Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30010960
Length (bp)1327
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30010960) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30010960) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30010960) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30010960) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010960

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010960SMESG000013824.1 SmedASXL_000270SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30010960SMESG000013824.1 SmedASXL_008393SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30010960SMESG000013824.1 dd_Smed_v4_30208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010960SMESG000013824.1 dd_Smed_v6_30208_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 59.3066 bits (142), Expect = 1.107e-8
Identity = 31/107 (28.97%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F L +  P  ++ +N+L+ V++K  +  +L CEV G P+P I W+K+   ++    H+         I S    L+  +V    +G YTC A +  GH  +S ++ V
Sbjct: 2470 FGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHH---------IISGGRFLQITNVQVPHTGRYTCLASSPAGHKSRSFSLNV 2567          

HSP 2 Score: 57.7658 bits (138), Expect = 4.014e-8
Identity = 34/108 (31.48%), Postives = 52/108 (48.15%), Query Frame = 3
Query:   75 KFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            K+ L +  P  +  +  + +V +   +  +L CEV G P P I+WYK+N+Q+       +  N  I         LK    T  D+G Y+C A N+ G  QK  NI+V
Sbjct: 1350 KYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTESSTIQTVNNGKI---------LKLFRATPEDAGRYSCKAINIAGTSQKYFNIDV 1448          

HSP 3 Score: 57.3806 bits (137), Expect = 4.530e-8
Identity = 37/128 (28.91%), Postives = 60/128 (46.88%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYK-NNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++AGD + + + E      K  L + +P   I + +  S+ I  G   +L C V G P PTI W + +N+ I  + F  S ++        RT  L   ++  SD G Y C A+N +G +Q    + V
Sbjct:  765 LDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEPADVSMEI--GSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFSVSSIS------QLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTV 884          

HSP 4 Score: 52.7582 bits (125), Expect = 1.451e-6
Identity = 30/111 (27.03%), Postives = 48/111 (43.24%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTT 446
            IQ   K ++++ G+   + C   G P+P I W K    +     H+         +++    L     T SD+G YTC A N+ G  +  I + VQ   T +   P  +TT
Sbjct: 1173 IQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHH---------VSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTT 1274          

HSP 5 Score: 51.2174 bits (121), Expect = 3.740e-6
Identity = 31/106 (29.25%), Postives = 46/106 (43.40%), Query Frame = 3
Query:  117 QNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPH 434
            Q+    + + +GEE +L CEV   P P I W K    I      ++F+  G          +K     TSDSG Y C A N+ G+V +++ + V      Q    H
Sbjct: 1083 QDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSG---------SMKITETRTSDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKH 1179          

HSP 6 Score: 50.8322 bits (120), Expect = 5.186e-6
Identity = 35/128 (27.34%), Postives = 61/128 (47.66%), Query Frame = 3
Query:   21 EAGDQSSLELGEVEVKISKFALHLSTPSALIIQNS--LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            + G+ + + + +      KF+L +  P ++   +S  L  V ++ G   SL CE +  P P I WYKN   I     H   +  G ++++ + +E+       SD+G Y C A NV G   K+ ++ V
Sbjct: 3029 DGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLSVVNVREGTSVSLECESNAVPPPVITWYKNGRMITES-THVEILADG-QMLHIKKAEV-------SDTGQYVCRAINVAGRDDKNFHLNV 3147          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 58.9214 bits (141), Expect = 1.340e-8
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:   93 STPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKR-QWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSV 476
            S P+A I    L  +++  G + ++  +V G P P ++W  N  +I+  + FH  F   G +        L  Q V   D+G YTC A N  G V+       Q V T Q   PH  T     SKP SV
Sbjct:  549 SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FEQRGTQ------HSLCIQEVFPEDTGTYTCEAWNSAGEVR------TQAVLTVQE--PHDGTQPWFISKPRSV 661          

HSP 2 Score: 51.2174 bits (121), Expect = 3.570e-6
Identity = 27/83 (32.53%), Postives = 35/83 (42.17%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            LK   +  G++F L C V G P+P I W  N   I+          Y      +  +EL  Q     D G YTC A+N  G V
Sbjct:  451 LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----------YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQV 523          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 58.9214 bits (141), Expect = 1.340e-8
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:   93 STPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKR-QWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSV 476
            S P+A I    L  +++  G + ++  +V G P P ++W  N  +I+  + FH  F   G +        L  Q V   D+G YTC A N  G V+       Q V T Q   PH  T     SKP SV
Sbjct:  549 SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FEQRGTQ------HSLCIQEVFPEDTGTYTCEAWNSAGEVR------TQAVLTVQE--PHDGTQPWFISKPRSV 661          

HSP 2 Score: 51.2174 bits (121), Expect = 3.570e-6
Identity = 27/83 (32.53%), Postives = 35/83 (42.17%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            LK   +  G++F L C V G P+P I W  N   I+          Y      +  +EL  Q     D G YTC A+N  G V
Sbjct:  451 LKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----------YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQV 523          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 58.9214 bits (141), Expect = 1.359e-8
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:   93 STPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKR-QWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSV 476
            S P+A I    L  +++  G + ++  +V G P P ++W  N  +I+  + FH  F   G +        L  Q V   D+G YTC A N  G V+       Q V T Q   PH  T     SKP SV
Sbjct:  618 SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FEQRGTQ------HSLCIQEVFPEDTGTYTCEAWNSAGEVR------TQAVLTVQE--PHDGTQPWFISKPRSV 730          

HSP 2 Score: 52.373 bits (124), Expect = 1.500e-6
Identity = 30/104 (28.85%), Postives = 44/104 (42.31%), Query Frame = 3
Query:   63 VKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            +++ + A+    PS     + LK   +  G++F L C V G P+P I W  N   I+          Y      +  +EL  Q     D G YTC A+N  G V
Sbjct:  502 LQVERLAVMEVAPS---FSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----------YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQV 592          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 58.9214 bits (141), Expect = 1.359e-8
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:   93 STPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKR-QWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSV 476
            S P+A I    L  +++  G + ++  +V G P P ++W  N  +I+  + FH  F   G +        L  Q V   D+G YTC A N  G V+       Q V T Q   PH  T     SKP SV
Sbjct:  618 SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FEQRGTQ------HSLCIQEVFPEDTGTYTCEAWNSAGEVR------TQAVLTVQE--PHDGTQPWFISKPRSV 730          

HSP 2 Score: 52.373 bits (124), Expect = 1.500e-6
Identity = 30/104 (28.85%), Postives = 44/104 (42.31%), Query Frame = 3
Query:   63 VKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            +++ + A+    PS     + LK   +  G++F L C V G P+P I W  N   I+          Y      +  +EL  Q     D G YTC A+N  G V
Sbjct:  502 LQVERLAVMEVAPS---FSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----------YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQV 592          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 51.9878 bits (123), Expect = 8.265e-7
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR--TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +   L+++RI   + F L C+  G P PTI W+K+  ++    F Y      +++I S     EL   S T  D+G Y C A+N YG  + S ++ V
Sbjct: 4704 LMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV----FPYG----RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNV 4792          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 51.9878 bits (123), Expect = 9.584e-7
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR--TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +   L+++RI   + F L C+  G P PTI W+K+  ++    F Y      +++I S     EL   S T  D+G Y C A+N YG  + S ++ V
Sbjct: 5177 LMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV----FPYG----RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNV 5265          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 51.6026 bits (122), Expect = 1.093e-6
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR--TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +   L+++RI   + F L C+  G P PTI W+K+  ++    F Y      +++I S     EL   S T  D+G Y C A+N YG  + S ++ V
Sbjct: 5177 LMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV----FPYG----RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNV 5265          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 51.6026 bits (122), Expect = 1.349e-6
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR--TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +   L+++RI   + F L C+  G P PTI W+K+  ++    F Y      +++I S     EL   S T  D+G Y C A+N YG  + S ++ V
Sbjct: 4624 LMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV----FPYG----RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNV 4712          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: unc-89 (Muscle M-line assembly protein unc-89 [Source:UniProtKB/Swiss-Prot;Acc:O01761])

HSP 1 Score: 51.2174 bits (121), Expect = 1.388e-6
Identity = 31/97 (31.96%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR--TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +   L+++RI   + F L C+  G P PTI W+K+  ++    F Y      +++I S     EL   S T  D+G Y C A+N YG  + S ++ V
Sbjct: 5322 LMEPLENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERV----FPYG----RLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNV 5410          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342823)

HSP 1 Score: 55.4546 bits (132), Expect = 1.024e-7
Identity = 32/106 (30.19%), Postives = 51/106 (48.11%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            + +  P+ + I    + +R+  G+E SL C   G P P + W  N + +KR  +             S T+ LK   VT +D+G YTCH +N  G  +  + +EVQ
Sbjct: 2454 ITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWV-NEMALKRDLYSPP----------SNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQ 2548          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342806)

HSP 1 Score: 55.4546 bits (132), Expect = 1.061e-7
Identity = 32/106 (30.19%), Postives = 51/106 (48.11%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            + +  P+ + I    + +R+  G+E SL C   G P P + W  N + +KR  +             S T+ LK   VT +D+G YTCH +N  G  +  + +EVQ
Sbjct: 3133 ITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWV-NEMALKRDLYSPP----------SNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQ 3227          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342816)

HSP 1 Score: 55.0694 bits (131), Expect = 1.096e-7
Identity = 32/106 (30.19%), Postives = 51/106 (48.11%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            + +  P+ + I    + +R+  G+E SL C   G P P + W  N + +KR  +             S T+ LK   VT +D+G YTCH +N  G  +  + +EVQ
Sbjct: 2998 ITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWV-NEMALKRDLYSPP----------SNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQ 3092          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: trol (gene:FBgn0284408 transcript:FBtr0342807)

HSP 1 Score: 55.0694 bits (131), Expect = 1.183e-7
Identity = 32/106 (30.19%), Postives = 51/106 (48.11%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            + +  P+ + I    + +R+  G+E SL C   G P P + W  N + +KR  +             S T+ LK   VT +D+G YTCH +N  G  +  + +EVQ
Sbjct: 2706 ITVQEPTLVQIIPDNRDLRLTEGDELSLTCVGSGVPNPEVEWV-NEMALKRDLYSPP----------SNTAILKIYRVTKADAGIYTCHGKNEAGSDEAHVRVEVQ 2800          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: bt (gene:FBgn0005666 transcript:FBtr0334482)

HSP 1 Score: 53.1434 bits (126), Expect = 5.114e-7
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  108 LIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +I ++SL  VRIK+G+ F+  C+V G P P   W     ++      YS  N  +  ++  T +LK  S T SDSG YT  A+N  G     + + V
Sbjct: 4474 IIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEV------YSKDNVKVTNVDYNT-KLKVNSATRSDSGIYTVFAENANGEDSADVKVTV 4563          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 58.5362 bits (140), Expect = 1.604e-8
Identity = 40/148 (27.03%), Postives = 65/148 (43.92%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITS 461
            +E G++  + + E E   S F    STP        +KS RI  G   +  C++ G+P+P I WYK+  +IK          Y + ++    + L+   V   D G YT  A N+ G+   S  + V+    AQ   P +   + + S
Sbjct:  664 IEDGEEMVINVAEHEAVASSF----STP--------VKSYRILEGMGVTFHCKMGGKPLPKIAWYKDGKRIKHGG------RYQMEVLQDGRASLRLPVVLPEDEGIYTAFASNMKGNAVSSGKLYVESTAAAQPYYPQAEAVRRVQS 793          

HSP 2 Score: 51.9878 bits (123), Expect = 1.731e-6
Identity = 37/120 (30.83%), Postives = 55/120 (45.83%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV--QKSINIEVQCVTTAQSAAPHS 437
            LH++ P    I   ++ + +++G+      EV G P P + WYKN+ Q     F   F+  G    N  T  L    V   D+  Y C A+N YG      S+N+EV  V +  + AP S
Sbjct: 2612 LHVNIPEPPQIIRHMQPLSVEAGKPARFSVEVTGIPQPQVSWYKNS-QALSSGFKCKFLREG----NEHT--LLLIEVFPEDAAQYNCEAKNDYGVATSSASLNVEVPEVVSPDTGAPLS 2724          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: nrg2b (neuregulin 2b [Source:ZFIN;Acc:ZDB-GENE-090205-2])

HSP 1 Score: 53.9138 bits (128), Expect = 1.918e-8
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRI-INSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFF 497
            + S  ++ G++ +L CE  G P P+  WYK+  Q++++          ++I  N + S+L    V   DSGNYTC  +N  G    +  + VQ +TT  S     +     T K + +     +F
Sbjct:   11 MDSQWLQEGKKLTLKCEAVGNPSPSFNWYKDGSQLRQK--------KTVKIKTNKKNSKLHISKVRLEDSGNYTCVVENSLGRENATSFVSVQSITTTLSPGSSHARKCNETEKTYCINGGDCYF 127          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: ttn.2 (titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-030113-2])

HSP 1 Score: 57.3806 bits (137), Expect = 3.100e-8
Identity = 40/148 (27.03%), Postives = 65/148 (43.92%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITS 461
            +E G++  + + E E   S F    STP        +KS RI  G   +  C++ G+P+P I WYK+  +IK          Y + ++    + L+   V   D G YT  A N+ G+   S  + V+    AQ   P +   + + S
Sbjct:  708 IEDGEEMVINVAEHEAVASSF----STP--------VKSYRILEGMGVTFHCKMGGKPLPKIAWYKDGKRIKHGG------RYQMEVLQDGRASLRLPVVLPEDEGIYTAFASNMKGNAVSSGKLYVESTAAAQPYYPQAEAVRRVQS 837          

HSP 2 Score: 49.6766 bits (117), Expect = 8.940e-6
Identity = 38/124 (30.65%), Postives = 56/124 (45.16%), Query Frame = 3
Query:   72 SKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV--QKSINIEVQCVTTAQSAAPHS 437
            S   LH++ P    I   ++ + +++G+      EV G P P + WYKN+ Q     F   F+  G    N  T  L    V   D+  Y C A+N YG      S+N+EV  V +  + AP S
Sbjct: 2652 SIVTLHVNIPEPPQIIRHMQPLSVEAGKPARFSVEVTGIPQPQVSWYKNS-QALSSGFKCKFLREG----NEHT--LLLIEVFPEDAAQYNCEAKNDYGVATSSASLNVEVPEVVSPDTGAPLS 2768          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: nrg2b (neuregulin 2b [Source:ZFIN;Acc:ZDB-GENE-090205-2])

HSP 1 Score: 53.9138 bits (128), Expect = 4.228e-8
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRI-INSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFF 497
            + S  ++ G++ +L CE  G P P+  WYK+  Q++++          ++I  N + S+L    V   DSGNYTC  +N  G    +  + VQ +TT  S     +     T K + +     +F
Sbjct:    9 MDSQWLQEGKKLTLKCEAVGNPSPSFNWYKDGSQLRQK--------KTVKIKTNKKNSKLHISKVRLEDSGNYTCVVENSLGRENATSFVSVQSITTTLSPGSSHARKCNETEKTYCINGGDCYF 125          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: nrg2a (neuregulin 2a [Source:ZFIN;Acc:ZDB-GENE-070615-10])

HSP 1 Score: 55.0694 bits (131), Expect = 5.522e-8
Identity = 32/99 (32.32%), Postives = 47/99 (47.47%), Query Frame = 3
Query:  135 VRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR-TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAA 428
            V    G    + CE  G P P   WYK+  ++KR           I+I N++  S+++  S    DSGNYTC A+N+ G    +  + VQ +TT  S  
Sbjct:    5 VLADEGSRLIVKCEATGSPAPEYKWYKDGAELKRSKE--------IKIRNNKKNSKVQIGSAKLEDSGNYTCVAENILGKANGTSTVHVQSITTTVSPG 95          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 56.9954 bits (136), Expect = 5.794e-8
Identity = 34/126 (26.98%), Postives = 56/126 (44.44%), Query Frame = 3
Query:   21 EAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +AG  + +        + K  L +  P  ++     K   I   +   ++CE HG P P I+W+K+ + + +          G R+  S T  L    V   D+G YTC A+N+ G V  S+N+ V
Sbjct: 3935 DAGTYTCIAQNPAGTALKKVRLKVHVPPVIVPHQ--KEYVISMDKSIMIVCEAHGSPTPEIIWHKDGVPLAKL--------AGQRM--SATGGLHIAVVQPDDAGEYTCTAENIAGSVNSSMNLSV 4048          

HSP 2 Score: 53.1434 bits (126), Expect = 9.721e-7
Identity = 35/106 (33.02%), Postives = 45/106 (42.45%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAP 431
            IQ   K +R+K G  F + C  HG P PT  WYK+  QI    F     N  +R+          +S   SD G YTC A NV G    +  +E+    T     P
Sbjct: 1156 IQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDG-QIME--FDQGQDNNMLRV----------ESAKPSDGGTYTCVASNVIGTDSANATVEIYAPPTLSDLEP 1248          

HSP 3 Score: 52.7582 bits (125), Expect = 1.348e-6
Identity = 32/96 (33.33%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  111 IIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            I++N +K V +   ++ +L C  HG P PTI W KNNL I  +   YS +  G         EL   +    D G YTC A N  G    ++ + V
Sbjct: 4054 IVKN-IKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASG---------ELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV 4139          

HSP 4 Score: 51.6026 bits (122), Expect = 2.901e-6
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 3
Query:   36 SSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +S E G+ E    K++L +  P  +   + + +V +   +  SL+CE  G P P I WYK   Q+          +  ++I+  +   LK   +   DSG+YTC A N+ G  +K   + V
Sbjct: 1319 ASNEAGQTE---KKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLLCEASGSPPPLITWYKGRTQVDE--------SATVQIL-EKGKILKILKMALKDSGHYTCKANNIAGESKKQYFVNV 1427          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 56.9954 bits (136), Expect = 6.102e-8
Identity = 34/126 (26.98%), Postives = 56/126 (44.44%), Query Frame = 3
Query:   21 EAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +AG  + +        + K  L +  P  ++     K   I   +   ++CE HG P P I+W+K+ + + +          G R+  S T  L    V   D+G YTC A+N+ G V  S+N+ V
Sbjct: 3934 DAGTYTCIAQNPAGTALKKVRLKVHVPPVIVPHQ--KEYVISMDKSIMIVCEAHGSPTPEIIWHKDGVPLAKL--------AGQRM--SATGGLHIAVVQPDDAGEYTCTAENIAGSVNSSMNLSV 4047          

HSP 2 Score: 53.1434 bits (126), Expect = 1.033e-6
Identity = 35/106 (33.02%), Postives = 45/106 (42.45%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAP 431
            IQ   K +R+K G  F + C  HG P PT  WYK+  QI    F     N  +R+          +S   SD G YTC A NV G    +  +E+    T     P
Sbjct: 1168 IQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDG-QIME--FDQGQDNNMLRV----------ESAKPSDGGTYTCVASNVIGTDSANATVEIYAPPTLSDLEP 1260          

HSP 3 Score: 52.373 bits (124), Expect = 1.457e-6
Identity = 32/96 (33.33%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  111 IIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            I++N +K V +   ++ +L C  HG P PTI W KNNL I  +   YS +  G         EL   +    D G YTC A N  G    ++ + V
Sbjct: 4053 IVKN-IKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASG---------ELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV 4138          

HSP 4 Score: 51.6026 bits (122), Expect = 3.162e-6
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 3
Query:   36 SSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +S E G+ E    K++L +  P  +   + + +V +   +  SL+CE  G P P I WYK   Q+          +  ++I+  +   LK   +   DSG+YTC A N+ G  +K   + V
Sbjct: 1331 ASNEAGQTE---KKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLLCEASGSPPPLITWYKGRTQVDE--------SATVQIL-EKGKILKILKMALKDSGHYTCKANNIAGESKKQYFVNV 1439          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 56.9954 bits (136), Expect = 6.372e-8
Identity = 34/126 (26.98%), Postives = 56/126 (44.44%), Query Frame = 3
Query:   21 EAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +AG  + +        + K  L +  P  ++     K   I   +   ++CE HG P P I+W+K+ + + +          G R+  S T  L    V   D+G YTC A+N+ G V  S+N+ V
Sbjct: 4004 DAGTYTCIAQNPAGTALKKVRLKVHVPPVIVPHQ--KEYVISMDKSIMIVCEAHGSPTPEIIWHKDGVPLAKL--------AGQRM--SATGGLHIAVVQPDDAGEYTCTAENIAGSVNSSMNLSV 4117          

HSP 2 Score: 52.7582 bits (125), Expect = 1.420e-6
Identity = 32/96 (33.33%), Postives = 45/96 (46.88%), Query Frame = 3
Query:  111 IIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            I++N +K V +   ++ +L C  HG P PTI W KNNL I  +   YS +  G         EL   +    D G YTC A N  G    ++ + V
Sbjct: 4123 IVKN-IKDVSVVINDQTTLPCAAHGIPTPTITWAKNNLPITVKAGKYSVLASG---------ELILYNAQHKDVGTYTCTASNAIGEDTHTVRLTV 4208          

HSP 3 Score: 51.6026 bits (122), Expect = 3.162e-6
Identity = 34/121 (28.10%), Postives = 57/121 (47.11%), Query Frame = 3
Query:   36 SSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            +S E G+ E    K++L +  P  +   + + +V +   +  SL+CE  G P P I WYK   Q+          +  ++I+  +   LK   +   DSG+YTC A N+ G  +K   + V
Sbjct: 1324 ASNEAGQTE---KKYSLKVHDPPLIKDMDIISNVSVLLHQTMSLLCEASGSPPPLITWYKGRTQVDE--------SATVQIL-EKGKILKILKMALKDSGHYTCKANNIAGESKKQYFVNV 1432          

HSP 4 Score: 50.447 bits (119), Expect = 6.740e-6
Identity = 32/85 (37.65%), Postives = 39/85 (45.88%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYG 368
            IQ   K +R+K G  F + C  HG P PT  WYK+  QI    F     N  +R+          +S   SD G YTC A NV G
Sbjct: 1170 IQRGPKLIRVKLGHSFEIACISHGIPPPTAAWYKDG-QIME--FDQGQDNNMLRV----------ESAKPSDGGTYTCVASNVIG 1241          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000024069.1 (hemicentin 2 [Source:NCBI gene;Acc:100490941])

HSP 1 Score: 55.4546 bits (132), Expect = 2.017e-7
Identity = 32/92 (34.78%), Postives = 47/92 (51.09%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            +K V+ K     +L CE    P PT+ WYK+   ++         + G++I+ S   EL+ Q +  SDSG YTC A NV G  +K   + VQ
Sbjct: 2390 IKEVKTKVNSSLTLQCESQAVPKPTLHWYKDGQLLES--------SGGVQIL-SDGQELQLQPIRLSDSGRYTCVATNVAGEDEKEFYVNVQ 2472          

HSP 2 Score: 50.0618 bits (118), Expect = 7.516e-6
Identity = 28/112 (25.00%), Postives = 50/112 (44.64%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQ 419
            + +  P +++     +S+ +  G +  L C+V   P PTI WY+ ++ ++           G   + S+   ++  S+  SDSG YTC A N  G       +E+Q     Q
Sbjct: 3300 VRMKVPPSVVGSTEPRSLAVSVGGQLVLECKVEADPPPTIQWYRGDIPLQTD---------GRVQVLSKGRYVQIHSLRPSDSGEYTCIASNPAGRTSLHFTVEIQLAPMIQ 3402          

HSP 3 Score: 50.0618 bits (118), Expect = 7.646e-6
Identity = 31/107 (28.97%), Postives = 46/107 (42.99%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F LH+ +   L    S + V    G   +  CE HG P+P++ W K+   +  Q            + N   + L  +SV   DSG Y+C A N  G V K  ++ V
Sbjct: 3116 FVLHIESLPVLERSESTEEVTAIKGASVTFTCEAHGTPLPSLSWEKDGQPLNLQ---------SNLLPNGLGTRLHLESVRALDSGIYSCIAVNAAGRVSKHFHLTV 3213          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: lrrc8c (leucine rich repeat containing 8 VRAC subunit C [Source:Xenbase;Acc:XB-GENE-5797483])

HSP 1 Score: 53.1434 bits (126), Expect = 9.874e-7
Identity = 36/118 (30.51%), Postives = 60/118 (50.85%), Query Frame = 3
Query:   48 LGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            +GE E ++++  + L  PS  + + S  +V +    EF   CE  G P+PT+ W K++  + +         Y IR  ++    LK + VT  D G+YTC A+N+ G  + S  + VQ
Sbjct:  249 VGERESEVAELTV-LERPS-FVRRPSNMAVTVDDSVEFK--CEARGDPVPTVRWRKDDGDLPKS-------RYEIRDDHT----LKIRKVTAGDMGSYTCVAENMVGKAEASAVLTVQ 351          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 60.8474 bits (146), Expect = 2.832e-9
Identity = 32/107 (29.91%), Postives = 52/107 (48.60%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F L +  P  ++ +N+L+ V+IK  +  +L CEV G P+P I W+K+   ++    H+           S    L+  +   S +G YTC A N+ G   KS  + V
Sbjct: 2469 FGLSVLVPPHIVGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLLQEDEAHHMM---------SGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNV 2566          

HSP 2 Score: 59.3066 bits (142), Expect = 7.599e-9
Identity = 36/128 (28.12%), Postives = 60/128 (46.88%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYK-NNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++AGD + + + E      +  L + +P   I + S  +V I  G   +L C V G P P I W + +N+ +  + F  SF++        RT  L   ++  SD G Y C A+N +G +Q    + V
Sbjct:  765 LDAGDYTCVAINEAGRATGRLTLDVGSPPVFIQEPSDVAVEI--GSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFIS------QLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTV 884          

HSP 3 Score: 56.6102 bits (135), Expect = 6.592e-8
Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 3
Query:   75 KFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            K+ L +  P  +  +  + +V + + +  SL CEV G P P I WYK+++Q+          +  ++I+N+    LK   V+  D+G Y+C A N+ G  QK  ++ V
Sbjct: 1349 KYNLKVHVPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTE--------SSTVQIVNN-GKILKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNV 1447          

HSP 4 Score: 52.7582 bits (125), Expect = 1.031e-6
Identity = 28/110 (25.45%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSST 443
            IQ+  + ++++ G+   ++C  HG P P I W+K+            F++ G +   S    L  +    SD+G YTC A N+ G  +  + + VQ   + +   P  +T
Sbjct: 1173 IQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSG---------RPFLD-GAQHPGSPDGTLSIEQAVISDAGVYTCAATNIAGSDEAEVTLHVQEPPSVEDLQPPFNT 1272          

HSP 5 Score: 51.2174 bits (121), Expect = 2.896e-6
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 3
Query:  165 LICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            L CE  G P+P I WYK+  Q+        +++ G          L  Q    SDS  YTCHA NV G  +KS ++++
Sbjct: 1566 LECETRGLPVPAITWYKDG-QVVTSSSQALYIDKG--------QLLHIQRAQVSDSATYTCHAANVAGTAEKSFHVDI 1634          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 60.077 bits (144), Expect = 4.363e-9
Identity = 32/107 (29.91%), Postives = 53/107 (49.53%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F L +  P  ++ +N+L+ V+IK  +  +L CEV G P+P I W+K+   ++    H+         + S    L+  +   S +G YTC A N+ G   KS  + V
Sbjct: 2469 FGLSVLVPPHIVGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLLQEDEAHH---------MMSGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNV 2566          

HSP 2 Score: 58.151 bits (139), Expect = 1.757e-8
Identity = 34/124 (27.42%), Postives = 61/124 (49.19%), Query Frame = 3
Query:   27 GDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            G+   + + E      K+ L +  P  +  +  + +V + + +  SL CEV G P P I WYK+++Q+          +  ++I+N+    LK   V+  D+G Y+C A N+ G  QK  ++ V
Sbjct: 1333 GEYICVAVNEAGTTERKYNLKVHVPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTE--------SSTVQIVNN-GKILKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNV 1447          

HSP 3 Score: 57.3806 bits (137), Expect = 3.856e-8
Identity = 35/128 (27.34%), Postives = 60/128 (46.88%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYK-NNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++AGD + + + E      +  L + +P   I + S   V ++ G   +L C V G P P I W + +N+ +  + F  SF++        RT  L   ++  SD G Y C A+N +G +Q    + V
Sbjct:  765 LDAGDYTCVAINEAGRATGRLTLDVGSPPVFIQEPS--DVAVEIGSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFIS------QLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTV 884          

HSP 4 Score: 50.8322 bits (120), Expect = 3.877e-6
Identity = 30/100 (30.00%), Postives = 44/100 (44.00%), Query Frame = 3
Query:  165 LICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSK 464
            L CE  G P+P I WYK+  Q+        +++ G          L  Q    SDS  YTCHA NV G  +KS ++++    T +      S  + I  +
Sbjct: 1566 LECETRGLPVPAITWYKDG-QVVTSSSQALYIDKG--------QLLHIQRAQVSDSATYTCHAANVAGTAEKSFHVDIYVPPTIEGDLTAPSNKQVIIGQ 1656          

HSP 5 Score: 50.447 bits (119), Expect = 4.725e-6
Identity = 28/110 (25.45%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSST 443
            IQ+  + ++++ G+   ++C  HG P P I W+K+            F++ G +   S    L  +    SD+G YTC A N+ G  +  + + VQ   + +   P  +T
Sbjct: 1173 IQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSG---------RPFLD-GAQHPGSPDGTLSIEQAVISDAGVYTCAATNIAGSDEAEVTLHVQEPPSVEDLQPPFNT 1272          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Hmcn2 (hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838])

HSP 1 Score: 54.6842 bits (130), Expect = 2.141e-7
Identity = 34/131 (25.95%), Postives = 55/131 (41.98%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTS-ELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKP 467
            F L + +P  +   N    V +  G    L+CE  G P P I WYK+           + +     ++ S+   +L+      SD+G YTC A N  G  +KS ++EV    T + A       + +  +P
Sbjct: 1528 FQLSIHSPPTIWGSNETGEVTVLEGHTAQLLCEARGMPSPAITWYKDG----------TLLAPSSEVVYSKGGRQLQLVKAQPSDAGLYTCQASNPAGITKKSTSLEVYVPPTIEGADGGPYLVQAVAGRP 1648          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Ncam2 (neural cell adhesion molecule 2 [Source:MGI Symbol;Acc:MGI:97282])

HSP 1 Score: 53.1434 bits (126), Expect = 5.875e-7
Identity = 29/113 (25.66%), Postives = 52/113 (46.02%), Query Frame = 3
Query:   60 EVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            E+      + ++ P A+++     +   + GEE +L C+  G P PTI W++N   I+    +         I+    +EL  +++   D G+Y C A N  G  QK   ++V
Sbjct:  195 EIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDPTISWFRNGKLIEENEKY---------ILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAFLQV 298          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Palld (palladin, cytoskeletal associated protein [Source:MGI Symbol;Acc:MGI:1919583])

HSP 1 Score: 52.373 bits (124), Expect = 5.987e-7
Identity = 39/136 (28.68%), Postives = 59/136 (43.38%), Query Frame = 3
Query:    6 FKYKMEAG--DQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCV 407
             +Y++E    D+S  E+ + +V +          +A   +  LK  +I  G   +  C V G P P I W+K+  QI  +  HY+     I+     T  L   + T  D GNYT  A N  G V  +  + VQ V
Sbjct:   41 IEYRLERSPVDESGDEVQDPDVPVENA-------TAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYT-----IQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRVSCTGRLMVQAV 164          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.981e-8
Identity = 32/107 (29.91%), Postives = 52/107 (48.60%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F L +  P  ++ +N+L+ V+IK  +  +L CEV G P+P I W+K+   ++    H+           S    L+  +   S +G YTC A N+ G   KS  + V
Sbjct: 2469 FGLSVLVPPHIVGENTLEDVKIKEKQSVTLTCEVRGNPVPQITWHKDGQLLQEDEAHHMM---------SGGRFLQITNAQVSHTGRYTCLASNIAGDKSKSFRLNV 2566          

HSP 2 Score: 59.3066 bits (142), Expect = 5.315e-8
Identity = 36/128 (28.12%), Postives = 60/128 (46.88%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYK-NNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++AGD + + + E      +  L + +P   I + S  +V I  G   +L C V G P P I W + +N+ +  + F  SF++        RT  L   ++  SD G Y C A+N +G +Q    + V
Sbjct:  765 LDAGDYTCVAINEAGRATGRLTLDVGSPPVFIQEPSDVAVEI--GSNVTLPCYVQGYPEPKIKWRRLDNMPVFSRPFSVSFIS------QLRTGALFISNLWASDKGTYICEAENQFGKIQSQTTVTV 884          

HSP 3 Score: 56.6102 bits (135), Expect = 4.611e-7
Identity = 32/108 (29.63%), Postives = 56/108 (51.85%), Query Frame = 3
Query:   75 KFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            K+ L +  P  +  +  + +V + + +  SL CEV G P P I WYK+++Q+          +  ++I+N+    LK   V+  D+G Y+C A N+ G  QK  ++ V
Sbjct: 1349 KYNLKVHVPPVIRDKEHVTNVSVLTSQLASLYCEVEGTPSPVITWYKDDIQVTE--------SSTVQIVNN-GKILKLFKVSAEDAGRYSCKAINIAGTSQKDFSVNV 1447          

HSP 4 Score: 52.7582 bits (125), Expect = 7.213e-6
Identity = 28/110 (25.45%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSST 443
            IQ+  + ++++ G+   ++C  HG P P I W+K+            F++ G +   S    L  +    SD+G YTC A N+ G  +  + + VQ   + +   P  +T
Sbjct: 1173 IQHGNRHIKVQVGQRVDILCNAHGSPPPVITWFKSG---------RPFLD-GAQHPGSPDGTLSIEQAVISDAGVYTCAATNIAGSDEAEVTLHVQEPPSVEDLQPPFNT 1272          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 59.3066 bits (142), Expect = 5.315e-8
Identity = 31/107 (28.97%), Postives = 54/107 (50.47%), Query Frame = 3
Query:   78 FALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            F L +  P  ++ +N+L+ V++K  +  +L CEV G P+P I W+K+   ++    H+         I S    L+  +V    +G YTC A +  GH  +S ++ V
Sbjct: 2470 FGLSVLVPPHIVGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQPLQEDEAHH---------IISGGRFLQITNVQVPHTGRYTCLASSPAGHKSRSFSLNV 2567          

HSP 2 Score: 57.7658 bits (138), Expect = 1.928e-7
Identity = 34/108 (31.48%), Postives = 52/108 (48.15%), Query Frame = 3
Query:   75 KFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            K+ L +  P  +  +  + +V +   +  +L CEV G P P I+WYK+N+Q+       +  N  I         LK    T  D+G Y+C A N+ G  QK  NI+V
Sbjct: 1350 KYNLKVHVPPVIKDKEQVTNVSVLLNQLTNLFCEVEGTPSPIIMWYKDNVQVTESSTIQTVNNGKI---------LKLFRATPEDAGRYSCKAINIAGTSQKYFNIDV 1448          

HSP 3 Score: 57.3806 bits (137), Expect = 2.175e-7
Identity = 37/128 (28.91%), Postives = 60/128 (46.88%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYK-NNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++AGD + + + E      K  L + +P   I + +  S+ I  G   +L C V G P PTI W + +N+ I  + F  S ++        RT  L   ++  SD G Y C A+N +G +Q    + V
Sbjct:  765 LDAGDYTCVAINEAGRATGKITLDVGSPPVFIQEPADVSMEI--GSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFSVSSIS------QLRTGALFILNLWASDKGTYICEAENQFGKIQSETTVTV 884          

HSP 4 Score: 52.7582 bits (125), Expect = 6.969e-6
Identity = 30/111 (27.03%), Postives = 48/111 (43.24%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTT 446
            IQ   K ++++ G+   + C   G P+P I W K    +     H+         +++    L     T SD+G YTC A N+ G  +  I + VQ   T +   P  +TT
Sbjct: 1173 IQRGPKHLKVQVGQRVDIPCNAQGTPLPVITWSKGGSTMLVDGEHH---------VSNPDGTLSIDQATPSDAGIYTCVATNIAGTDETEITLHVQEPPTVEDLEPPYNTT 1274          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15746|MYLK_HUMAN (Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4)

HSP 1 Score: 58.9214 bits (141), Expect = 6.524e-8
Identity = 41/129 (31.78%), Postives = 57/129 (44.19%), Query Frame = 3
Query:   93 STPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKR-QWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSV 476
            S P+A I    L  +++  G + ++  +V G P P ++W  N  +I+  + FH  F   G +        L  Q V   D+G YTC A N  G V+       Q V T Q   PH  T     SKP SV
Sbjct:  618 SKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFH--FEQRGTQ------HSLCIQEVFPEDTGTYTCEAWNSAGEVR------TQAVLTVQE--PHDGTQPWFISKPRSV 730          

HSP 2 Score: 52.373 bits (124), Expect = 7.202e-6
Identity = 30/104 (28.85%), Postives = 44/104 (42.31%), Query Frame = 3
Query:   63 VKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            +++ + A+    PS     + LK   +  G++F L C V G P+P I W  N   I+          Y      +  +EL  Q     D G YTC A+N  G V
Sbjct:  502 LQVERLAVMEVAPS---FSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQ----------YARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQV 592          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86TC9|MYPN_HUMAN (Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 3.338e-7
Identity = 37/134 (27.61%), Postives = 58/134 (43.28%), Query Frame = 3
Query:    6 FKYKMEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCV 407
            F+ +    D+S  E+   E+   K         A I    LK  R+  G   +  C++ G P+P + W+K+  QI ++  H      G       T  L  +S T+ D GNYT  A N  G +  S ++ VQ +
Sbjct:  918 FRLERTPVDESDDEIQHDEIPTGKCI-------APIFDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKMRREG-----DGTCSLHIESTTSDDDGNYTIMAANPQGRISCSGHLMVQSL 1039          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C5E3|PALLD_RAT (Palladin (Fragment) OS=Rattus norvegicus OX=10116 GN=Palld PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 7.752e-7
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query:    6 FKYKMEAG--DQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCV 407
             +Y++E    ++S  E+ E EV +   A       A   +  LK  +I  G   +  C V G P P I W+K+  QI  +  HY+      R ++  T  L   + T  D GNYT  A N  G V  +  + VQ V
Sbjct:  249 IEYRLERSPVEESGDEVQEAEVPVENAA-------APFFEMKLKHYKIFEGMPVTFTCRVAGSPKPKIYWFKDGKQISPKSDHYTIQ----RDVDG-TCSLHTTASTLDDDGNYTIMAANTQGRVSCTGRLMVQAV 372          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A2H1CLL8 (Immunoglobulin domain protein OS=Fasciola hepatica OX=6192 GN=D915_04233 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.239e-14
Identity = 43/123 (34.96%), Postives = 71/123 (57.72%), Query Frame = 3
Query:   33 QSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSF-VNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            + S++ GEVEV+I++F + +S P  +        + +  G +  L C+V GRP P I W+ N+++IK  W    F V  GI   +   S+L+   V+   +GNYTC A+N+ GH++KS+ + V
Sbjct:   43 KPSVDFGEVEVRITQFMVLISYPLQMRPLYHADQLSVDEGNDLLLSCQVRGRPTPLISWFFNDVEIKTPW---KFGVKQGIIQTSRHLSKLQLAKVSPDQTGNYTCLAENLNGHIRKSVQLIV 162          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: W6ULJ1 (Schwann cell myelin protein OS=Echinococcus granulosus OX=6210 GN=EGR_02858 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.452e-14
Identity = 44/121 (36.36%), Postives = 72/121 (59.50%), Query Frame = 3
Query:   30 DQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINI 392
            ++++++  EVEV+I++F + LS+P  +   +  +S++++ GEE  L C V GRP P I WY NN Q    W        G+   N R S L+  +    DSGNY+C A+NV G+++K++ I
Sbjct:    7 NETTVDPNEVEVRITRFTVTLSSPLQMRSLHHQESLKVQQGEEVVLSCVVMGRPAPLISWYVNNTQQLGLW--NMATGRGVIHKNKRKSRLQISNTHPMDSGNYSCLAENVNGYIKKTVEI 125          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4Z2CRY1 (Schwann cell myelin protein (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_008013 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.446e-14
Identity = 44/121 (36.36%), Postives = 69/121 (57.02%), Query Frame = 3
Query:   39 SLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            +L+ GEVEV+IS+F + +S P  +        +++  G +  L C V GRP P I WY N  +IK  W   +    GI   +   S+L+  +V  +D+ NYTC A+NV GH++KS+ + V+
Sbjct:   25 NLDYGEVEVRISQFMVLMSDPLQMRSLYHEDVLKVNEGNDLLLSCRVRGRPTPLISWYVNQTEIKYPWRLET--GRGIIQKSRYLSKLQLSNVHPTDNANYTCLAENVNGHIRKSVKVIVK 143          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A094ZCH8 (Schwann cell myelin protein (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_00083 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.427e-9
Identity = 57/198 (28.79%), Postives = 94/198 (47.47%), Query Frame = 3
Query:  135 VRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHD-CLRNPCRMNNSVGKRISYKTCVCSGKNISPKCQMVEFRKHQIYSNNEQIEQNSFKSCKDGCDPNTSR 725
            +++  G +  L C V GRP P I WY N  +IK  W   +    GI   +   S+L+  +V T+D+ NYTC A+N+ GH++KS+ + V+   T       +    T      SV         PC   H+ C R  C + +  GK   Y +C+   + +  +C +    K + + +   I ++ F SC+ GC+ N +R
Sbjct:   10 LKVNEGNDLLLSCRVRGRPTPLISWYINQTEIKNPWRLET--GRGIIQKSRYLSKLQLSNVHTTDNANYTCLAENLNGHIRKSVQVIVK-PATTSPPPTTTPPPTTTEMTTTSVH--------PC---HNYCHRGHCYIID--GK--PYCSCISQYRGV--RCDLFTPEKEENHLDQLPINESKFDSCESGCESNLAR 187          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A068WFM1 (Pro neuregulin 2 membrane bound OS=Echinococcus granulosus OX=6210 GN=EgrG_000634200 PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.927e-9
Identity = 41/113 (36.28%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  129 KSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKP 467
            +S++++ GEE  L C V GRP P I WY NN Q    W   +    G+   N R S L+  +    DSGNY+C A+NV G+++K++ I V  V   Q+     +T   +T +P
Sbjct:  187 ESLKVQQGEEVVLSCVVMGRPAPLISWYVNNTQQLGLWNMAT--GRGVIHKNKRKSRLQISNTHPMDSGNYSCLAENVNGYIKKTVEIYV--VPRPQTTPQPWTTLPPLTGRP 295          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: mxra5b (matrix-remodelling associated 5b [Source:ZFIN;Acc:ZDB-GENE-081104-119])

HSP 1 Score: 55.8398 bits (133), Expect = 7.140e-8
Identity = 38/119 (31.93%), Postives = 57/119 (47.90%), Query Frame = 3
Query:   45 ELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKN-NLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            ++G+ E+K+    + +   +A I  N+ + +R+  G+  SL C   G P PTI W+   N  I      Y   N G  +I         Q   T DSGNYTC A+N  G  +K + +EV
Sbjct: 1964 QIGKDEMKV---YIKVVAAAATIRNNTYEVIRVPYGDTASLSCSAKGEPSPTITWFSPINRIILPASDKYHVTNDGTLLI---------QKFQTFDSGNYTCSAKNSAGTDRKVVRVEV 2070          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000056836.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:23743368:23934807:-1 gene:ENSAMXG00000001638.2 transcript:ENSAMXT00000056836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 8.148e-8
Identity = 38/130 (29.23%), Postives = 61/130 (46.92%), Query Frame = 3
Query:   48 LGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKS----INIEVQCVTTAQSA 425
            +GE E +I++  + L  PS         SV + + E     CE  G P PTI W K + ++ +  +          I+   T  L  Q VT +D G+Y+C A+N+ G  + S    +++ VQC+   Q A
Sbjct:  260 VGERESEIAELTV-LERPS---FTRRPSSVVVLADESVEFRCEARGDPFPTIRWRKEDGELPKGRYE---------ILEDHT--LSLQRVTPADVGSYSCLAENMVGKAEASATLTVHVHVQCLLPLQCA 374          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: nrg2b (pro-neuregulin-2, membrane-bound isoform-like [Source:NCBI gene;Acc:103042778])

HSP 1 Score: 55.4546 bits (132), Expect = 8.387e-8
Identity = 30/103 (29.13%), Postives = 53/103 (51.46%), Query Frame = 3
Query:  123 SLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRI-INSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAA 428
            +++S  +  G+  +L CE  G P P+  W+K+  ++++        +  ++I  N + S+++   V   DSGNYTC A+N  G    +  I VQ +TT  S  
Sbjct:  274 TMRSQWVWEGDRVTLKCEAQGNPSPSFRWFKDGSELRK--------SKDVKIKTNKKNSKIQISRVRLEDSGNYTCVAENSLGKENSTSYINVQSITTTLSPG 368          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: nrg2b (pro-neuregulin-2, membrane-bound isoform-like [Source:NCBI gene;Acc:103042778])

HSP 1 Score: 55.4546 bits (132), Expect = 9.585e-8
Identity = 30/103 (29.13%), Postives = 53/103 (51.46%), Query Frame = 3
Query:  123 SLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRI-INSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAA 428
            +++S  +  G+  +L CE  G P P+  W+K+  ++++        +  ++I  N + S+++   V   DSGNYTC A+N  G    +  I VQ +TT  S  
Sbjct:  274 TMRSQWVWEGDRVTLKCEAQGNPSPSFRWFKDGSELRK--------SKDVKIKTNKKNSKIQISRVRLEDSGNYTCVAENSLGKENSTSYINVQSITTTLSPG 368          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000003826.2 (myopalladin [Source:NCBI gene;Acc:103025959])

HSP 1 Score: 55.4546 bits (132), Expect = 9.871e-8
Identity = 32/99 (32.32%), Postives = 48/99 (48.48%), Query Frame = 3
Query:  105 ALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            A + +  LK+ +   G   +  C+V G P+P + W+K+  QI ++  HY  +  G       T  L   SVT  D GNYT  A N  G +  S ++ VQ
Sbjct: 1474 APLFEKKLKNFKAVEGIPVTFTCKVVGIPVPKVYWFKDGKQILKKNVHYRRIREG-----DGTCSLHINSVTNDDDGNYTVMAANPQGRMSCSGHLIVQ 1567          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002502.1 (pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-1 gene:ENSPMAG00000002253.1 transcript:ENSPMAT00000002502.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 8.917e-8
Identity = 29/101 (28.71%), Postives = 47/101 (46.53%), Query Frame = 3
Query:  102 SALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQW-FHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            +A +++  LK   +  GE   + C+V G P P I+W++   +I+R   F  +F         +  + L  +     DSG +TC A N  G V  S  + VQ
Sbjct:  375 AATVVKEGLKDTTVVEGESVRMECQVAGFPTPAIMWFREEYRIERSADFQIAF--------QAGVASLTIREAFAEDSGRFTCTATNEAGTVSTSSYLLVQ 467          

HSP 2 Score: 46.9802 bits (110), Expect = 8.561e-6
Identity = 26/71 (36.62%), Postives = 37/71 (52.11%), Query Frame = 3
Query:  165 LICEVHGRPIPTILWYKNNLQIKRQW-FHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHV 374
            L C + G P+  + W+KN+ ++K       SFVN  + ++  R SE       T DS +YTC AQN  G V
Sbjct: 4362 LDCSLKGSPVIKVTWFKNDNEVKADGRVQLSFVN-NVAVLEIRDSE-------TEDSADYTCEAQNEVGTV 4424          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006750.1 (pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 gene:ENSPMAG00000006079.1 transcript:ENSPMAT00000006750.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 9.547e-8
Identity = 43/178 (24.16%), Postives = 70/178 (39.33%), Query Frame = 3
Query:  135 VRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHDCLRNPCRMNNSVGKRISYKTCVCSGKNISPKCQMVEFRKHQIYSNNEQ 668
            V  + G    L C V G P P I+W K+   I   W  Y  +  G+R+     +EL+       D+G +TC A N +G V  + ++ V    T     P     +   S        +  + KP  +    +R    +   VG  +  K C   G   SP+  +V F+   ++ +  Q
Sbjct:   37 VLARVGRTLKLSCPVEGDPPPLIMWSKDGRNIHSGWMRYRVLRDGLRV-----TELE-----PDDAGVFTCQATNGFGSVTINYSLAVIANITIPPYLPAPCLREPNASMQIQKPGGQPRWMKPRFTQPAKMRRRV-IARPVGSSVRLK-CNAGG---SPRPDVVWFKDEHVFGDAAQ 199          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007382.1 (pep scaffold:Pmarinus_7.0:GL476981:74023:86492:-1 gene:ENSPMAG00000006664.1 transcript:ENSPMAT00000007382.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.560e-7
Identity = 29/81 (35.80%), Postives = 41/81 (50.62%), Query Frame = 3
Query:  159 FSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
              L C+V+G P P I WY+N    +R   H S V     +++     L+ Q VT+ D G YTC A+N +G    S  + VQ
Sbjct:   18 LRLHCQVYGVPAPRITWYQN----RRSLPHNSGV-----LLSDLNRTLEVQRVTSEDEGEYTCVAENAHGRALTSAYVRVQ 89          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002463.1 (pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 gene:ENSPMAG00000002229.1 transcript:ENSPMAT00000002463.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 9.155e-7
Identity = 36/104 (34.62%), Postives = 53/104 (50.96%), Query Frame = 3
Query:   93 STPSALIIQNSLKS-VRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRT-SELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            + P  + +  S+KS + +K+G   SL   V G+P PTI W K  L++K           GI+I   R  + L+  SVT S SG YT  A+N  G    +I ++V
Sbjct: 5193 NVPPRIELDVSMKSLITVKAGANVSLAGTVFGKPKPTITWKKETLEVK--------AAEGIKISTVRNHTALELFSVTRSQSGEYTIIAENASGSKFANIKLKV 5288          

HSP 2 Score: 48.521 bits (114), Expect = 3.126e-6
Identity = 28/91 (30.77%), Postives = 46/91 (50.55%), Query Frame = 3
Query:  129 KSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTS-ELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            K++ +K+G  FSL     G+P P ++W K +  ++        +  GI   N+RTS  L  +    SDSG YT   QN+ G    ++ ++V
Sbjct: 12099 KTILVKAGTHFSLSVGFKGKPTPNVMWSKPDTDLR--------IRAGIN--NTRTSTTLSIEKANRSDSGKYTLTVQNLVGSASVTLGVKV 12179          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008285.1 (pep scaffold:Pmarinus_7.0:GL481193:15019:35761:-1 gene:ENSPMAG00000007495.1 transcript:ENSPMAT00000008285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.1358 bits (113), Expect = 3.975e-6
Identity = 33/110 (30.00%), Postives = 47/110 (42.73%), Query Frame = 3
Query:  150 GEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVF 479
            G   +  C V GRP PT+ W ++   +      Y F+  G   +++    LK  SV  SD G Y+C  +N  G V  S  + V       S  P  ST   +T   H+ F
Sbjct:    3 GYSATFTCMVSGRPAPTVTWQRDGKNVDNFVDSYRFLTEGRDGMHT----LKINSVRPSDMGTYSCKVKNSAGEVNASAILGVPSEQILWSKPP--STAYEVTEGKHARF 106          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO49554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL8])

HSP 1 Score: 50.0618 bits (118), Expect = 1.372e-6
Identity = 28/99 (28.28%), Postives = 42/99 (42.42%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIK---RQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQ 401
            + + L  V +  G +  L+C+V   P PT+ WYK +  +K   R   H+          + R S L  Q  T  D G Y C  QN  G     + + V+
Sbjct:   17 LSSQLMPVEVTEGNDIDLVCKVSVNPKPTVTWYKGDALVKLDDRISAHF----------DGRFSRLSIQKATKDDEGIYICDVQNELGKAFSKVELTVR 105          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO43171 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZN6])

HSP 1 Score: 50.0618 bits (118), Expect = 1.426e-6
Identity = 39/151 (25.83%), Postives = 72/151 (47.68%), Query Frame = 3
Query:   81 ALHLSTPS--------ALIIQNSLKSVRIK--SGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKS-INIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFE 500
            A H+ TPS        A + + ++K++RI+   G +  L C  +G P P I W+ N  +++ +  ++  +         R   L  +S+  SDSG YTC  +N +G ++++ I   ++  +T + A   S+    I    H + +NK   E
Sbjct:  144 AAHIITPSPPPPVKVQAPVFRRNIKALRIRLEEGSQLKLRCHANGSPQPKIQWHHNGKKLRSRRRNHVIL---------RGWVLNIRSLRQSDSGRYTCIVKNKHGTIRRTYIVSPLKSRSTGEPALEPSNAPNGIDINTH-LLKNKTAVE 284          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO49552 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL6])

HSP 1 Score: 49.6766 bits (117), Expect = 1.506e-6
Identity = 30/103 (29.13%), Postives = 47/103 (45.63%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPH 434
            L+ +    GEE   +  V G PIPT+ W+K++  IK +     F  Y     + R   L ++     D G Y C  +N  G V  S N+    + + +SA+P 
Sbjct:  185 LRPLETLEGEETKFVVNVSGEPIPTVEWFKDDTPIKHE---DRFRTY----FDGRVCMLVFRKTGLDDQGIYKCVLRNDVGTVSSSANL----IVSKKSASPQ 276          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO32296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH4])

HSP 1 Score: 49.2914 bits (116), Expect = 1.919e-6
Identity = 27/85 (31.76%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  114 IQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYG 368
            I N+L +++   G + +LIC   GRP PTI W++   +++ +       N G          L  + V++SD G YTC A+N +G
Sbjct:   47 IGNNLTTMK---GRKLTLICHATGRPRPTITWFRGGEEMRTK-----VTNNG---------SLILEKVSSSDIGRYTCTARNAFG 114          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO49553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL7])

HSP 1 Score: 48.521 bits (114), Expect = 3.892e-6
Identity = 26/92 (28.26%), Postives = 42/92 (45.65%), Query Frame = 3
Query:  126 LKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIK-RQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            L+ + I  G++F L C V GRP P + W+++ + IK  + F  S+        +   S L  +     D G Y C   N +G V    ++ V
Sbjct:   22 LEPIEITEGDDFQLSCNVTGRPQPEVQWFRDEVLIKPSRRFKASY--------DGNVSALTVKEAELDDDGVYKCVVTNNFGSVSSKADVTV 105          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ncam1b (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101167636])

HSP 1 Score: 53.9138 bits (128), Expect = 2.815e-7
Identity = 33/116 (28.45%), Postives = 57/116 (49.14%), Query Frame = 3
Query:   51 GEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            GE+++++ K  +++  P+  I+Q+ L +     G+   + C V G P P + W +N + ++     YSF        N   SE+    VT  D G YTC A+N  G   K +++ V
Sbjct:  195 GEIDLRVIKVIVNVR-PTVRILQSELNATA-DVGQPAKMTCAVDGFPEPMVTWTRNGVDLEPG-EKYSF--------NEDGSEITIMDVTKLDEGEYTCIAKNKAGKDDKELSLRV 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: hmcn1 (hemicentin 1 [Source:NCBI gene;Acc:101172646])

HSP 1 Score: 53.9138 bits (128), Expect = 3.009e-7
Identity = 39/115 (33.91%), Postives = 52/115 (45.22%), Query Frame = 3
Query:   84 LHLSTPSALIIQNSLKSVRIKS-GEEFSLICEVHGRPIPTILWYKNNLQIK-----RQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVT 410
            +H+  P   II   L S R++  G    L CEV G P PTI W KN + I+     RQ F+ S   YG                 + D+G Y C A N  G V++SI + +Q  T
Sbjct: 4086 VHVKPP---IIDGDLHSNRVEPLGGNTILNCEVRGDPPPTIQWSKNGVNIQIGNRIRQMFNGSLAIYG---------------TVSEDAGIYMCVATNDAGVVERSITLTLQAPT 4182          

HSP 2 Score: 51.9878 bits (123), Expect = 1.114e-6
Identity = 28/100 (28.00%), Postives = 47/100 (47.00%), Query Frame = 3
Query:   99 PSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            P  L    S + V +  G   SL+C   G P+PTI W + ++ +           + IR++N  T+ L+      +D+G+YTC   N  G   +  N++V
Sbjct: 3193 PPGLDGAGSTEDVTVIRGNTASLLCVADGTPVPTISWLREDVPV--------LSEHNIRLLNLNTT-LQISLAQVNDTGHYTCKVYNTAGEASRHFNLKV 3283          

HSP 3 Score: 50.8322 bits (120), Expect = 2.750e-6
Identity = 31/109 (28.44%), Postives = 56/109 (51.38%), Query Frame = 3
Query:   72 SKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            SK+ + +  PS L   +S +++ +      +L CE  G P+PTI W K+N  I+         +  + I++ R+  L + +VT  D+G YTC   N  G  +K+ ++ +
Sbjct: 2176 SKYDVSVHPPSILGQVHSPENISVVVKNPVALTCEASGIPLPTISWLKDNQPIQ--------TSSSVLILSGRSVRLMHTAVT--DAGRYTCIVSNSGGEERKNFDLVI 2274          

HSP 4 Score: 50.0618 bits (118), Expect = 4.768e-6
Identity = 28/83 (33.73%), Postives = 40/83 (48.19%), Query Frame = 3
Query:  150 GEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            G+   L+C+    P PT+ W K+   +        F   G+ I+    S LK  S    DSG YTC A NV G  +K+ N++V
Sbjct: 1925 GQSVELLCQSDAIPPPTLSWRKDGRPL--------FRKPGL-IVADHGSRLKINSAQVQDSGRYTCEATNVAGKTEKNYNLDV 1998          

HSP 5 Score: 49.6766 bits (117), Expect = 7.585e-6
Identity = 31/95 (32.63%), Postives = 45/95 (47.37%), Query Frame = 3
Query:  123 SLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCV 407
            S K V++      +L C     P PT+ WYK+  QI R   H S         N R  ++K+  V  SD+G YTC A NV G  +   ++ +Q +
Sbjct: 2477 SSKEVKVTINSTLTLECVAQAFPSPTLQWYKDG-QILRADDHVSVT------ANGRIVQIKHAQV--SDTGRYTCVATNVAGEDEMDFDVNIQVI 2562          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ncam1b (neural cell adhesion molecule 1 [Source:NCBI gene;Acc:101167636])

HSP 1 Score: 53.1434 bits (126), Expect = 3.766e-7
Identity = 33/116 (28.45%), Postives = 57/116 (49.14%), Query Frame = 3
Query:   51 GEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEV 398
            GE+++++ K  +++  P+  I+Q+ L +     G+   + C V G P P + W +N + ++     YSF        N   SE+    VT  D G YTC A+N  G   K +++ V
Sbjct:  195 GEIDLRVIKVIVNVR-PTVRILQSELNATA-DVGQPAKMTCAVDGFPEPMVTWTRNGVDLEPG-EKYSF--------NEDGSEITIMDVTKLDEGEYTCIAKNKAGKDDKELSLRV 299          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000020281.2 (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:101168083])

HSP 1 Score: 52.7582 bits (125), Expect = 6.716e-7
Identity = 33/138 (23.91%), Postives = 61/138 (44.20%), Query Frame = 3
Query:    9 KYKMEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQS 422
            +Y   A +Q   +  +V+VK++     +++P           V+++ G   ++ C   G P+P ++W+    +   Q     F  Y  R +      L+ +     DSGNYTC A N  G   K ++++V+  T   S
Sbjct: 1894 EYTCYAENQEGQDTMKVKVKVT-----MTSPPTFTEDRRPSIVKVRQGATVTIPCLATGNPVPKVMWFSPTHRAIPQSLGSRF--YSGRSVVGSDGTLQIRFAQKGDSGNYTCRAINSVGERSKVVSLDVEAPTYGNS 2024          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034751.1 (matrix-remodeling-associated protein 5 [Source:NCBI gene;Acc:101168083])

HSP 1 Score: 52.7582 bits (125), Expect = 7.484e-7
Identity = 32/134 (23.88%), Postives = 60/134 (44.78%), Query Frame = 3
Query:    9 KYKMEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVT 410
            +Y   A +Q   +  +V+VK++     +++P           V+++ G   ++ C   G P+P ++W+    +   Q     F  Y  R +      L+ +     DSGNYTC A N  G   K ++++V+  T
Sbjct: 2028 EYTCYAENQEGQDTMKVKVKVT-----MTSPPTFTEDRRPSIVKVRQGATVTIPCLATGNPVPKVMWFSPTHRAIPQSLGSRF--YSGRSVVGSDGTLQIRFAQKGDSGNYTCRAINSVGERSKVVSLDVEAPT 2154          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000013824.1 (SMESG000013824.1)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 284/292 (97.26%), Postives = 288/292 (98.63%), Query Frame = 3
Query:   18 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHDCLRNPCRMNNSVGKRISYKTCVCSGKNISPKCQMVEFRKHQIYSNNEQIEQNSFKSCKDGCDPNTSRXXXXXXXXXXXXXXXXXXXMVFITKRQRSRYKLTYTSTKSTANTNKDRRK-FQFKR 890
            MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHDCLRNPCRMNNS GKRISYKTCVCSGKNISPKCQMVEFRKHQIYSNNEQIEQNSFKSCKDGCDPNTSRLFLLSVLSLLLFLLIVFLIMVFITKRQRSRYKLTYTSTKSTANTNKD+++ F F +
Sbjct:    1 MEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHDCLRNPCRMNNSFGKRISYKTCVCSGKNISPKCQMVEFRKHQIYSNNEQIEQNSFKSCKDGCDPNTSRLFLLSVLSLLLFLLIVFLIMVFITKRQRSRYKLTYTSTKSTANTNKDKQESFPFNK 292          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000028939.1 (SMESG000028939.1)

HSP 1 Score: 121.324 bits (303), Expect = 2.447e-30
Identity = 70/177 (39.55%), Postives = 103/177 (58.19%), Query Frame = 3
Query:   15 KMEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSGEEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSR-TSELKYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKTITSKPHSVFENKVFFEKPCLSDHDCLRNPC 542
            K+   D SS++ GEVE+KIS+F++H+S  S     +    V+I  GE F+LIC V G P P I WY NN  + RQWF Y+  N+  +  NSR TSELK+Q   ++ +GNYTCHA+N +GHV+KS+ +++  + T    +  S T+ ++          K+     C SD DC+   C
Sbjct:    7 KLITIDPSSVDFGEVELKISQFSIHVSKESLKYNHHLNHGVKITEGESFTLICSVIGDPTPRIFWYHNNQLVDRQWFRYT--NHDDK--NSRNTSELKFQFAKSNLTGNYTCHAENTHGHVRKSVFVKIMEIPTTTKGSS-SVTSNSL----------KIDNRSGCDSDRDCIPGRC 168          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000059415.1 (SMESG000059415.1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.098e-22
Identity = 42/47 (89.36%), Postives = 45/47 (95.74%), Query Frame = -3
Query: 1185 SPWIRGRIMKLLSPHKVIVNYGTVAMPSHIADLRHRNEDSLESRGDI 1325
            SPWIRGRIMKLLSPHKVIV+Y TVAMP HIADLRHRN+DSLESRGD+
Sbjct:  120 SPWIRGRIMKLLSPHKVIVDYETVAMPRHIADLRHRNQDSLESRGDV 166          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000067568.1 (SMESG000067568.1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.582e-20
Identity = 40/47 (85.11%), Postives = 44/47 (93.62%), Query Frame = -3
Query: 1185 SPWIRGRIMKLLSPHKVIVNYGTVAMPSHIADLRHRNEDSLESRGDI 1325
            SPWIRGRIMKLLSPHKVIV+YGTVA+P H+ADLRHRNEDS ESR D+
Sbjct:  275 SPWIRGRIMKLLSPHKVIVDYGTVAIPRHVADLRHRNEDSFESRRDV 321          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000065270.1 (SMESG000065270.1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.586e-19
Identity = 44/59 (74.58%), Postives = 49/59 (83.05%), Query Frame = -3
Query: 1149 SPWIRGRIMKLLSPHKVIVNYGTVAMPSHIADLRHRNEDSLESRGDI**RIN*KRKLFK 1325
            SPWIR RIMKLLSP+KVIV+YGTVAMP HIA+LRHRNEDSLESR      +  K+KLFK
Sbjct:  180 SPWIRRRIMKLLSPYKVIVDYGTVAMPRHIAELRHRNEDSLESRQMYNKELIRKKKLFK 238          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN11.107e-828.97hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
MYLK1.340e-831.78myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK1.340e-831.78myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK1.359e-831.78myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK1.359e-831.78myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-898.265e-731.96Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-899.584e-731.96Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.093e-631.96Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.349e-631.96Muscle M-line assembly protein unc-89 [Source:Uni... [more]
unc-891.388e-631.96Muscle M-line assembly protein unc-89 [Source:Uni... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trol1.024e-730.19gene:FBgn0284408 transcript:FBtr0342823[more]
trol1.061e-730.19gene:FBgn0284408 transcript:FBtr0342806[more]
trol1.096e-730.19gene:FBgn0284408 transcript:FBtr0342816[more]
trol1.183e-730.19gene:FBgn0284408 transcript:FBtr0342807[more]
bt5.114e-734.02gene:FBgn0005666 transcript:FBtr0334482[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttn.21.604e-827.03titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
nrg2b1.918e-827.20neuregulin 2b [Source:ZFIN;Acc:ZDB-GENE-090205-2][more]
ttn.23.100e-827.03titin, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
nrg2b4.228e-827.20neuregulin 2b [Source:ZFIN;Acc:ZDB-GENE-090205-2][more]
nrg2a5.522e-832.32neuregulin 2a [Source:ZFIN;Acc:ZDB-GENE-070615-10][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eftud25.794e-826.98elongation factor Tu GTP binding domain containing... [more]
eftud26.102e-826.98elongation factor Tu GTP binding domain containing... [more]
eftud26.372e-826.98elongation factor Tu GTP binding domain containing... [more]
ENSXETT00000024069.12.017e-734.78hemicentin 2 [Source:NCBI gene;Acc:100490941][more]
lrrc8c9.874e-730.51leucine rich repeat containing 8 VRAC subunit C [S... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn12.832e-929.91hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn14.363e-929.91hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn22.141e-725.95hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838][more]
Ncam25.875e-725.66neural cell adhesion molecule 2 [Source:MGI Symbol... [more]
Palld5.987e-728.68palladin, cytoskeletal associated protein [Source:... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3YXG0|HMCN1_MOUSE1.981e-829.91Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|Q96RW7|HMCN1_HUMAN5.315e-828.97Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|Q15746|MYLK_HUMAN6.524e-831.78Myosin light chain kinase, smooth muscle OS=Homo s... [more]
sp|Q86TC9|MYPN_HUMAN3.338e-727.61Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 S... [more]
sp|P0C5E3|PALLD_RAT7.752e-730.15Palladin (Fragment) OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H1CLL81.239e-1434.96Immunoglobulin domain protein OS=Fasciola hepatica... [more]
W6ULJ11.452e-1436.36Schwann cell myelin protein OS=Echinococcus granul... [more]
A0A4Z2CRY17.446e-1436.36Schwann cell myelin protein (Fragment) OS=Schistos... [more]
A0A094ZCH82.427e-928.79Schwann cell myelin protein (Fragment) OS=Schistos... [more]
A0A068WFM12.927e-936.28Pro neuregulin 2 membrane bound OS=Echinococcus gr... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mxra5b7.140e-831.93matrix-remodelling associated 5b [Source:ZFIN;Acc:... [more]
ENSAMXT00000056836.18.148e-829.23pep primary_assembly:Astyanax_mexicanus-2.0:20:237... [more]
nrg2b8.387e-829.13pro-neuregulin-2, membrane-bound isoform-like [Sou... [more]
nrg2b9.585e-829.13pro-neuregulin-2, membrane-bound isoform-like [Sou... [more]
ENSAMXT00000003826.29.871e-832.32myopalladin [Source:NCBI gene;Acc:103025959][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002502.18.917e-828.71pep scaffold:Pmarinus_7.0:GL476400:249000:366561:-... [more]
ENSPMAT00000006750.19.547e-824.16pep scaffold:Pmarinus_7.0:GL477426:19036:34193:1 g... [more]
ENSPMAT00000007382.11.560e-735.80pep scaffold:Pmarinus_7.0:GL476981:74023:86492:-1 ... [more]
ENSPMAT00000002463.19.155e-734.62pep scaffold:Pmarinus_7.0:GL476400:5068:120393:-1 ... [more]
ENSPMAT00000008285.13.975e-630.00pep scaffold:Pmarinus_7.0:GL481193:15019:35761:-1 ... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495541.372e-628.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431711.426e-625.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495521.506e-629.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322961.919e-631.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495533.892e-628.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncam1b2.815e-728.45neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
hmcn13.009e-733.91hemicentin 1 [Source:NCBI gene;Acc:101172646][more]
ncam1b3.766e-728.45neural cell adhesion molecule 1 [Source:NCBI gene;... [more]
ENSORLT00000020281.26.716e-723.91matrix-remodeling-associated protein 5 [Source:NCB... [more]
ENSORLT00000034751.17.484e-723.88matrix-remodeling-associated protein 5 [Source:NCB... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013824.10.000e+097.26SMESG000013824.1[more]
SMESG000028939.12.447e-3039.55SMESG000028939.1[more]
SMESG000059415.17.098e-2289.36SMESG000059415.1[more]
SMESG000067568.16.582e-2085.11SMESG000067568.1[more]
SMESG000065270.12.586e-1974.58SMESG000065270.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010960 ID=SMED30010960|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1327bp
TAATGTTTAAATATAAAATGGAAGCTGGAGATCAATCAAGCCTTGAATTA
GGCGAAGTGGAAGTTAAAATTTCAAAATTTGCCTTGCATTTATCCACACC
ATCAGCGCTAATTATACAAAATTCGTTAAAAAGTGTTCGAATTAAATCGG
GAGAAGAGTTTTCTTTGATTTGTGAAGTTCACGGAAGACCGATTCCAACC
ATCCTCTGGTACAAAAACAATCTGCAAATCAAGCGCCAGTGGTTTCATTA
TTCATTTGTTAATTATGGAATAAGAATTATTAACAGCAGAACTTCCGAGT
TGAAATATCAATCAGTTACAACAAGTGACTCCGGAAATTATACATGCCAT
GCTCAAAATGTTTATGGACATGTGCAAAAATCAATAAACATTGAAGTGCA
ATGTGTGACAACTGCACAATCTGCCGCCCCGCATTCATCAACCACGAAGA
CAATCACTAGTAAACCGCATTCAGTATTTGAGAACAAAGTTTTTTTTGAA
AAGCCTTGCCTGAGTGATCATGACTGTCTAAGGAATCCTTGCAGAATGAA
TAATTCTGTTGGTAAAAGAATATCATACAAGACTTGCGTCTGTTCTGGAA
AAAACATTTCACCAAAATGCCAAATGGTTGAATTTAGAAAACATCAAATA
TATTCTAACAACGAGCAAATTGAACAAAATTCCTTCAAAAGCTGTAAAGA
CGGTTGTGATCCAAATACGAGTAGACTATTTCTTTTGTCAGTCCTTAGTT
TGCTTCTGTTTTTGCTAATTGTCTTTTTAATTATGGTGTTTATTACAAAA
AGACAGCGATCGAGATATAAATTAACATATACAAGCACGAAATCAACTGC
CAACACAAATAAAGATAGAAGGAAATTTCAATTTAAAAGATCCGGTTGAC
CATCAAATGTAAACATTGCGATTCGTCAGACGATAATTGAAGACAGCCTA
AAGCATATTTGAAAAGGATTTATATTGCACTGAAATAATATTCGGCCTCA
TGCTTCTAGAAAAACACTTTACGTAAACATATAGCCTAAATGCCATTCTA
TTTGATTTTCGTTTAACGAGAAAAAGTTTATATATGATAATAATTAACAA
CAAGAATTTACTAATTTTAAAATCTCTATTTTCTAAAACATTTAATTATT
TAAACAACTTTCTTTTCTAATTTATTCTTTATTATATATCTCCCCGAGAT
TCTAACGAATCTTCATTCCTGTGCCTTAAATCGGCTATATGACTTGGCAT
TGCAACAGTTCCGTAATTGACGATTACTTTATGTGGAGACAGTAGCTTCA
TGATTCTTCCTCTTATCCATGGAGATG
back to top

protein sequence of SMED30010960-orf-1

>SMED30010960-orf-1 ID=SMED30010960-orf-1|Name=SMED30010960-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=299bp
MFKYKMEAGDQSSLELGEVEVKISKFALHLSTPSALIIQNSLKSVRIKSG
EEFSLICEVHGRPIPTILWYKNNLQIKRQWFHYSFVNYGIRIINSRTSEL
KYQSVTTSDSGNYTCHAQNVYGHVQKSINIEVQCVTTAQSAAPHSSTTKT
ITSKPHSVFENKVFFEKPCLSDHDCLRNPCRMNNSVGKRISYKTCVCSGK
NISPKCQMVEFRKHQIYSNNEQIEQNSFKSCKDGCDPNTSRLFLLSVLSL
LLFLLIVFLIMVFITKRQRSRYKLTYTSTKSTANTNKDRRKFQFKRSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007399nervous system development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 48..122
e-value: 1.6E-11
score: 54.3
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 42..133
e-value: 9.3E-9
score: 45.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 33..140
e-value: 2.5E-21
score: 77.8
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 38..132
e-value: 8.8E-16
score: 57.8
NoneNo IPR availablePANTHERPTHR45889FAMILY NOT NAMEDcoord: 22..152
NoneNo IPR availableCDDcd00096Igcoord: 53..129
e-value: 1.62779E-13
score: 62.6448
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 33..131
score: 13.602
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 41..134