Ras and EF-hand domain-containing protein

Overview
NameRas and EF-hand domain-containing protein
Smed IDSMED30010954
Length (bp)2331
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras and EF-hand domain-containing protein (SMED30010954) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras and EF-hand domain-containing protein (SMED30010954) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras and EF-hand domain-containing protein (SMED30010954) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras and EF-hand domain-containing protein (SMED30010954) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010954

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30010954SMESG000043201.1 SMESG000043200.1 SMESG000043198.1 SMESG000040703.1 SMESG000040702.1 SMESG000039353.1 SMESG000039352.1 SMESG000039347.1 SmedASXL_016820SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30010954SMESG000043201.1 SMESG000043200.1 SMESG000043198.1 SMESG000040703.1 SMESG000040702.1 SMESG000039353.1 SMESG000039352.1 SMESG000039347.1 dd_Smed_v4_7604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010954SMESG000043201.1 SMESG000043200.1 SMESG000043198.1 SMESG000040703.1 SMESG000040702.1 SMESG000039353.1 SMESG000039352.1 SMESG000039347.1 dd_Smed_v4_7604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010954SMESG000043201.1 SMESG000043200.1 SMESG000043198.1 SMESG000040703.1 SMESG000040702.1 SMESG000039353.1 SMESG000039352.1 SMESG000039347.1 dd_Smed_v4_7604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010954SMESG000043201.1 SMESG000043200.1 SMESG000043198.1 SMESG000040703.1 SMESG000040702.1 SMESG000039353.1 SMESG000039352.1 SMESG000039347.1 dd_Smed_v4_7604_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010954SMESG000043201.1 SMESG000040702.1 SMESG000039353.1 Contig55098newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010954SMESG000043201.1 SMESG000040702.1 SMESG000039353.1 Contig55098uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: CRACR2A (calcium release activated channel regulator 2A [Source:HGNC Symbol;Acc:HGNC:28657])

HSP 1 Score: 174.866 bits (442), Expect = 4.630e-45
Identity = 80/190 (42.11%), Postives = 121/190 (63.68%), Query Frame = 1
Query: 1525 SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPS 2094
            S    P+ +FK+V VG+S VGK++ L RFC   F      T+G+D+ +K++ V+N  +ALQLWDTAGQERY  IT+QF+RK DGVI++YD+ +  SF+++R W+ +VE+  GD V +++LGNKLD  K   + +P      L+ E   + +E SA +G N  ES   LA+ LK ++D    +  Q+  P+
Sbjct:  537 SSPSAPDRLFKIVFVGNSAVGKTSFLRRFCEDRFSPGMAATVGIDYRVKTLNVDNSQVALQLWDTAGQERYRCITQQFFRKADGVIVMYDLTDKQSFLSVRRWLSSVEEAVGDRVPVLLLGNKLDNEKE--REVPRGLGEQLATENNLIFYECSAYSGHNTKESLLHLARFLKEQEDTVREDTIQVGHPA 724          

HSP 2 Score: 117.087 bits (292), Expect = 1.997e-26
Identity = 110/335 (32.84%), Postives = 183/335 (54.63%), Query Frame = 1
Query:  127 VVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFII---------GDVQTKKRH------SSDFEDRDFSFEEKNTKFQ---DNLSCS-VVEKET-ASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERD 1071
            V+ ++A+E + TCD +GKG+I +K+M  L   LPLS E+LE VFD+LD DGNG LT QEFT GF  F              Q  +RH      S   ED     E++  +F+   D L    V+E E+    L+ +LK + P+LL  FE+ LT++  +++ +H    ++E  + ++   ++++I+ +Y+EME QIKSE+++ + ++ +R +   + LEQ L  K++  ++L  KQ++ + +   L     + + E   L      L   LE T   L++ Q  LE LQ ++ +  +++      V+  +  E+  LL QL  L+E NK L+DERD
Sbjct:   50 VMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDFLTRIISQLQEAHEEKNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQELEQKLLCKEQELEQLTQKQKRLEGQCTALHHDKHETKAENTKLKLTNQELARELERTSWELQDAQQQLESLQQEACKLHQEKEMEVYRVTESLQREKAGLLKQLDFLRERNKHLRDERD 384          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RASEF (RAS and EF-hand domain containing [Source:HGNC Symbol;Acc:HGNC:26464])

HSP 1 Score: 162.54 bits (410), Expect = 5.639e-41
Identity = 80/177 (45.20%), Postives = 109/177 (61.58%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL----AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVD 2061
            +  +K+VL GD+ VGKS+ L R C   FREN   T+GVDF +K++ V+     LQLWDTAGQER+ SI K ++RK DGV+L+YD+    SF+NIR W+D +E    + V +M++GNK D+    A    K +P      L+  YGAL  E SA  G NI E+   LA+ +K R D D
Sbjct:  539 QKAYKIVLAGDAAVGKSSFLMRLCKNEFRENISATLGVDFQMKTLIVDGERTVLQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCEKSFLNIREWVDMIEDAAHETVPIMLVGNKADIRDTAATEGQKCVPGHFGEKLAMTYGALFCETSAKDGSNIVEAVLHLAREVKKRTDKD 715          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RAB15 (RAB15, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:20150])

HSP 1 Score: 150.214 bits (378), Expect = 1.003e-40
Identity = 69/164 (42.07%), Postives = 111/164 (67.68%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +F+++L+GDS VGK+ +L RF +  F  ++ +TIGVDF +K+IEV+ I + +Q+WDTAGQERY++ITKQ+YR+  G+ LVYDI    S+ +I  W+ +V++   + V  +++GNK D  + Q + +  +    L++EYG   +E SA T  NI ESF  L +++
Sbjct:    8 LFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKAD--EEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELV 169          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: AL358472.6 (novel protein)

HSP 1 Score: 149.058 bits (375), Expect = 1.847e-40
Identity = 69/169 (40.83%), Postives = 115/169 (68.05%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + +FK++L+GDS VGK+ ++ RF    F   Y +TIG+DF ++++++E   I LQ+WDTAGQER+++IT  +YR   G+ILVYDI +  SF NI+NW+ ++++N    V  ++LGNK D+     + +  + A  L+RE+G   FE SA +  N++E+F++LA+ + L+
Sbjct:    6 DHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDM--EAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Match: RAB13 (RAB13, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9762])

HSP 1 Score: 149.058 bits (375), Expect = 1.847e-40
Identity = 69/169 (40.83%), Postives = 115/169 (68.05%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + +FK++L+GDS VGK+ ++ RF    F   Y +TIG+DF ++++++E   I LQ+WDTAGQER+++IT  +YR   G+ILVYDI +  SF NI+NW+ ++++N    V  ++LGNK D+     + +  + A  L+RE+G   FE SA +  N++E+F++LA+ + L+
Sbjct:    6 DHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDM--EAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17482329:-1 gene:WBGene00007067.1 transcript:4R79.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 175.637 bits (444), Expect = 4.669e-49
Identity = 97/238 (40.76%), Postives = 146/238 (61.34%), Query Frame = 1
Query: 1408 NIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEM------PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVE-NIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQ-PKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSN 2097
            NII+  P+ YR I  Q EQ   K +++ + ++   K +   EE+      P+ +FKVV VGDS VGK+  L RFC+  F+  +  TIGVDF +K++++  N  IA+QLWDTAGQER+ SITKQ++RK DGV+L++D+    SF+N+RNWID+V     D  ++ ++GNK+DL  S   ++   + A  L+ E+    FE SA TG  I+     +A+ L+ R+D  +  A +L   SN
Sbjct:   68 NIIIKKPL-YRPI--QPEQSIPKVSSLAEELNAIGKKVLQKEEIEEEVTQPDRIFKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSAVYRAAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDINSN 302          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17483332:-1 gene:WBGene00007067.1 transcript:4R79.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 176.407 bits (446), Expect = 2.230e-48
Identity = 97/238 (40.76%), Postives = 146/238 (61.34%), Query Frame = 1
Query: 1408 NIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEM------PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVE-NIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQ-PKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSN 2097
            NII+  P+ YR I  Q EQ   K +++ + ++   K +   EE+      P+ +FKVV VGDS VGK+  L RFC+  F+  +  TIGVDF +K++++  N  IA+QLWDTAGQER+ SITKQ++RK DGV+L++D+    SF+N+RNWID+V     D  ++ ++GNK+DL  S   ++   + A  L+ E+    FE SA TG  I+     +A+ L+ R+D  +  A +L   SN
Sbjct:  152 NIIIKKPL-YRPI--QPEQSIPKVSSLAEELNAIGKKVLQKEEIEEEVTQPDRIFKVVFVGDSAVGKTCFLHRFCHNRFKPLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSAVYRAAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDINSN 386          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 147.132 bits (370), Expect = 4.265e-40
Identity = 72/165 (43.64%), Postives = 110/165 (66.67%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLK 2043
            +FK++L+GDS VGK+ +L RF + +F  ++ +TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G+ILVYDI    SF NI+NWI N+E++   +V  M++GNK D+   + + +       L+ EYG    E SA    NI+E+F TLA+ +K
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDI--EERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIK 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 147.132 bits (370), Expect = 4.265e-40
Identity = 72/165 (43.64%), Postives = 110/165 (66.67%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLK 2043
            +FK++L+GDS VGK+ +L RF + +F  ++ +TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G+ILVYDI    SF NI+NWI N+E++   +V  M++GNK D+   + + +       L+ EYG    E SA    NI+E+F TLA+ +K
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDI--EERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIK 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 146.362 bits (368), Expect = 6.141e-40
Identity = 68/167 (40.72%), Postives = 112/167 (67.07%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            +FK++L+GDS VGKS +L RF + T+ E+Y +TIGVDF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G+I+VYDI +  +F N++ W+  +++   + V  +++GNK DL  +  +A+ T+ A D + + G    E SA +  N+ ++F T+A  +K R
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDL--TAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSR 175          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 149.828 bits (377), Expect = 4.955e-41
Identity = 74/169 (43.79%), Postives = 110/169 (65.09%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            +FK++L+GDS VGK+ IL RF    F   + +TIG+DF +++IE++N  I LQ+WDTAGQER+ +IT  +YR   G++LVYDI +  SF NI+NWI N+E+N   +V  M+LGNK +L  +  + +  +    L+ EYG    E SA    N+ E+F TLA  +K + +
Sbjct:    8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCEL--TDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 149.828 bits (377), Expect = 4.955e-41
Identity = 74/169 (43.79%), Postives = 110/169 (65.09%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            +FK++L+GDS VGK+ IL RF    F   + +TIG+DF +++IE++N  I LQ+WDTAGQER+ +IT  +YR   G++LVYDI +  SF NI+NWI N+E+N   +V  M+LGNK +L  +  + +  +    L+ EYG    E SA    N+ E+F TLA  +K + +
Sbjct:    8 LFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCEL--TDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTE 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0331832)

HSP 1 Score: 147.132 bits (370), Expect = 6.297e-40
Identity = 74/187 (39.57%), Postives = 116/187 (62.03%), Query Frame = 1
Query: 1507 QYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMF--EVSALTGENINESFATLAKVLKLRQDVD 2061
            Q  +    EE  + +FK+VL+GD   GK+ I+DRF  G + E + NTIGVDF +K+I VE   I LQ+WDTAGQER+ +IT+ +YR  +GV++VYDI +  SF N++ WI+ V + T   V+++++GNK DL   + + +  + A  + +    ++F  E SA    N+ ++F  LA  LK + D +
Sbjct:    7 QTLMALPNEEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDL--EEQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDAN 191          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab19 (gene:FBgn0015793 transcript:FBtr0076705)

HSP 1 Score: 147.132 bits (370), Expect = 6.297e-40
Identity = 74/187 (39.57%), Postives = 116/187 (62.03%), Query Frame = 1
Query: 1507 QYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMF--EVSALTGENINESFATLAKVLKLRQDVD 2061
            Q  +    EE  + +FK+VL+GD   GK+ I+DRF  G + E + NTIGVDF +K+I VE   I LQ+WDTAGQER+ +IT+ +YR  +GV++VYDI +  SF N++ WI+ V + T   V+++++GNK DL   + + +  + A  + +    ++F  E SA    N+ ++F  LA  LK + D +
Sbjct:    7 QTLMALPNEEHFDFLFKIVLIGDCGTGKTCIVDRFKTGNYIERHGNTIGVDFSMKTIAVEGKQIKLQIWDTAGQERFRTITQSYYRSANGVLIVYDITKRSSFSNLQKWIEEVRRYTASNVLIILVGNKCDL--EEQREVDFEEARQMCQYIPEILFVMETSAKENMNVEDAFRCLANELKRQHDAN 191          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 143.665 bits (361), Expect = 7.177e-39
Identity = 67/167 (40.12%), Postives = 109/167 (65.27%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            +FK++L+GDS VGKS +L RF + T+ E+Y +TIGVDF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G+I+VYD  +  SF N++ W++ +E+   + V  +++GNK DL  +  K +    A + + + G    E SA +  N+ ++F T+A  +K R
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDL--TTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNR 175          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 280.411 bits (716), Expect = 1.884e-82
Identity = 221/730 (30.27%), Postives = 365/730 (50.00%), Query Frame = 1
Query:  145 KELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG--------------------------DVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCSVV--EKETASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQ----TPETSRSPSPQPEMLNFTDRLP--------------INNDPDNESDEADGQTINSDIRKLKF-AEASKLFG--ETMSVYETSKYG--DTFXXXXXXX-XXXXXPALLSDEP-----------------------LENRAFYRASLGSVQAN----IIVASPVKYREIDVQTEQEEK-----KETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQL 2082
            K+ +  CD +GKG+IT+ +M  L   LPL+ E+LE+VFDSLD D NG LTL +F+ GF  F+ G                          D Q  K    D E++ FS         ++L  S V  +     +L+ +L+   P+LL  FE  L+++T +I+ + +  K+MES + ++A  H+ +I+R+Y+EME QI +E+ R   ++++  +   + L+Q L  K++  ++L  KQ + +++ ++L     +++ E   L    + L   LE T   L   Q  L  LQ ++   + +R      V+ G+  E+  L+ QL  L+E+NK L+DERD   ++      ++SR        + +T+R P               N  P + ++         D RK      + KL G  E ++V E  + G  D +        E D  P LL  +P                       LE+ + Y++++    A+    + +  P K R I V      +     KET  + P +            P+ +FKV+LVG+S+VGK+A+L RFC+G F      T+G+D+ ++++ + +  +ALQLWDTAGQERY SITKQF+RK DGV+++YDI    SF ++R W+ ++++  GD + +M+LGNK D  K   + + TK A  L+ E   + +E SA TG N+ E+   LA+VL+ ++D    N  +L
Sbjct:   48 KDFFHICDSEGKGFITRTDMRRLHKELPLTAEELENVFDSLDVDKNGFLTLGKFSSGFSSFLHGRRVSMTEELTTTPSQKAPEAAGQSSEDEQVMKTIEDD-EEKHFSM------LMESLGASNVFEDPSEVRSLWAQLRKDEPHLLSNFEEFLSRVTFQIKEAQHERKEMESALRRKAVTHDTEIQRLYEEMEQQIINEKDRANLKDSESLQIRSQDLQQLLRGKEQELEQLFQKQRRLERQCRDLHSEQQESRLENVKLKMNNEELSRDLEHTCEELVLAQEQLAILQEQASRLQEEREMEMYRVTEGLQREKQSLMKQLDLLREMNKHLRDERDISFLKRSNSMKKSSRKHRVSASSIKYTERKPSVRKEVSKEEVTQRYNRKPSSPANTYCSPFTTGDDRKADVDGRSQKLTGGSENVNVGEDVEDGPPDGWPLRRVISIEEDHLPHLLQGDPHLLLHQLSEEEEERAGEDEAQGDLESSSLYQSNVSLASADSPPPVRMKKPSKKRWIRVNMPSSARGQPVGKETLQQGPTE-------GATASPQRLFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRSITKQFFRKADGVVVIYDITMEDSFSSVRPWLSSIQEAVGDPIPVMLLGNKSD--KENEREVQTKEADLLAEEANLMFYECSAYTGANVLEAMIHLARVLREQEDRVWVNTVRL 761          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 185.267 bits (469), Expect = 1.506e-50
Identity = 137/447 (30.65%), Postives = 221/447 (49.44%), Query Frame = 1
Query:  910 SILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQ----TPETSRSPSPQPEMLNFTDRLP--------------INNDPDNESDEADGQTINSDIRKLKF-AEASKLFG--ETMSVYETSKYG--DTFXXXXXXX-XXXXXPALLSDEP-----------------------LENRAFYRASLGSVQAN----IIVASPVKYREIDVQTEQEEK-----KETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQL 2082
            +IL+E  ++ +E+R       T    G+  E+  L+ QL  L+E+NK L+DERD   ++      ++SR        + +T+R P               N  P + ++         D RK      + KL G  E ++V E  + G  D +        E D  P LL  +P                       LE+ + Y++++    A+    + +  P K R I V      +     KET  + P +            P+ +FKV+LVG+S+VGK+A+L RFC+G F      T+G+D+ ++++ + +  +ALQLWDTAGQERY SITKQF+RK DGV+++YDI    SF ++R W+ ++++  GD + +M+LGNK D  K   + + TK A  L+ E   + +E SA TG N+ E+   LA+VL+ ++D    N  +L
Sbjct:   25 AILQEQASRLQEEREMEMYRVTE---GLQREKQSLMKQLDLLREMNKHLRDERDISFLKRSNSMKKSSRKHRVSASSIKYTERKPSVRKEVSKEEVTQRYNRKPSSPANTYCSPFTTGDDRKADVDGRSQKLTGGSENVNVGEDVEDGPPDGWPLRRVISIEEDHLPHLLQGDPHLLLHQLSEEEEERAGEDEAQGDLESSSLYQSNVSLASADSPPPVRMKKPSKKRWIRVNMPSSARGQPVGKETLQQGPTE-------GATASPQRLFKVILVGNSSVGKTALLRRFCDGQFHSATSATVGIDYSVRTLNLGDSHVALQLWDTAGQERYRSITKQFFRKADGVVVIYDITMEDSFSSVRPWLSSIQEAVGDPIPVMLLGNKSD--KENEREVQTKEADLLAEEANLMFYECSAYTGANVLEAMIHLARVLREQEDRVWVNTVRL 459          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01062083.1 (calcium release activated channel regulator 2Aa [Source:NCBI gene;Acc:100330395])

HSP 1 Score: 175.252 bits (443), Expect = 1.614e-45
Identity = 75/172 (43.60%), Postives = 120/172 (69.77%), Query Frame = 1
Query: 1540 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            P+ +FKVVLVG+S+VGK+++L RFC+  F      T+G+D+ +K++ V+N  IALQ+WDTAGQERY SITKQF+RK DGV++VYDI    +F  +R W+ +V++  G+++ +M+LGNK DL     + IP      L++++  + +E SA +  N+ +S   +A++LK ++D
Sbjct:  529 PDRLFKVVLVGNSSVGKTSLLRRFCDDCFHSGTCATVGIDYSVKTLSVDNSQIALQMWDTAGQERYRSITKQFFRKADGVVVVYDITNEQTFTAVRQWLASVQEGAGEDIPIMLLGNKTDLDSQ--RVIPLGLGEKLAKDFQLMFYECSAFSNHNVTDSMIHMARILKEQED 698          

HSP 2 Score: 145.591 bits (366), Expect = 9.861e-36
Identity = 110/350 (31.43%), Postives = 191/350 (54.57%), Query Frame = 1
Query:  127 VVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG------------DVQTKKRHSSDFEDRDFSFEEKNTKFQDNLS---CSVVEKETASNLYE----------KLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETS 1101
             V ++ +E +  CD +GKG+IT+++M  L   LPLS + LE+VFDSLD D NG LT +EF+ GF +F+ G            ++ ++K     +E +   +EE+ ++ +D+     C ++E   ASN++E          +L+   P+LL  FE  L ++T +I+ ++   K+ME+ + +++  H+ +I+R+Y+EME QIK+E+ R++ E+++R     + +E  L  K+K  + L  KQ++ +++ ++L     +   E   L    + L   L+ T   L   Q  L  LQ +S     +R      V+  +  ER  LL QL  L+E+NK L+DE+D    Q P+TS
Sbjct:   33 AVIEKTREFFQICDVEGKGFITRRDMQRLNGELPLSADDLENVFDSLDADANGYLTFEEFSSGFSEFMFGPSVVPADPHGGEELVSRKSPEMLYESQ---WEERLSRGEDDEEKHFCMLMENLGASNIFEDPEEVRSLWVQLRRDEPHLLSNFEEFLARVTYQIKEANQEKKEMETALKRKSATHDDEIQRLYEEMEQQIKNEKDRILLEDSERFLTRSQDMEHQLLSKEKELEILSNKQKRLERQCRDLLSEQRETSVENVKLKRYNEDLSRELDHTSQELSLAQEQLMLLQEQSSRLHEEREMEIYRVTESLQRERTSLLKQLDLLREMNKHLRDEKDISY-QKPKTS 378          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: rab15 (RAB15, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-2])

HSP 1 Score: 150.599 bits (379), Expect = 5.242e-41
Identity = 69/164 (42.07%), Postives = 112/164 (68.29%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +F+++L+GDS VGK+ +L RF +  F  ++ +TIGVDF +K++E++ I + +Q+WDTAGQERY++ITKQ+YR+  G+ LVYDI    SF +I  W  +V++   ++V  +++GNK D  + + + + T+    L++ YG   FE SA T  NI ESF  LA+++
Sbjct:    8 LFRLLLLGDSGVGKTCLLCRFTDNEFHPSHISTIGVDFKMKTLEIDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDITSERSFQHIMKWASDVDEYAPEKVQKILVGNKSD--EQEKRQVATEQGDKLAKAYGMDFFETSAFTNHNITESFTRLAELV 169          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:373105])

HSP 1 Score: 149.828 bits (377), Expect = 5.739e-41
Identity = 71/169 (42.01%), Postives = 112/169 (66.27%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            +FK++L+GDS VGK+ ++ RF    F   Y +TIG+DF +K+IEVE   + LQ+WDTAGQER+++IT  +YR   G+ILVYDI +  S+ NI+NW+ ++++N    V  M+LGNK D+     + +  +    L++E+G   FE SA +  N+ ESF +LA+ + L+ +
Sbjct:    8 LFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSYENIQNWMKSIKENASAGVSRMLLGNKCDI--EAKRKVSKETGEKLAKEHGIRFFETSAKSSINVEESFTSLARDILLKSN 174          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 161.384 bits (407), Expect = 8.043e-42
Identity = 80/175 (45.71%), Postives = 109/175 (62.29%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL----AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            E  +K+VL GD+ VGKS+ L R C   FR N   T+GVDF +K++ V+     LQLWDTAGQER+ SI K ++R+ DGV+L+YD+    SF+N+R WID +E  T + + +MM+GNK DL    A+     + T     LSR YGAL  E SA  G NI E+   LA+ ++ R D
Sbjct:  305 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDATSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCD 479          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 163.31 bits (412), Expect = 1.927e-41
Identity = 80/175 (45.71%), Postives = 109/175 (62.29%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL----AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            E  +K+VL GD+ VGKS+ L R C   FR N   T+GVDF +K++ V+     LQLWDTAGQER+ SI K ++R+ DGV+L+YD+    SF+N+R WID +E  T + + +MM+GNK DL    A+     + T     LSR YGAL  E SA  G NI E+   LA+ ++ R D
Sbjct:  496 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDATSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCD 670          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 163.696 bits (413), Expect = 2.047e-41
Identity = 80/175 (45.71%), Postives = 109/175 (62.29%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL----AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            E  +K+VL GD+ VGKS+ L R C   FR N   T+GVDF +K++ V+     LQLWDTAGQER+ SI K ++R+ DGV+L+YD+    SF+N+R WID +E  T + + +MM+GNK DL    A+     + T     LSR YGAL  E SA  G NI E+   LA+ ++ R D
Sbjct:  520 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDATSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAREVRKRCD 694          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: mdn1 (midasin AAA ATPase 1 [Source:Xenbase;Acc:XB-GENE-958471])

HSP 1 Score: 150.599 bits (379), Expect = 7.253e-41
Identity = 71/164 (43.29%), Postives = 108/164 (65.85%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +F+++L+GDS VGK+ +L RF +  F  ++ +TIGVDF +K+IEV+ I + +Q+WDTAGQERY++ITKQ+YR+  G+ LVYDI    S+ +I  W  +V++   D V  +++GNK D  + Q + +       L+ EYG   FE SA T  NI ESF  L +++
Sbjct:    8 LFRLLLIGDSGVGKTCLLCRFTDNEFHPSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDITSERSYQHIMKWASDVDEYAPDGVQKILIGNKAD--EEQKRQVGKNQGMKLAEEYGMDFFETSACTNYNIKESFTRLTELV 169          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Match: irf6 (interferon regulatory factor 6 [Source:Xenbase;Acc:XB-GENE-876410])

HSP 1 Score: 161.384 bits (407), Expect = 7.395e-41
Identity = 78/168 (46.43%), Postives = 105/168 (62.50%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL----AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAK 2034
            E  +K+VL GD+ VGKS+ L R C   FR N   T+GVDF +K++ V+     LQLWDTAGQER+ SI K ++R+ DGV+L+YD+    SF+N+R WID +E  T + + +MM+GNK DL    A+     + T     LSR YGAL  E SA  G NI E+   LA+
Sbjct:  495 EKAYKIVLAGDAAVGKSSFLMRLCKNEFRGNTSATLGVDFQMKTLVVDGEPTILQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKSFLNVREWIDMIEDATSEAIPIMMVGNKADLRQLMAEQGHICVSTNYGEKLSRTYGALFCETSAKEGSNIVEAVLHLAR 662          

HSP 2 Score: 51.6026 bits (122), Expect = 4.895e-6
Identity = 91/355 (25.63%), Postives = 159/355 (44.79%), Query Frame = 1
Query:  109 MIDLDEVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGF----GQFII---GDV-QTKKRHSSDFEDRDFSFEEKNTK----FQDNLSCSV---VEKETASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQ-RLKE--------LSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETS 1101
            M D DE+   R + L+ T D    G + K +   L   L +S  + E +F  LD D +  +T ++F  GF    G  +     DV Q +   S    D++   EE ++     FQ  L+  V     +E AS LY+ +    P L+  +E+++    +EI +    ++ +   + +   +   ++  + +EM+ +I++ EKR   +  +    +K   E +++E     K+L   +EQ+K   LKE        L  LT +NQK           L + L E ++++   QS L+ L++    D+   +     +  G + ER+ L  Q+  LQ  N+KL D  D GL    E S
Sbjct:    1 MEDKDEL--SRLRALFHTFDSKSSGRLEKGQFSALCAELKVSPSEAEDIFARLDSDKDSCITFEDFAMGFRGARGLHMPEGKKDVEQGEPPKSPSTPDKEEKPEETSSPAWEDFQRRLADEVNYIPRREQASILYQNINIVEPLLIQQYEHVIRNFVREIRLQSTEMENLAIAVKRAQDKAAIQLSELEEEMDQRIQAVEKREKRKSEEALNDLKRQHESEVAELQVTIKKLKKLEEQSKNINLKEDVAVLRRRLHDLTMENQK-----------LRKDLLEAQTSISFLQSELDALKSDYA-DQSLSSERDMDIIRGFTDERENLARQIEILQTANRKLHDSND-GLRSALENS 340          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Cracr2a (calcium release activated channel regulator 2A [Source:MGI Symbol;Acc:MGI:2685919])

HSP 1 Score: 177.563 bits (449), Expect = 3.755e-46
Identity = 78/185 (42.16%), Postives = 120/185 (64.86%), Query Frame = 1
Query: 1540 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPS 2094
            P+ +FK+V VGDS VGK++ L R C   F      T+G+D+ +K++ V+N  +ALQLWDTAGQERY  I++QF+RK DGV ++YD+    SF++IR W+ +VE+  GD + +++LGNKLD  K   + +P      L++E   + +E SA +G N  ES   LA++LK ++D   N+  Q+  P+
Sbjct:  537 PDRLFKIVFVGDSAVGKTSFLRRLCEARFSPGMAATVGIDYRVKTVTVDNAQVALQLWDTAGQERYRCISQQFFRKADGVAVMYDLTAKQSFLSIRQWLSSVEEAVGDRIPVLLLGNKLDNEKE--REVPRGLGEQLAKENNLIFYECSACSGHNAQESLLHLARLLKEQEDTVRNDTIQVGPPA 719          

HSP 2 Score: 116.316 bits (290), Expect = 2.975e-26
Identity = 108/335 (32.24%), Postives = 177/335 (52.84%), Query Frame = 1
Query:  127 VVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFI--------------IGDVQTKKRHSS----DFEDRDFSFEEKNTKFQDNLSCS-VVEKET-ASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERD 1071
             + ++A+E + TCD +GKG+I + +M  L   LPLS E+LE VFD+LD DGNG LT +EFT GF  F               +  +Q +K + S    D  D D   E +     D L    V+E E+    L+ +L+   P+LL  FE+LLT +  +++ +H    ++E  + ++   ++++I+ +Y+EME QIKSE ++ + ++ +R +     LE+ LS K++  + L  KQ + + +   L     + + E   L      L   LE T   L+E Q  LE LQ ++ E ++++      V+  +  E+  LL QL  L+E NK L+DERD
Sbjct:   44 AMWKKAQEFFQTCDSEGKGFIARTDMQRLHQELPLSLEELEDVFDALDADGNGFLTPEEFTTGFSHFFFSQNIQGEEEADQQVAQLQEEKVYQSRGEEDVGDMDHDEEAQFQMLMDRLGAQKVLEDESDVRQLWLQLRKDEPHLLSNFEDLLTTIFAQLQEAHEQKNELECALRKKIAAYDEEIQHLYEEMEQQIKSEREQFLLKDTERFQARSRELEKKLSAKEQELERLNQKQRKLEGQCAALHNDKHETKAENSKLRLTNQELARELERTSHQLQEAQQQLESLQREACELQQEKEMEVYRVTESLQREKSGLLKQLDFLRERNKHLRDERD 378          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rab15 (RAB15, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1916865])

HSP 1 Score: 150.984 bits (380), Expect = 3.673e-41
Identity = 69/164 (42.07%), Postives = 111/164 (67.68%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +F+++L+GDS VGK+ +L RF +  F  ++ +TIGVDF +K+IEV+ I + +Q+WDTAGQERY++ITKQ+YR+  G+ LVYDI    S+ +I  W+ +V++   + V  +++GNK D  + Q + +  +    L++EYG   +E SA T  NI ESF  L +++
Sbjct:    8 LFRLLLIGDSGVGKTCLLCRFTDNEFHSSHISTIGVDFKMKTIEVDGIKVRIQIWDTAGQERYQTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKAD--EEQKRQVGREQGQQLAKEYGMDFYETSACTNLNIKESFTRLTELV 169          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rab44 (RAB44, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:3045302])

HSP 1 Score: 152.14 bits (383), Expect = 5.182e-41
Identity = 73/184 (39.67%), Postives = 114/184 (61.96%), Query Frame = 1
Query: 1540 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKP 2091
            P+ ++ VV +GDSNVGK++ L    +  F      T+GVDF +K++ V+N   ALQLWDTAGQERY S+T+Q  RK +GV+L+YD+    SF ++R W+D ++    + V +++LGNK+D    + + +PT+    L++E G    E SA  G NI E    LA+ LK+++D    +  ++T P
Sbjct:   82 PDYLYHVVFLGDSNVGKTSFLHLLHHDAFATGLTATVGVDFRVKNLLVDNKTFALQLWDTAGQERYHSLTRQLLRKAEGVVLMYDVTSQESFTHVRYWLDCLQDAGVEGVAMVLLGNKMDC--EEERQVPTEAGRRLAQELGVSFGECSAALGHNILEPMMNLARSLKMQEDRLKASLAEVTHP 263          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 146.362 bits (368), Expect = 1.282e-39
Identity = 71/170 (41.76%), Postives = 116/170 (68.24%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDL-AKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + +FK++L+GDS VGK+ ++ RF    F   Y +TIG+DF ++++++E   I LQ+WDTAGQER+++IT  +YR   G+ILVYDI +  SF NI+NW+ ++++N    V  ++LGNK D+ AK Q   +  + A  L+RE+    FE SA +  N++E+F++LA+ + L+
Sbjct:    6 DHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQ---VQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Match: Rab19 (RAB19, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:103292])

HSP 1 Score: 146.362 bits (368), Expect = 1.674e-39
Identity = 67/181 (37.02%), Postives = 117/181 (64.64%), Query Frame = 1
Query: 1525 SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGAL-MFEVSALTGENINESFATLAKVLKLRQDVDI 2064
            + +E  + +FKV+L+GDSNVGK+ ++  F +G + E+ +NTIGVDF ++S+E++   + +Q+WDTAGQER+ +IT+ +YR     I+ YD+    +F ++ +WI  +EK     +++M++GNK DL   + + +  ++AC L+ ++G L + E SA    NI+E F  +AK L  R  + +
Sbjct:    9 TSDENVDYLFKVILIGDSNVGKTCVVQHFKSGVYSESQQNTIGVDFTVRSLEIDGKKVKMQVWDTAGQERFRTITQSYYRSAHAAIIAYDLTRRSTFESVPHWIHEIEKYGAANLVIMLIGNKSDLW--EKRHVLFEDACTLAEKHGLLAVLETSAKESRNIDEVFVLMAKELIARNSLHL 187          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|Q39433|RB1BV_BETVU (Ras-related protein RAB1BV OS=Beta vulgaris OX=161934 GN=RAB1BV PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.675e-44
Identity = 76/167 (45.51%), Postives = 116/167 (69.46%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + K++L+GDS VGKS +L RF +G+F  ++  TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G++LVYD+ +  SF NIRNWI N+E++  D V  +++GNK D+ +S+ +A+PT     L+ EYG   FE SA T  N+ E F ++A+ +K R
Sbjct:   15 LIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK-RAVPTAKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQR 180          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|O24466|RAE1A_ARATH (Ras-related protein RABE1a OS=Arabidopsis thaliana OX=3702 GN=RABE1A PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.745e-43
Identity = 76/167 (45.51%), Postives = 115/167 (68.86%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + K++L+GDS VGKS +L RF +G+F  ++  TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G++LVYD+ +  SF NIRNWI N+E++  D V  +++GNK D+ +S+ +A+P      L+ EYG   FE SA T  N+ E F ++AK +K R
Sbjct:   15 LIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDSVNKILVGNKADMDESK-RAVPKSKGQALADEYGMKFFETSAKTNLNVEEVFFSIAKDIKQR 180          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P28186|RAE1C_ARATH (Ras-related protein RABE1c OS=Arabidopsis thaliana OX=3702 GN=RABE1C PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.811e-43
Identity = 75/167 (44.91%), Postives = 115/167 (68.86%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + K++L+GDS VGKS +L RF +G+F  ++  TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G++LVYD+ +  SF NIRNWI N+E++  D V  +++GNK D+ +S+ +A+PT     L+ EYG   FE SA T  N+ E F ++ + +K R
Sbjct:   15 LIKLLLIGDSGVGKSCLLLRFSDGSFTTSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDESSFNNIRNWIRNIEQHASDNVNKILVGNKADMDESK-RAVPTAKGQALADEYGIKFFETSAKTNLNVEEVFFSIGRDIKQR 180          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P20790|RAB8A_DICDI (Ras-related protein Rab-8A OS=Dictyostelium discoideum OX=44689 GN=rab8A PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 1.385e-41
Identity = 78/182 (42.86%), Postives = 115/182 (63.19%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPS 2094
            + K++L+GDS VGKS +L RF   +F  ++  TIG+DF +++IE+E   I LQ+WDTAGQER+ +IT  +YR   G++LVYD+ +  SF NIRNWI N+E++  D V  M++GNK D+A  + K + +     L+ EYG    E SA    N+ E+F +LAK +K R     N   Q+ +P 
Sbjct:   15 LIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGNIRNWIRNIEQHATDSVNKMLIGNKCDMA--EKKVVDSSRGKSLADEYGIKFLETSAKNSINVEEAFISLAKDIKKRMIDTPNEQPQVVQPG 194          
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Match: sp|P20791|RAB8B_DICDI (Ras-related protein Rab-8B OS=Dictyostelium discoideum OX=44689 GN=rab8B PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.858e-41
Identity = 74/167 (44.31%), Postives = 111/167 (66.47%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            + K++L+GDS VGKS +L RF +G+F  ++  TIG+DF +++IE+E   I LQ+WDTAGQER+ +IT  +YR   G++LVYD+ +  SF +IRNWI N+E++  D V  M++GNK D+  ++ K + +     L+ EYG    E SA    N+ E+F  LAK +K R
Sbjct:   15 LVKLLLIGDSGVGKSCLLLRFSDGSFTPSFIATIGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGSIRNWIRNIEQHASDSVNKMLIGNKCDM--TEKKVVDSSRGKSLADEYGIKFLETSAKNSVNVEEAFIGLAKDIKKR 179          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: A0A1S8X7B6 (Ras family protein OS=Opisthorchis viverrini OX=6198 GN=X801_01536 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.024e-91
Identity = 223/683 (32.65%), Postives = 368/683 (53.88%), Query Frame = 1
Query:  121 DEVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIGDVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCSVVEK--ETASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDE-------GLMQTP------ETSRSPSPQPEMLNFTDRLP---INNDPDNESDEADGQTINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREID--VQTEQEEKKETAVEKPIDIQYKLIF-------SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLD-LAKSQPKAIPTKNACD-LSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQL 2082
            D  V   A+ L+  CD D +G+IT+++ D +K  LPL  +QL+++FD LD++  G +T + F +GFGQF   + + +    S    +D S EE +      +   V+ K  E  S ++++LK   P LL  FE +LT + KE+E + +  + M+ TI ++  + E+ + R+Y+E+E Q+  E++RL A+E ++ ++++E L + +  +++   EL  + E+   RL+E+  +    Q+E   L +EKD L+  L +T+S LE+C+  +  LQ K++ED+R RA  A  +S  I+ ER+ L+ QL  L+ +N+KL D+R+E       G +Q+       ET   P   PE     DR+    I +D     +   G+T +  +     ++A +  G  M+ Y    +G                 ++     +N   ++     +  N+    PV++  +     +  E K ET +     +  +L F       S ++M + VFKV  VGDSNVGKS+I+ RF  G F+ N   T+GVD   K +E +++I+ LQLWDTAG ER+  +T+Q+YR+ D VILVYD+    SF+++R W+  V  NT +  +LM+L NK+D L +      PTKN  D L  E GA+ FEVSA  G+NI  +F  L K+L + +D  + N  +L
Sbjct:    4 DPSVIGEARILFSLCDPDDRGFITRQDFDRVKEHLPLEDDQLDAIFDVLDENNEGCVTSEVFLKGFGQFFSKNREDRGVEISGSSGQD-SDEENHKHALKAVGADVLLKDYEQISRIWKQLKRDNPPLLSDFERMLTGIAKELETAKSEHQSMDQTIQKKLCKQEEHLSRMYEELEQQLNQEKERLAAQEREKERKMREELMKKVQSQERLAAELTTQYEEALARLEEIGNIHAVTQQERDQLTQEKDTLQSRLHDTQSALEDCKEYIATLQKKAREDKRNRAKAAIELSQNIALERENLVRQLDSLRLVNRKLLDDREERNHRRVSGTVQSTSIIREGETIPLPLTHPEEPG-KDRMVTCRITHDHGLVCEAEFGKTDSRSMGSTGISKARR--GSIMAAY----FGPVLSRRGSSENDLT--GIMEGVESDNEEVFKTGRYPIDHNL--GHPVRWSSVQGPFGSMDEAKVETVLPGLAAVD-QLSFRSDDGAVSRQQMAQRVFKVTFVGDSNVGKSSIIHRFVEGEFKSNLGATVGVDVNTKFVECDSVIVILQLWDTAGLERFRGLTRQYYRRADAVILVYDVTNIQSFLSVRKWVQEVRDNTDEYTVLMILSNKIDLLPEVSSDQYPTKNDLDALCTENGAIGFEVSAALGQNIELAFNDLTKLLMVEEDFKLKNVLEL 673          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: G7YAP1 (Ras and EF-hand domain-containing protein OS=Clonorchis sinensis OX=79923 GN=RASEF PE=4 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 4.546e-89
Identity = 216/664 (32.53%), Postives = 355/664 (53.46%), Query Frame = 1
Query:  121 DEVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIGDVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCSVVEK--ETASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDE-------------GLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKL-FGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQY-KLIF-------SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQP-KAIPTKNACD-LSREYGALMFEVSALTGENINESFATLAK 2034
            D  V   A+ L+  CD DG+G+IT+++ D +K  LPL  +QL+++FD LD++  G +T + F +GFGQF   + + +    S    +D S EE +      +   V+ K  E  S ++++LK   P LL  FE +LT + KE+E + +  + M+ TI ++  + E+ + R+Y+E+E Q+  E++RL A+E ++ ++++E L + +  +++   +L  + E+   RL+E+  +    Q+E   L +EKD LE+ L++T+S LE+C+  +  LQ K++ED+R RA  A  +S  I+ ER+ L+ QL  L+ IN+KL D+R+E              +++  ET   P   PE       +     PD+     D +   +D R +     SK   G  M+ Y    +G                 +     ++N   ++     +  N+     V++  +       ++ +    +P  +   +L F       S  +M + VFKV  VGDSNVGKS+I+ RF  G F+ N   T+GVD   K +E +N+ + LQLWDTAG ER+  +T+Q+YR+ D VILVYD+  T SF+++R W+  V  NT +  +LM+L NKLDL    P +  PT N  D L +E  A+ FEVSA +G+NI  +F  L K
Sbjct:    4 DSSVIGEARILFSLCDPDGRGFITRQDFDRVKEHLPLEDDQLDAIFDVLDENNEGYVTSEVFLKGFGQFFSKNREDRSVEISGSSGQD-SDEENHKHALKAVGADVLLKDYEQISRIWKQLKRDNPPLLSDFERMLTGIAKELETAKSEHQTMDQTIQKKLCKQEEHLSRMYEELEQQLNQEKERLSAQEREKERKVREELMKKVQFEERLAADLTTQYEEALARLEEIGNIHAMTQQERDQLTQEKDTLEKRLQDTQSALEDCKEYIATLQKKAREDKRNRAKAAIELSQNIALERENLVRQLDSLRLINRKLLDDREERNHRRVSGTVQSTSILREGETIPLPLTDPEEPGKYGTVICRIRPDHVGLVCDTEFGKTDSRSMDSTGISKARRGSIMAAY----FGPALPRRGSSENDLI--GITEAGEVDNEEVFKTGGSHIAHNL--EYLVRWSSVQGPFGSVDEVKVGTVRPGSVAVDQLSFRSNDDAVSRSQMAQRVFKVTFVGDSNVGKSSIIHRFVEGEFKSNLGATVGVDVNTKFVECDNVNVILQLWDTAGLERFRGLTRQYYRRADAVILVYDVTNTQSFLSVRKWVQEVRDNTDEYTVLMILSNKLDLLPEVPSEQYPTTNDLDALCKENDAIGFEVSAASGQNIELAFNDLTK 658          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: A0A3B5MEH4 (Calcium release activated channel regulator 2Ab OS=Xiphophorus couchianus OX=32473 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 6.641e-87
Identity = 218/659 (33.08%), Postives = 349/659 (52.96%), Query Frame = 1
Query:  139 RAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQF-------IIGDVQTKKR--HSSDFEDRDFSFEEKNTKFQDNLSCSVVEKETASN-------LYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDER----DEGLMQTPETSRSPSPQPEML---NFTDRLPINND--PDNESDEADGQTINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALL--SDEPLENRAFYRASLGSVQANIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAK 2034
            + KE + TCD +GKG+IT+ +M  L   LPLS E+LE VFDSLD D  G LTL+ F+  F  F         G V   K   + S +E R    E++    ++   C ++E   ASN       L+ +L+   P+LL  FE  L ++T +I+ +H   K+MES + ++   H+ +IR +Y+EMEAQIK+E+ RL+ ++++R +   + LE  L  K++  ++L  KQ++ + +  EL+    ++  E   L    + L  ALE +   L   Q  L  LQ ++    +++      ++ G+  E+  L+ QL  L+E+NK LKDER    D     T  T+ + + +   L   N +   P   D  P      A   T    + K +     K+ GE   V      G          E    P LL    +PL ++      + S + + +  +PV  R   V   +E K E AV           F+    P+ +FKVVLVG+S+VGK+++L  FC G F  +   T+G+D+ +K++ ++N+ IA+QLWDTAGQER+ S+TKQF+RK DGV+L+YD+    SF  +R W+ NV++  G+ + +++LGNK+D+ +   + +P+K+A  L+ E   + FEVSA TG+N+ ES   LA+
Sbjct:   26 KTKEFFQTCDVEGKGFITRTDMRRLHRELPLSAEELEDVFDSLDTDRAGYLTLEAFSSRFSTFPPFNKLSAPGPVLKAKEALYQSQWEARLSGVEDE----EERHFCMLLESLGASNVPGEVRNLWAQLRRDEPHLLSNFEEFLARVTYQIKEAHQEKKEMESALQRKTATHDNEIRHLYEEMEAQIKNEKDRLVLQDSERLQVRSQELEHQLFSKEQELEQLFQKQKRLELQCHELNSERQESHVENVKLKTTNEELSRALESSSLELSLAQEHLALLQEQAARLHQEKEMEMYRITEGLQREKQCLMKQLDLLREMNKHLKDERDVFYDAPAAPTAMTACTTAKKIATLANGNISPGPPREQDVKPKPRRTSAKNATNRKVMVKAREESERKMSGEEGEVLSEPTDGWPLRKVISIEEDHL-PHLLQGGPQPLLHQLSEEEDVSSTKKSQLKKTPVSPRCQPVG--REAKPERAV-----------FA----PDRLFKVVLVGNSSVGKTSLLRSFCEGRFHPSTTATVGIDYSVKTLTLDNMQIAMQLWDTAGQERFRSMTKQFFRKADGVVLMYDVTVAESFTAVRPWLLNVQEAAGEGIPILLLGNKMDMTRE--REVPSKDAEQLAFENKVMFFEVSAYTGKNVTESLTHLAR 660          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: A0A4W5P051 (Calcium release activated channel regulator 2A OS=Hucho hucho OX=62062 GN=CRACR2A PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.163e-86
Identity = 219/697 (31.42%), Postives = 360/697 (51.65%), Query Frame = 1
Query:  127 VVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG------------------DVQTKKRHSSD------FEDRDFSFEEKNTKFQDNLSCSVVEKETASNLYE----------KLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPE-TSRSPSPQPEM----LNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGS---------VQANII--VASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEE----MPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
             + ++  + + TCD + KG+IT+++M  L   LPLS E+LE+VFD+LD DGNG LTL+EF+ GF +F+ G                    Q   +   D      +E+R    E++  K      C ++E   ASN++E          +L+   P+LL  FE  L ++  +I  ++    +MES + +++  H+ +I R+Y+EME QIK+E+ R++ ++++R     + LE  LS K++   ++  KQ + + + +EL       + E   L +  + L + LE T   L   Q  L  LQ +S    ++R      V+ G+  ER  LL QL  L+E+NK L+DERD    Q P  T ++P+  P +    LN  DR   + D +          ++   RK        + G ++     S+           IE D  P LL D+       Y+  L           +Q N I   +SP    +  V T + E   +   +P+    K     EE     P+ +FK+VLVG+S+VGK++ L RFC+  F      T+G+D+ +K+I V+N  +ALQ+WDTAGQERY SITKQF+RK DGV+++YDI    SF  +R W+ +V++  G+++ +M+LGNK+D  K   + + T+    L++++  + +E SA +G+N+ +S   LA++LK ++D
Sbjct:   46 TMLEKTHDFFQTCDIEDKGFITRRDMQRLHGELPLSAEELENVFDTLDSDGNGYLTLEEFSLGFSEFLFGRRISVTEGMGEASPIAKEPTQGPTQGPPDSLYQIQWEERLAGSEDEEKKH----FCMLMESLGASNVFEDPGEVRSLWAQLRRDEPHLLSNFEEFLARVILQITGANQERMEMESALKRKSATHDDEIHRLYEEMEQQIKNEKDRILLQDSERFLSRSQDLEHQLSSKERELDQIFQKQRRWEHQCRELHSEQHVTKVENVTLKQTNEELAQELEHTSQELSLAQEQLVLLQEQSSHLNQEREMEMYRVTEGLQRERASLLKQLDLLREMNKHLRDERDMCSYQKPRNTVKNPACNPRLGSNTLNPFDRKAFSEDEEV--------VLHHSKRK----SPGGVNGYSLEDVVDSRPLHRPLQRIISIEEDHLPQLLQDD-------YQTQLWEWHEEEEHIELQMNSINPPSSPQTMEQQPVDTRETEMPTSPRGQPVG---KETIGNEEGAALAPDRLFKIVLVGNSSVGKTSFLRRFCDDCFYPGTSATVGIDYSVKTILVDNSQVALQMWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLTSVQEGAGEDIPIMLLGNKMD--KGSERKVQTRVGEKLAKDWQLIFYECSACSGQNVVDSMVNLARILKEQED 714          
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Match: A0A3P9QAD9 (Calcium release activated channel regulator 2A OS=Poecilia reticulata OX=8081 GN=CRACR2A (1 of many) PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.044e-85
Identity = 221/686 (32.22%), Postives = 359/686 (52.33%), Query Frame = 1
Query:  127 VVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG------DVQTKKR---------HSSDFEDRDFSFEEKNTK----FQDNLSCSVVEKETAS--NLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQ--PEMLNFTDRLPINNDPDNE-SDEADGQTINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALL----SDEPLENRAFYRASLGSVQANIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIF-SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQL-TKPS 2094
             + ++  E +  CD + KG+IT+++M  L + LPLS ++LE+VFDSLD DGNG LTL+EF+ GF  F+ G      DV T+K+         + S +++   + E+   K      ++L  S +    A   +L+ +L+   P LL  FE  L ++T +I  ++   + MES + ++   H+ +I+ +Y+EME QIK+E+ +++ ++  R     + LE  LS K+K  ++L  KQ + + + +EL     + + E   L +  D L   LE     L   Q  L  LQ +S     ++      ++ G+  ER  L  QL  L+E+NK L+DERD    +   T +S   +   + +  TD    N++ + E +  A  Q +N   +    AEA   F   +S+ E                 D  P LL    +   L++ A     L   +  + V S +  R   +QTE+ +   +   +P+  +  +   S    P+ +FKVVLVG+S+VGK++IL RFC+  F      T+G+D+ +K+I V+N  +ALQLWDTAGQERY SITKQF+RK DGVI++YD+    SF  +R W+ +V++ TG E+ +M+LGNK D  K   + +  +    L+++     FE SA +G N+ ES   LA++LK ++D       QL + PS
Sbjct:   46 TILEKTHEFFQMCDTESKGFITRRDMQRLNDELPLSADELENVFDSLDSDGNGFLTLEEFSSGFSAFLFGRRISVDDVMTEKKLSKSVPEVLYQSQWKEGPGAAEDDEEKHFAMLMESLGASSLLDHPAEVRSLWAQLRRDEPQLLSNFELFLARVTAQIRDANQEKRDMESALRRKTATHDDEIQHLYEEMEQQIKNEKDKILLQDYDRYLSRSKDLELQLSSKEKELEQLFQKQRRLECQCQELHSEQHETKVENVKLKQTNDDLARELELVSQELTLAQEQLGLLQEQSARLHEEKEMEIYRLTEGLQRERASLHKQLDLLREMNKHLRDERDMSFQKPKGTKKSLKHRFFIDGVKQTDTDVFNSEDEEEPTSSALRQNLNGFYQPSFPAEARSRFQRIISIEE-----------------DHLPYLLNSGLAQNALQDCAEVETQLDD-EDGVDVTSELHRRSSPIQTEERQIPTSPRGQPVGKETTINEESAPSAPDRLFKVVLVGNSSVGKTSILQRFCDDRFHPGTCATVGIDYSVKTITVDNSQVALQLWDTAGQERYRSITKQFFRKADGVIVMYDVTAEQSFTAVRQWLTSVKEGTGGEIPIMLLGNKTD--KEAEREVQKEVGERLAKDCQMTFFECSACSGANVAESMVHLARILKEQEDQQKEKTVQLISSPS 711          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: rab15 (ras-related protein Rab-15 [Source:NCBI gene;Acc:103033217])

HSP 1 Score: 151.369 bits (381), Expect = 1.948e-41
Identity = 69/164 (42.07%), Postives = 111/164 (67.68%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +F+++L+GDS VGK+ +L RF +  F  ++ +TIGVDF +K++E++ I + +Q+WDTAGQERY++I+KQ+YR+  G+ LVYDI    SF +I  W  +V++   D+V  +++GNK D  + Q + + T     L++ YG   +E SA T  NI ESF  LA+++
Sbjct:    8 LFRLLLLGDSGVGKTCLLCRFTDNEFHPSHISTIGVDFKMKTLEIDGIKVRIQIWDTAGQERYQTISKQYYRRAQGIFLVYDITSERSFQHIMKWASDVDEYAPDKVQRILVGNKSD--EEQKRQVATAQGDKLAKAYGMDFYETSAFTNHNITESFTRLAELV 169          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: cracr2ab (calcium release activated channel regulator 2Ab [Source:ZFIN;Acc:ZDB-GENE-041210-94])

HSP 1 Score: 157.918 bits (398), Expect = 2.199e-41
Identity = 78/181 (43.09%), Postives = 120/181 (66.30%), Query Frame = 1
Query: 1540 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQL 2082
            PE +FKV+LVG+S+VGK+A L RFC+G F      T+ +D+ ++++ + N  +ALQLWDTAGQE Y SITKQF+RK DGV+++YD+    SF ++  W+ ++++  GD + +M+LGNK D+     + +PTK A  L+ E   + +E SA TG N+ E+   LA VL+ ++D    N  +L
Sbjct:  244 PERLFKVILVGNSSVGKTAFLRRFCDGHFHATTTATV-IDYSVRTLNLGNSHVALQLWDTAGQE-YRSITKQFFRKADGVVVLYDVTMQSSFRSVHPWLVSIQEAVGDPIPIMLLGNKSDMESI--RQVPTKEAKRLAEETNLMFYECSAYTGYNVLEAMLHLA-VLREQEDRVWENTVRL 419          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:103044636])

HSP 1 Score: 147.517 bits (371), Expect = 3.199e-40
Identity = 71/167 (42.51%), Postives = 111/167 (66.47%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            +FK++L+GDS VGK+ ++ RF    F   Y +TIG+DF +K+IEVE   + LQ+WDTAGQER+++IT  +YR   G+ILVYDI +  SF NI+NW+ ++++N    V  M+LGNK D+     + +  +    L++++G   FE SA +  N+ ESF +LA+ + L+
Sbjct:    8 LFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVSRMLLGNKCDI--EAKRKVSKEMGEKLAKDHGIRFFETSAKSSINVEESFMSLARDILLK 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000049453.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:35571610:35594001:1 gene:ENSAMXG00000029651.1 transcript:ENSAMXT00000049453.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.458 bits (402), Expect = 1.134e-39
Identity = 75/179 (41.90%), Postives = 121/179 (67.60%), Query Frame = 1
Query: 1531 EEMPE---SVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDV 2058
            E++P+   +V+ VV+VG+S+VGK++ ++R  +G F  +Y +TIGVD  +++I +    + L +WDTAGQERY SIT+Q + K  G++L+YDI  + SF  +RNW+  +++   D+V++++LGNK D A+   + +  +   DLSREY     E SA TGEN+ ES  TLA +L ++Q+V
Sbjct: 1565 EQIPDFGVAVYNVVMVGNSSVGKTSFMNRLQSGHFSPDYCSTIGVDTCVQNITLGGRTVKLHVWDTAGQERYHSITRQVFHKAQGLLLMYDITSSESFCAVRNWVTQIKECAPDDVIMILLGNKNDCAE---RKVQLQEGEDLSREYKIHFLECSAATGENVEESMKTLACLL-VKQNV 1739          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046759.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:35582476:35594001:1 gene:ENSAMXG00000029651.1 transcript:ENSAMXT00000046759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.458 bits (402), Expect = 1.345e-39
Identity = 75/179 (41.90%), Postives = 121/179 (67.60%), Query Frame = 1
Query: 1531 EEMPE---SVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDV 2058
            E++P+   +V+ VV+VG+S+VGK++ ++R  +G F  +Y +TIGVD  +++I +    + L +WDTAGQERY SIT+Q + K  G++L+YDI  + SF  +RNW+  +++   D+V++++LGNK D A+   + +  +   DLSREY     E SA TGEN+ ES  TLA +L ++Q+V
Sbjct: 2136 EQIPDFGVAVYNVVMVGNSSVGKTSFMNRLQSGHFSPDYCSTIGVDTCVQNITLGGRTVKLHVWDTAGQERYHSITRQVFHKAQGLLLMYDITSSESFCAVRNWVTQIKECAPDDVIMILLGNKNDCAE---RKVQLQEGEDLSREYKIHFLECSAATGENVEESMKTLACLL-VKQNV 2310          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 149.443 bits (376), Expect = 1.960e-41
Identity = 76/189 (40.21%), Postives = 119/189 (62.96%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDI-------NNAFQLTKPS 2094
            +FK++L+GDS VGK+ +L RF    F   + +TIG+DF +++I+++   I LQ+WDTAGQER+ +IT  +YR   G++LVYDI    SF NI+NWI N+E++   +V  M+LGNK D+  ++ + +  +    L+ EYG    E SA    N+ E+F TLA+ +K + D  +       +NA ++T PS
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDM--NERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRKLEGNNTPDSNAVRITAPS 194          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 137.117 bits (344), Expect = 3.809e-37
Identity = 65/167 (38.92%), Postives = 106/167 (63.47%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLR 2049
            +FK++L+GDS VGKS +L RF + T+ E+Y +TIGVDF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G+I+VYD+ +  SF N++ W+  +++   + V  +++GNK DL  +  K +    A + +        E SA    N+ ++F T+A  +K R
Sbjct:   11 LFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDL--TTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKR 175          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab30 (RAB30, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-250])

HSP 1 Score: 134.806 bits (338), Expect = 2.565e-36
Identity = 65/166 (39.16%), Postives = 100/166 (60.24%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKL 2046
            +FK+VL+G++ VGK+ ++ RF  G F      TIGVDFM+K++EV+   I LQ+WDTAGQER+ SIT+ +YR    ++L YD+    +F  +  W+  +E++    V  +++GNKLDLA    + +  + A   +R +G    E SA   EN+   F  LA+ L L
Sbjct:    9 LFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEVDGTKIKLQIWDTAGQERFRSITQSYYRSAHALVLTYDVSSEETFACLPAWLREMEQHASAHVPRVLVGNKLDLADV--RQVTREQAEAFARLHGLRYLETSAKEAENVERLFVELARRLAL 172          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rasef (RAS and EF-hand domain containing [Source:ZFIN;Acc:ZDB-GENE-081105-157])

HSP 1 Score: 145.206 bits (365), Expect = 2.671e-36
Identity = 69/168 (41.07%), Postives = 105/168 (62.50%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKA----IPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            V+K+VL GD+ VGKS+ L R C   FR++   T+GVDF +K++ V+   + LQLWDTAGQER+ SI K ++R+ DGV+L+YD+    +F+N+R+WID +E +    + +M++GNK D+    P A    +       L+  Y AL  E SA  G N+ E+   LA+ +
Sbjct:  570 VYKLVLAGDAAVGKSSFLLRLCRNEFRKDTIATLGVDFQMKTLIVDGEHMTLQLWDTAGQERFRSIAKSYFRRADGVLLLYDVTCEKTFLNVRDWIDIIEDSAPKSIPVMLVGNKSDMRNMSPGADQKYVAHTFGEKLAMNYNALFCETSAKDGSNVVETVLHLARYV 737          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 128.257 bits (321), Expect = 5.676e-34
Identity = 63/172 (36.63%), Postives = 101/172 (58.72%), Query Frame = 1
Query: 1525 SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            +G +M +  FK+VL+G+S VGKS+++ RF  G F E   +TIG  F+ +++ +E+  +  ++WDTAGQERY S+   +YR     I+VYDI    SF   +NW+  +++     +++ + GNK DLA    + +  + A   S + G L  E SA T  N+N+ F  +AK L
Sbjct:   15 AGNKMCQ--FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDLANQ--RTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKL 182          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 142.124 bits (357), Expect = 5.462e-39
Identity = 68/171 (39.77%), Postives = 108/171 (63.16%), Query Frame = 1
Query: 1543 ESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            +S+ K++L+GDS VGKS +L RF    F  ++  TIG+DF +K++++    + LQLWDTAGQER+ +IT  +YR   G+ILVYD+ +  +F NI+ W   V ++  DE  L+++GNK D+   + + +       L++E G    E SA   +N+NE F TLAK+++ + D
Sbjct:   18 DSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM---ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKID 185          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 141.354 bits (355), Expect = 1.094e-38
Identity = 70/160 (43.75%), Postives = 103/160 (64.38%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATL 2028
            +FK+VL+GDS VGKS +L RF    F    ++TIGV+F  ++IEVEN  I  Q+WDTAGQERY +IT  +YR   G ++VYDI ++ S+ N  +W+  + +N  D V + ++GNK DLA    +A+PT  A + + E   L  E SAL  +N++++F  L
Sbjct:   13 LFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLA--HLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFREL 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 138.658 bits (348), Expect = 9.940e-38
Identity = 66/160 (41.25%), Postives = 104/160 (65.00%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATL 2028
            +FK+VL+GDS VGKS +L RF    F  + ++TIGV+F  +++E++   I  Q+WDTAGQERY +IT  +YR   G ++VYDI ++ S+ N  +W+  + +N  D V + ++GNK DLA    +A+PT+ +   ++E   L  E SAL  EN++++F  L
Sbjct:   13 LFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLA--HLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEEL 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 135.576 bits (340), Expect = 1.706e-36
Identity = 74/196 (37.76%), Postives = 114/196 (58.16%), Query Frame = 1
Query: 1552 FKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSI--------EVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTG-DEVMLMMLGNKLDLAKSQP------------------KAIPTKNACDLSREYGALMFEVSALTGENINESFATLA-KVLKLRQD 2055
            FK+VL+GDS+VGKS+I+ RF   TF E   +TIG  F+ +SI        E ++++I  ++WDTAGQERY+S+   +YR  +  ++VYDI +  S    RNW+D ++   G D++++ +LGNK+DL +  P                  +AI T+ A   ++E G L  EVSA TGE + E F  +  K+  L++D
Sbjct:    4 FKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKLYDLKKD 199          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 130.183 bits (326), Expect = 6.571e-35
Identity = 61/169 (36.09%), Postives = 107/169 (63.31%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGAL----MFEVSALTGENINESFATLAKVLK 2043
            +FK++L+G+S VGKS +L RF + T+  +Y +TIGVDF +K++E++   + LQ+WDTAGQER+ +IT  +YR + G+I+VYD+ +  SF  ++ W+  +++     V+ +++GNK DL   +          D+++E+         E SAL   N+ ++F T+A+ +K
Sbjct:    8 LFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEY------DVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIK 170          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO28399 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 163.31 bits (412), Expect = 9.659e-47
Identity = 77/163 (47.24%), Postives = 113/163 (69.33%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKS-QPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAK 2034
            VFKVV +GDS VGKS+ L RFC+  ++ ++  TIGVDF +K++ V    IA+QLWDTAGQER+ SITKQ++RK DG+++ YD+    SF N+++W+ +VE+   + V  M+LGNK DLA+  + + + T +  +L+ +Y AL  E SA TG NI E+   LA+
Sbjct:    1 VFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEGAEEGVAKMVLGNKTDLAEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLAE 163          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO47822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL89])

HSP 1 Score: 163.31 bits (412), Expect = 9.659e-47
Identity = 77/163 (47.24%), Postives = 113/163 (69.33%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKS-QPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAK 2034
            VFKVV +GDS VGKS+ L RFC+  ++ ++  TIGVDF +K++ V    IA+QLWDTAGQER+ SITKQ++RK DG+++ YD+    SF N+++W+ +VE+   + V  M+LGNK DLA+  + + + T +  +L+ +Y AL  E SA TG NI E+   LA+
Sbjct:    1 VFKVVFIGDSGVGKSSFLHRFCHDQWKPSFTATIGVDFQIKTMNVNGQCIAIQLWDTAGQERFRSITKQYFRKADGILIFYDVTAESSFTNLKSWMVSVEEGAEEGVAKMVLGNKTDLAEDEESRVVKTIDGKNLANQYDALYMETSAKTGNNIQEAMYKLAE 163          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 151.369 bits (381), Expect = 5.907e-42
Identity = 74/175 (42.29%), Postives = 112/175 (64.00%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNA 2073
            +FK++L+GDS VGK+ +L RF    F   + +TIG+DF +++IE++   I LQ+WDTAGQER+ +IT  +YR   G++LVYDI    SF NI+NWI N+E++   +V  M+LGNK D+     + +  +    L+ EYG    E SA    N+ E+F TLA+ +KL+ D  + N+
Sbjct:    8 LFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDM--EDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENS 180          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO40857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S613])

HSP 1 Score: 147.902 bits (372), Expect = 3.176e-41
Identity = 68/166 (40.96%), Postives = 108/166 (65.06%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPK----AIPTKNACDLSREYGALMFEVSALTGENINESFATLAK 2034
            +FK+VL GD+ VGKS+ + R C   F     +T+GVDF +K++ V+    ALQLWDTAGQER+ SI K ++RK DGV+L+YD+    SF+++R+W++ +E++    V +M+ GNK+D+ +S        I  ++   L++E+GAL  E S+   +NI E+   LA+
Sbjct:    1 MFKIVLAGDAAVGKSSFILRLCRNRFHSALNSTLGVDFQMKTLVVDGKTYALQLWDTAGQERFRSIAKSYFRKADGVLLLYDVTCETSFLDVRDWVEAIEESCSKPVPIMLCGNKIDIRQSAAAENKTVITAESGSRLAKEHGALFIETSSKENKNIAEACIELAR 166          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Match: EDO34945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW9])

HSP 1 Score: 145.591 bits (366), Expect = 8.593e-40
Identity = 74/176 (42.05%), Postives = 115/176 (65.34%), Query Frame = 1
Query: 1525 SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGAL-MFEVSALTGENINESFATLAKVLKLR 2049
            S EE  + +FK+VL+GD  VGK+ I+ RF +GTF E   +TIGVDF ++S++V+N  I LQ+WDTAGQER+ +IT+ +YR  +GVI+ YDI +  +F N+  W ++V+K   +  + +++GNK DL +   + +  ++A + +  YG L + E SA    NI  +F  LA+ LK R
Sbjct:    5 STEEFFDYLFKIVLIGDPGVGKTCIVQRFRSGTFVERNGSTIGVDFTMRSVQVDNKKIKLQIWDTAGQERFRTITQSYYRSCNGVIIAYDITKCDTFKNVIRWGEDVQKYAPENAIKLLVGNKKDLER--EREVSLEDAVNCASHYGMLDVLETSAKDATNIEAAFYRLARELKNR 178          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027276.1 (calcium release activated channel regulator 2A [Source:NCBI gene;Acc:101161971])

HSP 1 Score: 273.863 bits (699), Expect = 1.055e-80
Identity = 214/681 (31.42%), Postives = 348/681 (51.10%), Query Frame = 1
Query:  124 EVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG-DVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCS----VVEKETASN----------LYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETS-------RSPSPQPEMLNFTDRLPINND--PDNESDEADGQ--TINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDV---QTEQEEKKETAVEKPIDIQYKLIF--------SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            + + ++  E +  CD + KG+I +++M  L   LPLS+ +LE+VFD LD D NG LTL+EF+ GF  F+ G  V    +  +  +     +EE  T+  +         ++E+  A+N          L+  L+   P LL  FE+ L ++T +I  ++   K+ME  + ++A +H+ +I+ +Y+EME QIK+E+ R++ ++ +R       LE  LS K+K  ++L  KQ + + + +EL       + E   L +    LE  L+     L   Q  LE LQ +S +   ++      V+ G+  +R  LL QL  L+E+NK L+DERD  +   P+ S       + PS         D L ++N   P +E +EA+ +  + N+  +    A   +     +S+ E                    P L++         YR+S  S+Q +  V         D     T  EE  ET  + P   + + +         S    P+ +FKVVLVG+S+VGK+  L RFC+  F      T+GVD+ +K++ V+N  +ALQLWDTAGQERY SITKQF+RK DGV+++YDI    SF  +R W+ +V+++  +E+ +M+LGNK D  K   + +  K    L+++    +FE SA +GEN+ ES   LA++LK ++D
Sbjct:   45 DAILEKIPEFFQMCDLENKGFINRRDMQRLNGELPLSENELENVFDCLDSDSNGFLTLEEFSSGFSAFLHGQSVDPSTKDGNPCKILPEVWEEGPTREDEYEEEEHFSVLMERLGANNAFEDPAEVRSLWAHLRRDEPQLLSNFEDFLARVTSQIMKANQEKKEMECALEKKAAKHDDEIQHLYEEMEQQIKNEQDRIVLQDYERFLSRSRDLELQLSNKEKELEQLFQKQRKLEFQCQELHGKQHVTKVENMKLKQSNGELERELQYVSQKLMFAQEQLELLQEQSSKLHEEKEMEVYRVTEGLHRDRASLLKQLDLLREMNKHLRDERD-MVHHKPKNSLRRATLKQRPS--------VDELKVSNAEFPRSEDEEAETRLSSKNASSQPCLSAVPGRHLRRIISIEEDH-----------------LPHLVN---------YRSSPNSLQESDGVDDLCSEEMEDFVYPNTSAEENGETERQMPTSPRVQPVGKETSINEESAPSAPDRLFKVVLVGNSSVGKTCFLRRFCDDCFHPGTCATVGVDYSVKTLTVDNSQVALQLWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLSSVKESANEEIPIMLLGNKTD--KEMERKVEKKMGERLAKDCQLSVFECSAYSGENVLESMVHLARILKKQED 688          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035474.1 (calcium release activated channel regulator 2A [Source:NCBI gene;Acc:101161971])

HSP 1 Score: 273.863 bits (699), Expect = 1.055e-80
Identity = 214/681 (31.42%), Postives = 348/681 (51.10%), Query Frame = 1
Query:  124 EVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG-DVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCS----VVEKETASN----------LYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETS-------RSPSPQPEMLNFTDRLPINND--PDNESDEADGQ--TINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDV---QTEQEEKKETAVEKPIDIQYKLIF--------SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            + + ++  E +  CD + KG+I +++M  L   LPLS+ +LE+VFD LD D NG LTL+EF+ GF  F+ G  V    +  +  +     +EE  T+  +         ++E+  A+N          L+  L+   P LL  FE+ L ++T +I  ++   K+ME  + ++A +H+ +I+ +Y+EME QIK+E+ R++ ++ +R       LE  LS K+K  ++L  KQ + + + +EL       + E   L +    LE  L+     L   Q  LE LQ +S +   ++      V+ G+  +R  LL QL  L+E+NK L+DERD  +   P+ S       + PS         D L ++N   P +E +EA+ +  + N+  +    A   +     +S+ E                    P L++         YR+S  S+Q +  V         D     T  EE  ET  + P   + + +         S    P+ +FKVVLVG+S+VGK+  L RFC+  F      T+GVD+ +K++ V+N  +ALQLWDTAGQERY SITKQF+RK DGV+++YDI    SF  +R W+ +V+++  +E+ +M+LGNK D  K   + +  K    L+++    +FE SA +GEN+ ES   LA++LK ++D
Sbjct:   45 DAILEKIPEFFQMCDLENKGFINRRDMQRLNGELPLSENELENVFDCLDSDSNGFLTLEEFSSGFSAFLHGQSVDPSTKDGNPCKILPEVWEEGPTREDEYEEEEHFSVLMERLGANNAFEDPAEVRSLWAHLRRDEPQLLSNFEDFLARVTSQIMKANQEKKEMECALEKKAAKHDDEIQHLYEEMEQQIKNEQDRIVLQDYERFLSRSRDLELQLSNKEKELEQLFQKQRKLEFQCQELHGKQHVTKVENMKLKQSNGELERELQYVSQKLMFAQEQLELLQEQSSKLHEEKEMEVYRVTEGLHRDRASLLKQLDLLREMNKHLRDERD-MVHHKPKNSLRRATLKQRPS--------VDELKVSNAEFPRSEDEEAETRLSSKNASSQPCLSAVPGRHLRRIISIEEDH-----------------LPHLVN---------YRSSPNSLQESDGVDDLCSEEMEDFVYPNTSAEENGETERQMPTSPRVQPVGKETSINEESAPSAPDRLFKVVLVGNSSVGKTCFLRRFCDDCFHPGTCATVGVDYSVKTLTVDNSQVALQLWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLSSVKESANEEIPIMLLGNKTD--KEMERKVEKKMGERLAKDCQLSVFECSAYSGENVLESMVHLARILKKQED 688          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046122.1 (calcium release activated channel regulator 2A [Source:NCBI gene;Acc:101161971])

HSP 1 Score: 273.863 bits (699), Expect = 1.055e-80
Identity = 214/681 (31.42%), Postives = 348/681 (51.10%), Query Frame = 1
Query:  124 EVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIG-DVQTKKRHSSDFEDRDFSFEEKNTKFQDNLSCS----VVEKETASN----------LYEKLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETS-------RSPSPQPEMLNFTDRLPINND--PDNESDEADGQ--TINSDIRKLKFAEASKLFGETMSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDV---QTEQEEKKETAVEKPIDIQYKLIF--------SGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQD 2055
            + + ++  E +  CD + KG+I +++M  L   LPLS+ +LE+VFD LD D NG LTL+EF+ GF  F+ G  V    +  +  +     +EE  T+  +         ++E+  A+N          L+  L+   P LL  FE+ L ++T +I  ++   K+ME  + ++A +H+ +I+ +Y+EME QIK+E+ R++ ++ +R       LE  LS K+K  ++L  KQ + + + +EL       + E   L +    LE  L+     L   Q  LE LQ +S +   ++      V+ G+  +R  LL QL  L+E+NK L+DERD  +   P+ S       + PS         D L ++N   P +E +EA+ +  + N+  +    A   +     +S+ E                    P L++         YR+S  S+Q +  V         D     T  EE  ET  + P   + + +         S    P+ +FKVVLVG+S+VGK+  L RFC+  F      T+GVD+ +K++ V+N  +ALQLWDTAGQERY SITKQF+RK DGV+++YDI    SF  +R W+ +V+++  +E+ +M+LGNK D  K   + +  K    L+++    +FE SA +GEN+ ES   LA++LK ++D
Sbjct:   45 DAILEKIPEFFQMCDLENKGFINRRDMQRLNGELPLSENELENVFDCLDSDSNGFLTLEEFSSGFSAFLHGQSVDPSTKDGNPCKILPEVWEEGPTREDEYEEEEHFSVLMERLGANNAFEDPAEVRSLWAHLRRDEPQLLSNFEDFLARVTSQIMKANQEKKEMECALEKKAAKHDDEIQHLYEEMEQQIKNEQDRIVLQDYERFLSRSRDLELQLSNKEKELEQLFQKQRKLEFQCQELHGKQHVTKVENMKLKQSNGELERELQYVSQKLMFAQEQLELLQEQSSKLHEEKEMEVYRVTEGLHRDRASLLKQLDLLREMNKHLRDERD-MVHHKPKNSLRRATLKQRPS--------VDELKVSNAEFPRSEDEEAETRLSSKNASSQPCLSAVPGRHLRRIISIEEDH-----------------LPHLVN---------YRSSPNSLQESDGVDDLCSEEMEDFVYPNTSAEENGETERQMPTSPRVQPVGKETSINEESAPSAPDRLFKVVLVGNSSVGKTCFLRRFCDDCFHPGTCATVGVDYSVKTLTVDNSQVALQLWDTAGQERYRSITKQFFRKADGVVVMYDITAEQSFTAVRQWLSSVKESANEEIPIMLLGNKTD--KEMERKVEKKMGERLAKDCQLSVFECSAYSGENVLESMVHLARILKKQED 688          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: cracr2ab (ras and EF-hand domain-containing protein homolog [Source:NCBI gene;Acc:101155481])

HSP 1 Score: 176.022 bits (445), Expect = 1.205e-45
Identity = 78/167 (46.71%), Postives = 119/167 (71.26%), Query Frame = 1
Query: 1540 PESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVL 2040
            P+ +FKVVLVGDS VGK+++L  FC G F  +   T+G+D+ +K++ +++I IA+QLWDTAGQERY SITKQF+RK DGV++++D+    SF  +R W++NV++  G+ + +++LGNK+D+   Q + +  K A  L+ E   + +EVSA TG N+ ES   LA+VL
Sbjct:  577 PDRLFKVVLVGDSCVGKTSLLRSFCEGRFHPSSTTTVGIDYSVKTLTLDSIQIAMQLWDTAGQERYRSITKQFFRKADGVVVMFDVTLEESFKAVRPWLNNVQEAAGEGIPILLLGNKMDM--EQEREVSFKAAERLAFENNMMFYEVSAYTGMNVTESLTHLARVL 741          

HSP 2 Score: 139.428 bits (350), Expect = 1.023e-33
Identity = 118/372 (31.72%), Postives = 200/372 (53.76%), Query Frame = 1
Query:  139 RAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVFDSLDDDGNGQLTLQEFTEGFGQFIIGD--VQTKKRHSSD---FEDRDFSFEEKNTKFQDNLS----------CSVVEKETASNLYE----------KLKNQYPNLLPGFENLLTKLTKEIEMSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNES 1179
            + KE + TCD +GKG++T+ +M  L   +PLS E+LE VFDSLD D  G LTL+ F+  F QF+ G     T  +H +     + ++  ++   ++++  LS          C ++E   A N++E          + +   P+LL  FE  L ++T +I+ ++   K+MES + ++A  H+ +IR +Y+EMEAQIK+E++RL+  +++R +   + LE  L  K++  + L  KQ++ + +  EL+    ++  E   L    D L +ALE T   L   Q  L  LQ +++  ++++      V+ G+  E+  L+ QL  L+E+NK LKDERD       E  +      EML+ T +L  + D DN+S
Sbjct:   30 KTKEFFQTCDVEGKGFLTRLDMRRLHREVPLSAEELEDVFDSLDMDHAGYLTLEAFSSRFSQFLHGRRISVTDDQHQASGPVLKTKEALYQ---SQWEAKLSGDEDEEERHFCMLLESLGAINVFEDPGEVQNLWTQFRRDEPHLLSNFEEFLARVTVQIKEAYQEKKEMESALQRKAATHDSEIRHLYEEMEAQIKTEKERLLLMDSERLQLRSQDLEHQLRSKERELEYLFQKQKRLELQCNELNSEKQESHVENLKLKMTNDELSKALECTGQELALAQEQLAMLQEQARRLQQEKEMEMYRVTEGLQREKQSLMRQLDLLREMNKHLKDERD----MFCEVQKQREDLDEMLDDTSKLEQSED-DNDS 393          
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037618.1 (ras-related protein Rab-15 [Source:NCBI gene;Acc:101168905])

HSP 1 Score: 148.673 bits (374), Expect = 1.746e-40
Identity = 72/174 (41.38%), Postives = 116/174 (66.67%), Query Frame = 1
Query: 1549 VFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTK-NACDLSREYGALMFEVSALTGENINESFATLAKVL--KLRQDVD 2061
            +F+++L+GDS VGK+ +L RF  G F  ++ +TIGVDF +K++ ++ I + +Q+WDTAGQERY++ITKQ+YR+  G++ VYDI +  SF++I  W  +V++   ++V ++++GNK D   ++PK   TK     L+  YG   FE SA T  NI ESF  + +++    + DVD
Sbjct:    8 LFRLLLLGDSGVGKTCMLRRFAEGEFDPSHISTIGVDFKMKTLVIDGIRVRVQIWDTAGQERYQTITKQYYRRAQGIVFVYDITDEPSFLHIGKWASDVDEYAPEKVQMILVGNKAD---NEPKRRVTKAQGSKLAEAYGMEFFEASASTSRNIKESFTRVTELVLQAYKNDVD 178          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000043201.1 (SMESG000043201.1)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 297/298 (99.66%), Postives = 297/298 (99.66%), Query Frame = 1
Query: 1261 MSVYETSKYGDTFXXXXXXXXXXXXPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNXXXXXXXXXERVSNRSKFI 2154
            MSVYETSKYGDTFDDEDDGIEIDEEPALLSDEPLENRAFYRASLGSVQ NIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI
Sbjct:    1 MSVYETSKYGDTFDDEDDGIEIDEEPALLSDEPLENRAFYRASLGSVQTNIIVASPVKYREIDVQTEQEEKKETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI 298          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000039352.1 (SMESG000039352.1)

HSP 1 Score: 416.772 bits (1070), Expect = 2.361e-139
Identity = 235/236 (99.58%), Postives = 235/236 (99.58%), Query Frame = 1
Query:  547 MSHNNVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG 1254
            MSHNNVKKMESTIAQQATEHEKKIR VYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGALLEEKDMLEEALEETESNLEECQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG
Sbjct:    1 MSHNNVKKMESTIAQQATEHEKKIRCVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGALLEEKDMLEEALEETESNLEECQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG 236          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000039353.1 (SMESG000039353.1)

HSP 1 Score: 407.527 bits (1046), Expect = 1.454e-138
Identity = 206/206 (100.00%), Postives = 206/206 (100.00%), Query Frame = 1
Query: 1537 MPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNXXXXXXXXXERVSNRSKFI 2154
            MPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI
Sbjct:    1 MPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI 206          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000039352.1 (SMESG000039352.1)

HSP 1 Score: 399.438 bits (1025), Expect = 9.709e-133
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 1
Query:  571 MESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGAXXXXXXXXXXXXXXXXXXXXXCQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG 1254
            MESTIAQQATEHEKKIR VYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGALLEEKDMLEEALEETESNLEECQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG
Sbjct:    1 MESTIAQQATEHEKKIRCVYDEMEAQIKSEEKRLIAEENQRRKQIKELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGALLEEKDMLEEALEETESNLEECQSILEELQNKSKEDRRQRAATATTVSIGISSERDILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPINNDPDNESDEADGQTINSDIRKLKFAEASKLFG 228          
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Match: SMESG000040702.1 (SMESG000040702.1)

HSP 1 Score: 381.719 bits (979), Expect = 1.866e-128
Identity = 199/206 (96.60%), Postives = 199/206 (96.60%), Query Frame = 1
Query: 1537 MPESVFKVVLVGDSNVGKSAILDRFCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQFYRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNXXXXXXXXXERVSNRSKFI 2154
            MPESVFKVVLVGDSNVGKSAILD     TFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQE YESITKQFYRKTDGVILVYDIMET SFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI
Sbjct:    1 MPESVFKVVLVGDSNVGKSAILD-----TFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQEIYESITKQFYRKTDGVILVYDIMETRSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAKSQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDVDINNAFQLTKPSNKSSCCCKKSERVSNRSKFI 201          
The following BLAST results are available for this feature:
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRACR2A4.630e-4542.11calcium release activated channel regulator 2A [So... [more]
RASEF5.639e-4145.20RAS and EF-hand domain containing [Source:HGNC Sym... [more]
RAB151.003e-4042.07RAB15, member RAS oncogene family [Source:HGNC Sym... [more]
AL358472.61.847e-4040.83novel protein[more]
RAB131.847e-4040.83RAB13, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
4R79.24.669e-4940.76pep chromosome:WBcel235:IV:17480396:17482329:-1 ge... [more]
4R79.22.230e-4840.76pep chromosome:WBcel235:IV:17480396:17483332:-1 ge... [more]
rab-84.265e-4043.64RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-84.265e-4043.64RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-16.141e-4040.72RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab84.955e-4143.79gene:FBgn0262518 transcript:FBtr0308833[more]
Rab84.955e-4143.79gene:FBgn0262518 transcript:FBtr0074921[more]
Rab196.297e-4039.57gene:FBgn0015793 transcript:FBtr0331832[more]
Rab196.297e-4039.57gene:FBgn0015793 transcript:FBtr0076705[more]
Rab17.177e-3940.12gene:FBgn0285937 transcript:FBtr0084104[more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cracr2ab1.884e-8230.27calcium release activated channel regulator 2Ab [S... [more]
cracr2ab1.506e-5030.65calcium release activated channel regulator 2Ab [S... [more]
CABZ01062083.11.614e-4543.60calcium release activated channel regulator 2Aa [S... [more]
rab155.242e-4142.07RAB15, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab135.739e-4142.01RAB13, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
irf68.043e-4245.71interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
irf61.927e-4145.71interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
irf62.047e-4145.71interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
mdn17.253e-4143.29midasin AAA ATPase 1 [Source:Xenbase;Acc:XB-GENE-9... [more]
irf67.395e-4146.43interferon regulatory factor 6 [Source:Xenbase;Acc... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cracr2a3.755e-4642.16calcium release activated channel regulator 2A [So... [more]
Rab153.673e-4142.07RAB15, member RAS oncogene family [Source:MGI Symb... [more]
Rab445.182e-4139.67RAB44, member RAS oncogene family [Source:MGI Symb... [more]
Rab131.282e-3941.76RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab191.674e-3937.02RAB19, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q39433|RB1BV_BETVU7.675e-4445.51Ras-related protein RAB1BV OS=Beta vulgaris OX=161... [more]
sp|O24466|RAE1A_ARATH1.745e-4345.51Ras-related protein RABE1a OS=Arabidopsis thaliana... [more]
sp|P28186|RAE1C_ARATH3.811e-4344.91Ras-related protein RABE1c OS=Arabidopsis thaliana... [more]
sp|P20790|RAB8A_DICDI1.385e-4142.86Ras-related protein Rab-8A OS=Dictyostelium discoi... [more]
sp|P20791|RAB8B_DICDI3.858e-4144.31Ras-related protein Rab-8B OS=Dictyostelium discoi... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8X7B62.024e-9132.65Ras family protein OS=Opisthorchis viverrini OX=61... [more]
G7YAP14.546e-8932.53Ras and EF-hand domain-containing protein OS=Clono... [more]
A0A3B5MEH46.641e-8733.08Calcium release activated channel regulator 2Ab OS... [more]
A0A4W5P0514.163e-8631.42Calcium release activated channel regulator 2A OS=... [more]
A0A3P9QAD92.044e-8532.22Calcium release activated channel regulator 2A OS=... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab151.948e-4142.07ras-related protein Rab-15 [Source:NCBI gene;Acc:1... [more]
cracr2ab2.199e-4143.09calcium release activated channel regulator 2Ab [S... [more]
rab133.199e-4042.51RAB13, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000049453.11.134e-3941.90pep primary_assembly:Astyanax_mexicanus-2.0:13:355... [more]
ENSAMXT00000046759.11.345e-3941.90pep primary_assembly:Astyanax_mexicanus-2.0:13:355... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a1.960e-4140.21RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa3.809e-3738.92RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab302.565e-3639.16RAB30, member RAS oncogene family [Source:ZFIN;Acc... [more]
rasef2.671e-3641.07RAS and EF-hand domain containing [Source:ZFIN;Acc... [more]
rab5c5.676e-3436.63RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC45.462e-3939.77Rab family GTPase; essential for vesicle-mediated ... [more]
YPT321.094e-3843.75Rab family GTPase involved in the exocytic pathway... [more]
YPT319.940e-3841.25Rab family GTPase; involved in the exocytic pathwa... [more]
YPT521.706e-3637.76Endosomal Rab family GTPase; required for vacuolar... [more]
YPT16.571e-3536.09Rab family GTPase; involved in the ER-to-Golgi ste... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO283999.659e-4747.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478229.659e-4747.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410185.907e-4242.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408573.176e-4140.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349458.593e-4042.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000027276.11.055e-8031.42calcium release activated channel regulator 2A [So... [more]
ENSORLT00000035474.11.055e-8031.42calcium release activated channel regulator 2A [So... [more]
ENSORLT00000046122.11.055e-8031.42calcium release activated channel regulator 2A [So... [more]
cracr2ab1.205e-4546.71ras and EF-hand domain-containing protein homolog ... [more]
ENSORLT00000037618.11.746e-4041.38ras-related protein Rab-15 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras and EF-hand domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043201.10.000e+099.66SMESG000043201.1[more]
SMESG000039352.12.361e-13999.58SMESG000039352.1[more]
SMESG000039353.11.454e-138100.00SMESG000039353.1[more]
SMESG000039352.19.709e-13399.56SMESG000039352.1[more]
SMESG000040702.11.866e-12896.60SMESG000040702.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010954 ID=SMED30010954|Name=Ras and EF-hand domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2331bp
TTTGTTTTTAAAGCAATTATTCTCAGTGAAAGATCGGTTTTCCATTTATC
ATTGTCTAAGTTTATTTAAACAAATATAGAAATTTGGAACACTTATTCAT
ATTAAAAAATGATTGACCTTGATGAAGTTGTCGCCCAGAGAGCCAAAGAA
CTCTATGACACTTGTGACAGAGATGGGAAAGGATATATAACAAAGAAAGA
AATGGATAATTTAAAAAATCTTTTGCCTTTATCCCAGGAACAACTGGAAT
CTGTTTTTGATTCATTAGACGACGACGGAAATGGCCAGTTAACTTTACAG
GAATTCACGGAAGGTTTCGGTCAATTTATAATTGGGGACGTTCAAACAAA
AAAACGACATTCAAGTGATTTCGAGGACCGAGATTTTAGTTTTGAAGAAA
AAAACACAAAATTTCAAGATAATTTATCATGTTCTGTAGTTGAAAAAGAG
ACGGCCAGTAATTTGTACGAGAAACTCAAAAATCAATATCCAAATTTGCT
GCCAGGCTTTGAAAATCTGCTTACCAAATTAACGAAAGAAATCGAAATGT
CACACAATAACGTTAAGAAAATGGAGAGCACAATTGCTCAACAAGCAACT
GAGCACGAAAAGAAAATTCGACGTGTTTATGATGAAATGGAAGCTCAAAT
AAAGTCTGAAGAAAAAAGACTAATTGCTGAAGAAAATCAAAGAAGAAAAC
AAATTAAAGAGCTACTGGAGCAAGATTTAAGTGAAAAAGACAAACACTTC
AAAGAACTGTTAGTAAAGCAAGAACAGACAAAACAACGTTTAAAAGAACT
AAGTCAATTAACCGGGCAAAACCAAAAGGAGATAGGGGCATTACTTGAAG
AAAAGGACATGCTAGAAGAAGCACTAGAAGAAACAGAATCGAATCTCGAA
GAATGTCAAAGTATTTTGGAAGAATTGCAGAATAAGTCAAAAGAAGATCG
TCGACAAAGAGCCGCAACTGCAACAACTGTAAGCATAGGAATATCATCCG
AGCGGGATATTTTGTTGAACCAGTTACACCAATTACAAGAAATCAATAAA
AAGCTCAAAGATGAAAGAGACGAAGGACTGATGCAGACGCCTGAAACTAG
TCGAAGTCCTTCGCCTCAGCCAGAAATGTTAAATTTTACAGATCGACTTC
CCATCAACAACGATCCAGATAATGAGTCGGATGAAGCAGATGGTCAAACC
ATTAATTCTGATATTAGAAAATTAAAATTTGCTGAAGCATCTAAATTATT
TGGGGAAACAATGAGTGTGTACGAAACCTCAAAATATGGTGACACCTTTG
ACGACGAAGACGATGGAATAGAAATTGACGAAGAGCCAGCATTGCTTTCG
GATGAGCCTTTAGAAAATCGTGCATTTTATCGGGCTAGTTTAGGATCAGT
TCAGGCAAATATTATAGTTGCCAGTCCTGTTAAGTATAGAGAAATCGATG
TTCAAACTGAGCAAGAAGAGAAAAAAGAAACGGCTGTTGAAAAACCAATT
GATATTCAGTATAAATTAATTTTTTCTGGAGAAGAAATGCCAGAATCGGT
ATTTAAAGTCGTTTTGGTTGGAGATTCGAATGTCGGAAAAAGTGCAATTC
TTGACAGGTTTTGCAACGGAACGTTTCGAGAAAACTATAGAAATACGATA
GGAGTAGATTTTATGTTAAAATCTATTGAAGTAGAAAATATCATCATCGC
TCTTCAACTGTGGGATACAGCGGGACAAGAAAGATATGAGTCTATAACAA
AGCAGTTTTATCGAAAAACTGATGGAGTAATTTTGGTCTATGACATCATG
GAGACGGGGTCGTTTATAAACATTCGAAATTGGATTGATAACGTGGAAAA
GAATACTGGCGATGAAGTGATGTTGATGATGCTGGGAAATAAGTTAGATT
TAGCTAAATCCCAGCCTAAAGCTATTCCAACAAAAAATGCTTGTGACTTG
AGTCGAGAATATGGAGCCTTAATGTTTGAAGTGAGTGCCCTAACGGGAGA
AAATATAAACGAATCCTTTGCAACGTTGGCAAAAGTTTTGAAATTAAGAC
AAGACGTAGACATCAACAACGCATTTCAATTGACAAAACCTTCAAATAAA
TCCTCTTGTTGTTGTAAAAAGTCAGAAAGAGTGTCGAACAGATCAAAATT
TATCAATTCAAAATCAGAATGAAAGCTTCTTTTGGACCTTGAATTATTTT
TCAACAATGTTGGTGTTTTTGAGACACTTGTACAATGTGATACAGATCAT
TTATATGTATTTTTTAGATTTATATCCCTTTCACGTTGATATTAGTTTCA
GAATTTGTTTTTATCTGAATATATTTTGGAG
back to top

protein sequence of SMED30010954-orf-1

>SMED30010954-orf-1 ID=SMED30010954-orf-1|Name=SMED30010954-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=688bp
MIDLDEVVAQRAKELYDTCDRDGKGYITKKEMDNLKNLLPLSQEQLESVF
DSLDDDGNGQLTLQEFTEGFGQFIIGDVQTKKRHSSDFEDRDFSFEEKNT
KFQDNLSCSVVEKETASNLYEKLKNQYPNLLPGFENLLTKLTKEIEMSHN
NVKKMESTIAQQATEHEKKIRRVYDEMEAQIKSEEKRLIAEENQRRKQIK
ELLEQDLSEKDKHFKELLVKQEQTKQRLKELSQLTGQNQKEIGALLEEKD
MLEEALEETESNLEECQSILEELQNKSKEDRRQRAATATTVSIGISSERD
ILLNQLHQLQEINKKLKDERDEGLMQTPETSRSPSPQPEMLNFTDRLPIN
NDPDNESDEADGQTINSDIRKLKFAEASKLFGETMSVYETSKYGDTFDDE
DDGIEIDEEPALLSDEPLENRAFYRASLGSVQANIIVASPVKYREIDVQT
EQEEKKETAVEKPIDIQYKLIFSGEEMPESVFKVVLVGDSNVGKSAILDR
FCNGTFRENYRNTIGVDFMLKSIEVENIIIALQLWDTAGQERYESITKQF
YRKTDGVILVYDIMETGSFINIRNWIDNVEKNTGDEVMLMMLGNKLDLAK
SQPKAIPTKNACDLSREYGALMFEVSALTGENINESFATLAKVLKLRQDV
DINNAFQLTKPSNKSSCCCKKSERVSNRSKFINSKSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005509calcium ion binding
GO:0005525GTP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000419prepharyngeal region
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR002048EF_hand_dom
IPR027417P-loop_NTPase
IPR011992EF-hand-dom_pair
IPR001806Small_GTPase
IPR018247EF_Hand_1_Ca_BS
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 153..180
NoneNo IPR availableCOILSCoilCoilcoord: 21..63
NoneNo IPR availableCOILSCoilCoilcoord: 96..137
NoneNo IPR availableCOILSCoilCoilcoord: 68..88
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 476..498
score: 32.0
coord: 336..357
score: 47.7
coord: 359..375
score: 33.88
coord: 377..399
score: 46.34
coord: 439..452
score: 40.44
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 338..499
e-value: 2.4E-12
score: 38.2
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 333..501
e-value: 3.7E-19
score: 79.7
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 336..501
e-value: 4.4E-67
score: 238.8
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 314..502
e-value: 0.0035
score: 1.1
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 341..541
e-value: 6.0E-4
score: 7.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 326..538
e-value: 7.3E-57
score: 193.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 171..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availablePANTHERPTHR22621UNCHARACTERIZEDcoord: 3..522
NoneNo IPR availablePANTHERPTHR22621:SF27EF-HAND CALCIUM-BINDING DOMAIN-CONTAINING PROTEIN 4Bcoord: 3..522
NoneNo IPR availablePROSITEPS51419RABcoord: 328..541
score: 30.569
NoneNo IPR availableCDDcd00154Rabcoord: 336..496
e-value: 4.48469E-66
score: 209.62
IPR001806Small GTPasePFAMPF00071Rascoord: 337..498
e-value: 6.1E-51
score: 172.2
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 336..493
e-value: 2.4E-26
score: 90.4
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 334..502