dnaJ homolog subfamily B member 13

Overview
NamednaJ homolog subfamily B member 13
Smed IDSMED30010941
Length (bp)1168
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dnaJ homolog subfamily B member 13 (SMED30010941) t-SNE clustered cells

Violin plots show distribution of expression levels for dnaJ homolog subfamily B member 13 (SMED30010941) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dnaJ homolog subfamily B member 13 (SMED30010941) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dnaJ homolog subfamily B member 13 (SMED30010941) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010941

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30010941SMESG000076708.1 SmedASXL_005476SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010941SMESG000076708.1 dd_Smed_v6_4820_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010941SMESG000076708.1 OX_Smed_1.0.17349ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010941SMESG000076708.1 dd_Smed_v4_4820_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Match: DNAJB13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:HGNC Symbol;Acc:HGNC:30718])

HSP 1 Score: 388.652 bits (997), Expect = 1.752e-134
Identity = 182/315 (57.78%), Postives = 239/315 (75.87%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MGQDYYS+L I RN++D  IK+AYR  ALK HPLK+ ++PS+ E F  I+EAY+VLSDP KR +YD+FGEEGLK GIP        WT GY +HG P+K F  FFG +NPF EF+D    ++ L+FGGL GR    QDP +ERDL L+LE+++ GC KK+KISRRV+NEDG++S+I+DKIL+++V+ GW++GT+ITF KEGDQGPNIIPAD++FI+K++ H RFRR+  NL + + I L  AL  CT+++ TLDDRLL+IPI DII+P Y K VPGEGMP P  P  KGDL I F I+FP +LTP++K+ ++  L
Sbjct:    1 MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKS-NEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Match: DNAJB4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:HGNC Symbol;Acc:HGNC:14886])

HSP 1 Score: 313.153 bits (801), Expect = 1.921e-104
Identity = 162/337 (48.07%), Postives = 221/337 (65.58%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I++ A D DIKKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP +  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VFI+KD+ H +F+RD +N+IY++ ISL +AL GC+I++ TLD R + + + DI+ PG  + + G G+P P  PD +GDL I+F++ FP  ++   KE ++  L
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 301.982 bits (772), Expect = 5.038e-100
Identity = 163/349 (46.70%), Postives = 219/349 (62.75%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLS---------------FGG-------------------LYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I   A + +IKKAYR  ALK HP KN  +P+A EKF  I+EAY+VLSDP KR +YDQ+GEEGLK G       +G++   YT+HG+P  TF +FFG  NPF  F+         S               FG                    LY R + +QDP +  +L ++LEEIYHG  K++KI+RR +N DG T    DKIL + ++ GWKEGTKITFPKEGD  P+ IPAD+VF+LKD+ H+ FRRD  N++YS+ ISL +AL GCT++I T+D R++ +P  D+I PG VK + GEG+P P  P  +GDL ++FK+ FP +LTP+ ++ +K  L
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKN-KEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRK-VQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 345          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 301.982 bits (772), Expect = 5.038e-100
Identity = 163/349 (46.70%), Postives = 219/349 (62.75%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLS---------------FGG-------------------LYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I   A + +IKKAYR  ALK HP KN  +P+A EKF  I+EAY+VLSDP KR +YDQ+GEEGLK G       +G++   YT+HG+P  TF +FFG  NPF  F+         S               FG                    LY R + +QDP +  +L ++LEEIYHG  K++KI+RR +N DG T    DKIL + ++ GWKEGTKITFPKEGD  P+ IPAD+VF+LKD+ H+ FRRD  N++YS+ ISL +AL GCT++I T+D R++ +P  D+I PG VK + GEG+P P  P  +GDL ++FK+ FP +LTP+ ++ +K  L
Sbjct:    1 MGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKN-KEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRK-VQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 345          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Match: DNAJB5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:HGNC Symbol;Acc:HGNC:14887])

HSP 1 Score: 303.138 bits (775), Expect = 2.206e-99
Identity = 163/352 (46.31%), Postives = 220/352 (62.50%), Query Frame = 1
Query:   67 IVKMGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLS---------------FGG-------------------LYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            +  MG+DYY IL I   A + +IKKAYR  ALK HP KN  +P+A EKF  I+EAY+VLSDP KR +YDQ+GEEGLK G       +G++   YT+HG+P  TF +FFG  NPF  F+         S               FG                    LY R + +QDP +  +L ++LEEIYHG  K++KI+RR +N DG T    DKIL + ++ GWKEGTKITFPKEGD  P+ IPAD+VF+LKD+ H+ FRRD  N++YS+ ISL +AL GCT++I T+D R++ +P  D+I PG VK + GEG+P P  P  +GDL ++FK+ FP +LTP+ ++ +K  L
Sbjct:   70 VAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKN-KEPNAEEKFKEIAEAYDVLSDPKKRGLYDQYGEEGLKTGGGTSGGSSGSFH--YTFHGDPHATFASFFGGSNPFDIFFASSRSTRPFSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRRAPEPLYPRRK-VQDPPVVHELRVSLEEIYHGSTKRMKITRRRLNPDGRTVRTEDKILHIVIKRGWKEGTKITFPKEGDATPDNIPADIVFVLKDKPHAHFRRDGTNVLYSALISLKEALCGCTVNIPTIDGRVIPLPCNDVIKPGTVKRLRGEGLPFPKVPTQRGDLIVEFKVRFPDRLTPQTRQILKQHL 417          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 248.825 bits (634), Expect = 7.882e-80
Identity = 140/336 (41.67%), Postives = 193/336 (57.44%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYG-------------------------RSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHI 1008
            MG+DYY +L I + A D +IKKAYR  ALK HP KN  +  A  KF  I+EAY+VLSD  K+ +YDQFGEEGLK G P      G     Y + G+P   F +FFG  +PF        G      GG  G                         R    QDP++  DL+++LE++  G  KK+KI+R+VM ++     + DK+L+V ++ GWK GTKITFPKEGDQ PN  PAD+VF++KD+ H +F+R+ +++     ISL  AL G  I I TLD     + + D+I PG  + + G+G+P+P  P  +GDL I+F +EFP +L P Q+E I
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKN-KEAGAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMH-YEFRGDPMNIFSSFFGGSDPFG-----AGGPGMFDLGGGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHARQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQ--RLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVI 327          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Match: dnj-13 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:Q20774])

HSP 1 Score: 248.825 bits (634), Expect = 7.882e-80
Identity = 140/336 (41.67%), Postives = 193/336 (57.44%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYG-------------------------RSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHI 1008
            MG+DYY +L I + A D +IKKAYR  ALK HP KN  +  A  KF  I+EAY+VLSD  K+ +YDQFGEEGLK G P      G     Y + G+P   F +FFG  +PF        G      GG  G                         R    QDP++  DL+++LE++  G  KK+KI+R+VM ++     + DK+L+V ++ GWK GTKITFPKEGDQ PN  PAD+VF++KD+ H +F+R+ +++     ISL  AL G  I I TLD     + + D+I PG  + + G+G+P+P  P  +GDL I+F +EFP +L P Q+E I
Sbjct:    1 MGKDYYKVLGISKGATDDEIKKAYRKMALKYHPDKN-KEAGAENKFKEIAEAYDVLSDDKKKKIYDQFGEEGLKEGGPGAGGGGGGGMH-YEFRGDPMNIFSSFFGGSDPFG-----AGGPGMFDLGGGAGGPNMFFMNQGGMDDGMFGGMHQGGRRGHARQDPAVLHDLSVSLEDVLKGTTKKMKITRKVMTDNAQ--RLEDKVLTVTIKPGWKSGTKITFPKEGDQHPNRTPADIVFVIKDKPHPKFKREGSDIKRVEKISLKSALTGLDIMIPTLDGADYRLQLNDVIKPGTTRRLTGKGLPNPKSPSHRGDLIIEFDVEFPSQLNPTQREVI 327          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 120.939 bits (302), Expect = 1.977e-30
Identity = 113/374 (30.21%), Postives = 158/374 (42.25%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISR------------------------------RVM----------------NEDGHTSSIRDKILSVN--------------VQCGWKEGTKITFPKEGDQGPNI-IPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPIT--DIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            YY +L ++ +A D ++KKAYR  ALK HP KN   P   E+F  IS+AYEVLSD  KR +YDQ                 G    G  +H              NPF  F      DM    GG  GR +    P++  +L +TL+ +Y G  KKLKISR                              RV+                N +G T   +D+    N              +  G K+G K  F  +GD+   I  P D V +L +  H +F R   NLI   +I L++AL G    I TLD R +   +   ++I    VK++  EGMP       KGDL +QF ++FP K+ P+  + +  +L
Sbjct:    7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKN---PDGAEQFKQISQAYEVLSDEKKRQIYDQ----------GGEEALQGGGGGGEGFH--------------NPFDVF------DMFFGGGGRGGRGERRVKPTV-HNLRVTLDTLYKGVTKKLKISRTATCKGCKGLGGNEGSAKECSDCRGRGIKVRVIRMGPMVQQMQSHCDSCNGEGSTFLEKDRCKKCNGKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFPDKINPDAAKKLADLL 346          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Match: dnj-12 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O45502])

HSP 1 Score: 120.939 bits (302), Expect = 1.977e-30
Identity = 113/374 (30.21%), Postives = 158/374 (42.25%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISR------------------------------RVM----------------NEDGHTSSIRDKILSVN--------------VQCGWKEGTKITFPKEGDQGPNI-IPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPIT--DIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            YY +L ++ +A D ++KKAYR  ALK HP KN   P   E+F  IS+AYEVLSD  KR +YDQ                 G    G  +H              NPF  F      DM    GG  GR +    P++  +L +TL+ +Y G  KKLKISR                              RV+                N +G T   +D+    N              +  G K+G K  F  +GD+   I  P D V +L +  H +F R   NLI   +I L++AL G    I TLD R +   +   ++I    VK++  EGMP       KGDL +QF ++FP K+ P+  + +  +L
Sbjct:    7 YYDVLGVKPDASDNELKKAYRKMALKFHPDKN---PDGAEQFKQISQAYEVLSDEKKRQIYDQ----------GGEEALQGGGGGGEGFH--------------NPFDVF------DMFFGGGGRGGRGERRVKPTV-HNLRVTLDTLYKGVTKKLKISRTATCKGCKGLGGNEGSAKECSDCRGRGIKVRVIRMGPMVQQMQSHCDSCNGEGSTFLEKDRCKKCNGKKQVKEDEIIEVGITPGMKDGEKFVFEGKGDEVIGIEKPGDFVVVLDEVEHEKFVRKGDNLIIQHNIDLSEALCGFVRTISTLDGRTIFYRVLPGEVIAHADVKVIHNEGMPMRRASSDKGDLLVQFDVKFPDKINPDAAKKLADLL 346          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Match: dnj-19 (DNaJ domain (Prokaryotic heat shock protein) [Source:UniProtKB/TrEMBL;Acc:O16303])

HSP 1 Score: 89.3521 bits (220), Expect = 2.717e-19
Identity = 51/127 (40.16%), Postives = 77/127 (60.63%), Query Frame = 1
Query:  610 KILSVNVQCGWKEGTKITFPKEGDQG-PNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDR--LLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKK 981
            KIL V+V  G K   KITF  +GDQ  P+  P DVV +++ + H  F+RD  +L  +  +SL +AL G    I  LD    +L     D+I PG ++ V G+GMP+   P++KG+L ++F++EFPK+
Sbjct:  241 KILEVHVLPGMKHNDKITFKGDGDQSDPDGEPGDVVIVIQQKDHDIFKRDGDDLHMTKKLSLNEALCGYNFLIKHLDGHPLVLSSKQGDVIKPGVIRGVLGKGMPNKKYPELKGNLFVEFEVEFPKE 367          

HSP 2 Score: 53.1434 bits (126), Expect = 1.982e-7
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = 1
Query:   91 YSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEE 288
            Y+ L ++ +A   DIKK+Y   A + HP KN   P   +KF  IS AYEVLS P KR +YD  G E
Sbjct:   15 YTTLNVRPDASQADIKKSYFKLAKEYHPDKN---PDHGDKFKEISFAYEVLSSPEKRRLYDARGLE 77          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307057)

HSP 1 Score: 277.33 bits (708), Expect = 1.038e-90
Identity = 154/351 (43.87%), Postives = 214/351 (60.97%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTY--HGNPDKTFINFFGADNPFQEFYDRMDG-------------DMHLS-FGGLYGR-------------------SQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLD-DRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL + + A D +IKKAYR  AL+ HP KN +  +A +KF  ++EAYEVLSD SKR VYD++GE+GLK+G   G+   G  +  +TY  HG+P  TF  FFG  NPF  F+D  D              D   S FGG+  R                    +  QDP +E DL +TLEEIYHGC+KK+KISRR++  DG +S   +K L+++++ GWK GTK+TF KEGDQ P  IPAD+VFI++D+ H+ F+R+ ++L Y++ ++L  AL G    + T+  D+L    + +II P  VK + G G+P P     KGDL + F I+FP+KLT  QKE +K +L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSG---GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 346          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0335379)

HSP 1 Score: 275.789 bits (704), Expect = 4.654e-90
Identity = 154/355 (43.38%), Postives = 214/355 (60.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTY--HGNPDKTFINFFGADNPFQEFYDRMDG-------------DMHLS-FGGLYGR-----------------------SQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLD-DRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL + + A D +IKKAYR  AL+ HP KN +  +A +KF  ++EAYEVLSD SKR VYD++GE+GLK+G   G+   G  +  +TY  HG+P  TF  FFG  NPF  F+D  D              D   S FGG+  R                        +  QDP +E DL +TLEEIYHGC+KK+KISRR++  DG +S   +K L+++++ GWK GTK+TF KEGDQ P  IPAD+VFI++D+ H+ F+R+ ++L Y++ ++L  AL G    + T+  D+L    + +II P  VK + G G+P P     KGDL + F I+FP+KLT  QKE +K +L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSG---GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0307056)

HSP 1 Score: 275.789 bits (704), Expect = 4.654e-90
Identity = 154/355 (43.38%), Postives = 214/355 (60.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTY--HGNPDKTFINFFGADNPFQEFYDRMDG-------------DMHLS-FGGLYGR-----------------------SQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLD-DRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL + + A D +IKKAYR  AL+ HP KN +  +A +KF  ++EAYEVLSD SKR VYD++GE+GLK+G   G+   G  +  +TY  HG+P  TF  FFG  NPF  F+D  D              D   S FGG+  R                        +  QDP +E DL +TLEEIYHGC+KK+KISRR++  DG +S   +K L+++++ GWK GTK+TF KEGDQ P  IPAD+VFI++D+ H+ F+R+ ++L Y++ ++L  AL G    + T+  D+L    + +II P  VK + G G+P P     KGDL + F I+FP+KLT  QKE +K +L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSG---GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Match: CG5001 (gene:FBgn0031322 transcript:FBtr0077972)

HSP 1 Score: 275.789 bits (704), Expect = 4.654e-90
Identity = 154/355 (43.38%), Postives = 214/355 (60.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTY--HGNPDKTFINFFGADNPFQEFYDRMDG-------------DMHLS-FGGLYGR-----------------------SQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLD-DRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL + + A D +IKKAYR  AL+ HP KN +  +A +KF  ++EAYEVLSD SKR VYD++GE+GLK+G   G+   G  +  +TY  HG+P  TF  FFG  NPF  F+D  D              D   S FGG+  R                        +  QDP +E DL +TLEEIYHGC+KK+KISRR++  DG +S   +K L+++++ GWK GTK+TF KEGDQ P  IPAD+VFI++D+ H+ F+R+ ++L Y++ ++L  AL G    + T+  D+L    + +II P  VK + G G+P P     KGDL + F I+FP+KLT  QKE +K +L
Sbjct:    1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSG---GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQKEVLKDML 350          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Match: DnaJ-1 (gene:FBgn0263106 transcript:FBtr0077123)

HSP 1 Score: 254.988 bits (650), Expect = 4.035e-82
Identity = 140/335 (41.79%), Postives = 192/335 (57.31%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMD-------------------GDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHI-PITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+D+Y IL ++R A D +IKKAYR  ALK HP KN S P A E+F  I+EAYEVLSD  KR ++D +GE+GLK G P            Y +HG+P  TF  FFG+ +PF  F+   D                   GD   +F       +  QDP IE DL ++LEE+  GCIKK+KISR     +G      +K+L + V+ GWK GTKITFP+EGD  PN  PAD+VFI++D+ HS F+R+  +L Y++ ISL  AL G  + + TL    + + P  +II P   + + G G+P P +P  +GDL + F I+FP  L P  +  +  +L
Sbjct:    1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS-PQAEERFKEIAEAYEVLSDKKKRDIFDNYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSNGPYKE--EKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELL 332          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 380.563 bits (976), Expect = 2.395e-131
Identity = 181/315 (57.46%), Postives = 232/315 (73.65%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY+IL I RNA D DIKKAYR  ALK HP  N S   A E+F+L++EA++VLSDP K+A YD+FGEEGLK GIP       AW+ GY YHGN D+TF  FFG DNPF +F+     +++ +F  L GR + LQDP IERDL+L LE++Y+GC KK+KISRRVMNEDGHTSSIRDKIL+  V+ GW EGT+ITFPKEGDQGPN IPAD+VF+++ + H RF R   +L Y+  ISL  AL G ++++ TLD RLL+IPI DI++P Y K+V GEGMP  + P  +GDL I+F   FP+KL+ E+K+ ++  L
Sbjct:    1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSN-SHARAAERFNLLAEAFDVLSDPRKKATYDKFGEEGLKGGIPSELGVNSAWSSGYVYHGNADETFRQFFGGDNPFADFFTGDGNEVNTAFESLRGRKEKLQDPPIERDLHLALEDLYYGCTKKIKISRRVMNEDGHTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQNDDLFYTEHISLEKALTGFSVEVETLDGRLLNIPINDIVHPQYTKVVSGEGMPLSNSPSKRGDLIIRFITHFPEKLSAEKKKLLRGAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 380.563 bits (976), Expect = 2.395e-131
Identity = 181/315 (57.46%), Postives = 232/315 (73.65%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY+IL I RNA D DIKKAYR  ALK HP  N S   A E+F+L++EA++VLSDP K+A YD+FGEEGLK GIP       AW+ GY YHGN D+TF  FFG DNPF +F+     +++ +F  L GR + LQDP IERDL+L LE++Y+GC KK+KISRRVMNEDGHTSSIRDKIL+  V+ GW EGT+ITFPKEGDQGPN IPAD+VF+++ + H RF R   +L Y+  ISL  AL G ++++ TLD RLL+IPI DI++P Y K+V GEGMP  + P  +GDL I+F   FP+KL+ E+K+ ++  L
Sbjct:    1 MGRDYYAILEINRNAIDADIKKAYRRLALKHHPRSN-SHARAAERFNLLAEAFDVLSDPRKKATYDKFGEEGLKGGIPSELGVNSAWSSGYVYHGNADETFRQFFGGDNPFADFFTGDGNEVNTAFESLRGRKEKLQDPPIERDLHLALEDLYYGCTKKIKISRRVMNEDGHTSSIRDKILTFTVKAGWNEGTRITFPKEGDQGPNNIPADIVFVIRQKNHPRFVRQNDDLFYTEHISLEKALTGFSVEVETLDGRLLNIPINDIVHPQYTKVVSGEGMPLSNSPSKRGDLIIRFITHFPEKLSAEKKKLLRGAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 303.523 bits (776), Expect = 1.557e-100
Identity = 163/359 (45.40%), Postives = 219/359 (61.00%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-------------DRMDGDM---------------HLSFGG----------------LYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I   + + +IKKAYR  ALK HP KN  DP+A EKF  I+EAYEVLSDP KR +YDQ+GE+GLK G    S   G     YT+HG+P  TF +FFG  NPF  F+             D  D DM               H  F G                L+G  + LQDP +  +L ++LEEI+HGC K+++I+RR +N D  T    DKIL++ ++ GWKEGTKITFPKEGD+ P  IPAD+ F+LKD+ H  FRRD +N+IY++ I L +AL GCT++I T+D+R + +P  DII PG +K + GEG+P P  P  +GDL ++F++ FP ++ P+ +E IK  L
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKN-KDPNAEEKFKEIAEAYEVLSDPKKRVIYDQYGEDGLKTGGTGSSSGQGTTYH-YTFHGDPHATFASFFGGSNPFDIFFGSSRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHL 357          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:ZFIN;Acc:ZDB-GENE-070705-308])

HSP 1 Score: 303.523 bits (776), Expect = 1.557e-100
Identity = 163/359 (45.40%), Postives = 219/359 (61.00%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-------------DRMDGDM---------------HLSFGG----------------LYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I   + + +IKKAYR  ALK HP KN  DP+A EKF  I+EAYEVLSDP KR +YDQ+GE+GLK G    S   G     YT+HG+P  TF +FFG  NPF  F+             D  D DM               H  F G                L+G  + LQDP +  +L ++LEEI+HGC K+++I+RR +N D  T    DKIL++ ++ GWKEGTKITFPKEGD+ P  IPAD+ F+LKD+ H  FRRD +N+IY++ I L +AL GCT++I T+D+R + +P  DII PG +K + GEG+P P  P  +GDL ++F++ FP ++ P+ +E IK  L
Sbjct:    1 MGKDYYKILGIPSGSNEDEIKKAYRKMALKFHPDKN-KDPNAEEKFKEIAEAYEVLSDPKKRVIYDQYGEDGLKTGGTGSSSGQGTTYH-YTFHGDPHATFASFFGGSNPFDIFFGSSRQRGNTNGFPDHGDHDMDIDMDGEDDPFSSFSHFGFNGVNGFHHGGGRRHRNEPLHGGRKKLQDPPVVHELKVSLEEIFHGCTKRMRITRRRLNPDRKTMRTEDKILNIVIKRGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHPLFRRDGSNIIYTTKIGLKEALCGCTVNIPTIDNRAITLPCNDIIKPGTIKRLRGEGLPFPKNPSQRGDLIVEFQVRFPDRIPPQSREIIKQHL 357          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Match: dnajb1b (DnaJ heat shock protein family (Hsp40) member B1b [Source:ZFIN;Acc:ZDB-GENE-030131-5455])

HSP 1 Score: 294.664 bits (753), Expect = 2.410e-97
Identity = 160/340 (47.06%), Postives = 222/340 (65.29%), Query Frame = 1
Query:   67 IVKMGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR---MDGDMH-------LSFGGLYG------------RSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            +VKMG+DYYS+L IQ+ A D +IKKAYR  ALK HP KN S   A EKF  I+EAY+VLSDP K+ +YD+FGEEGLK G P G    G +T  YT+ G+P   F  FFG  NPF+  +     MD +M           GG+ G            R +  QDP++  DL ++L+E++ GC KK+KISR+ +N DG T+   DKIL+V V+ GWKEGTKITFP+EGD+ P+ IPADVVF+LKD+ H  ++RD +++IY + I+L +AL GC I++ TLD R + +   DI+ PG  + + GEG+P P  PD +GDL +++++ FP+KL+   K+ I  +L
Sbjct:    1 MVKMGKDYYSVLGIQKGASDDEIKKAYRKQALKYHPDKNKS-AGAEEKFKEIAEAYDVLSDPKKKDIYDRFGEEGLKGGAPGGGGGGGNYT--YTFQGDPHAMFSEFFGGRNPFEHIFGHNGGMDENMETDDPFASFGMGGIGGFPRSFTTHSHGGRMERKQDPAVIHDLRVSLDEVFTGCTKKMKISRKRLNPDGRTTRSEDKILTVEVKKGWKEGTKITFPREGDETPSNIPADVVFVLKDKPHPVYKRDGSDIIYPAKITLKEALCGCVINVPTLDGRTVKVTSQDIVRPGMKRRLTGEGLPLPKAPDRRGDLVVEYEVRFPEKLSQNAKDTIANVL 337          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:780382])

HSP 1 Score: 395.586 bits (1015), Expect = 1.195e-136
Identity = 187/315 (59.37%), Postives = 239/315 (75.87%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MGQDYYS+L I  +A D DIKKAYR  ALK HPLKN  +PSA  +F  I+EAY+VLSD  K+A YD+FGEEGLK G+P       AWT GY +HGNPD+TF  FFG DNPF +F+     +++  FGGL GR    QDP IERDL L+LE+++ GC KK+KISRRVMN+DGHTSSIRDKILS++ + GW+EGTKITF  EGDQGPNIIPAD++FI++++ H RF+R   +LIY+++I L  AL GCT+++ TLD+RLL+IPI DI++P Y K+VPGEGM  P  P +KGDL IQF I FP+ LTP++K+ ++  L
Sbjct:   36 MGQDYYSVLEITPSAGDSDIKKAYRKLALKYHPLKN-KEPSAPHRFKQIAEAYDVLSDLRKKATYDKFGEEGLKGGVPPEFGGEEAWTSGYVFHGNPDRTFNEFFGGDNPFADFFTPTGSEVNTGFGGLRGRGMKTQDPPIERDLYLSLEDLFFGCTKKIKISRRVMNDDGHTSSIRDKILSIDARPGWREGTKITFQNEGDQGPNIIPADIIFIVREKQHPRFKRQGNDLIYTANIELGKALTGCTVEVETLDERLLNIPINDIVHPTYRKVVPGEGMRLPKDPTLKGDLIIQFDIHFPEHLTPQKKQLLRKAL 349          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:100125006])

HSP 1 Score: 295.434 bits (755), Expect = 1.506e-97
Identity = 156/339 (46.02%), Postives = 212/339 (62.54%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFGGLY------------GRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYYS+L I++ A + DIKKAYR  ALK HP KN S   A EKF  I+EAYEVLSDP KR VYDQFGEEGLK G   G+ +       YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   SF                 + +  QDP I  DL ++LEEIY GC K+++ISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ P  IPAD+VF++KD+ H+ F+RD +N++    +SL +AL GC+I++ TLD R + + I DII PG  + + G G+P P  P+  GDL ++F++ FP  +    KE ++  L
Sbjct:    1 MGKDYYSVLGIEKGASEDDIKKAYRKQALKWHPDKNKS-AHAEEKFKEIAEAYEVLSDPKKREVYDQFGEEGLKGG--SGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGDPFSSFTSFNMNGFPREKNQVGNQFRRKQDPPIIHDLRVSLEEIYTGCTKRMRISRKRLNPDGRSVRTEDKILTIEIKKGWKEGTKITFPREGDEAPMTIPADIVFVVKDKPHTHFKRDGSNIVCPVRVSLREALCGCSINVPTLDGRSIPMTINDIIKPGMRRRIIGYGLPFPKNPEQNGDLLVEFEVIFPDSIPQSSKEILRRHL 336          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Match: chd9 (chromodomain helicase DNA binding protein 9 [Source:Xenbase;Acc:XB-GENE-1217623])

HSP 1 Score: 297.36 bits (760), Expect = 2.200e-97
Identity = 156/352 (44.32%), Postives = 218/352 (61.93%), Query Frame = 1
Query:   64 NIVKMGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSF--------------------------GGLYGRSQ-------MLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            + + MG+DYY IL +   A + +IKKAYR  ALK HP KN  D +A +KF  I+EAY+VLSDP KRAVYDQ+GEEGLK G         ++   YT+HG+P  TF +FFG  NPF  F+      M   F                           G + R Q        +QDP +  +L ++LEEIYHGC K++KI+RR +N DG T    DKIL+V ++ GWKEGTKITFPKEGD     IPAD+VF+LKD+ H+ F+RD +N++Y++ I+L +AL GCT++I T+D R++ +P +D+I PG VK + GEG+P P  P+ +GDL ++F++ FP ++    +E +K  L
Sbjct:   56 HTLDMGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKN-KDANAEDKFKEIAEAYDVLSDPKKRAVYDQYGEEGLKTGGGSTGNTGSSFH--YTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHEDMDINEDEDDLFGGFGRFGFSGVNGFHKRHQDQLHSRRKVQDPPVVHELKVSLEEIYHGCTKRMKITRRRLNPDGRTVRTEDKILNVVIKKGWKEGTKITFPKEGDATSENIPADIVFLLKDKPHALFKRDGSNIVYTAKITLKEALCGCTVNIPTIDGRVIPLPCSDVIKPGAVKRLRGEGLPFPKVPNQRGDLIVEFQVRFPDRIPQPTRELLKQHL 404          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Match: dnajb1 (DnaJ heat shock protein family (Hsp40) member B1 [Source:NCBI gene;Acc:493474])

HSP 1 Score: 275.789 bits (704), Expect = 8.524e-90
Identity = 153/349 (43.84%), Postives = 213/349 (61.03%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTK-GYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHL---------------------------------SFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A + +IKKAYR  ALK HP KN  DP A ++F  I+EAY+VLSDP KR V+D++GEEGLK     G    G      YT+HG+P   F  FFG  NPF  F+ R D DM                                   S  G        QDP I R+L ++LEE+++GC KK+KIS + +  DG +    DKIL++ V+ GWKEGTKITFPKEGD+ P+ IPAD+VF+LKD++H  F+R+ ++++Y+S ISL +AL GC+++I T+D+R + +  TDII PG  + +  EG+P P  PD +GDL ++F I FP++LT   +E ++ +L
Sbjct:    1 MGKDYYKILGIPKGATEEEIKKAYRKQALKYHPDKN-KDPGAEDRFKEIAEAYDVLSDPKKREVFDKYGEEGLKGTPGGGGSSGGPNGTYSYTFHGDPHAVFAEFFGGRNPFDGFFGRNDDDMDTDDPFAGFGGMGGFGGMGGMGGMGGMGGMGGFPRSASGRRDTVPRKQDPPITRELPVSLEEVFNGCTKKMKISHKRLGPDGRSVRNEDKILTIQVKKGWKEGTKITFPKEGDETPSNIPADIVFVLKDKSHPVFKREGSDVVYTSKISLREALCGCSVNIPTVDNRTIPLTFTDIIRPGTKRRITNEGLPLPKSPDQRGDLIVEFDIRFPERLTASSREVLERVL 348          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Match: dnaja4.1 (DnaJ heat shock protein family (Hsp40) member A4 [Source:NCBI gene;Acc:780309])

HSP 1 Score: 145.976 bits (367), Expect = 2.512e-39
Identity = 109/339 (32.15%), Postives = 159/339 (46.90%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADN-----------------PFQEFYDRMDGDMHLS----------FGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKI--------SRRVMNED------GHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPI--TDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFP 975
            YY  L ++ NA   +IKKAYR  ALK HP KN   P   EKF LIS+AYEVLSDP KR +YDQ GE+ +K     G +  G ++       +P   F  FFG                       + Y+     + L           +GG  G  +        R + + +++I  G +++++           R+  +D      G       KIL V++  G K+G KI F  EGDQ P + P DVV +L  + H  ++R + +LI   +I+L +AL G    I T+D R+L +     ++I  G+ K +  EGMP    P  KG L IQF++ FP
Sbjct:    7 YYDTLGVKPNATPDEIKKAYRKLALKYHPDKN---PKEGEKFKLISQAYEVLSDPKKRDLYDQGGEQAIK----EGGMGGGNFS-------SPMDIFDMFFGGGGRMNREKRGKNVVHQLAVSLNDLYNGTSRKLALQKNVICSKCEGYGGKKGAVEKC-TTCKGRGVQVRVQQIGPGMVQQIQSMCSDCHGEGERINQKDRCKQCSGKKVVREKKILEVHINKGMKDGQKIMFSGEGDQEPGLEPGDVVIVLDQKEHDVYQRQQNDLIMKMNITLVEALCGFKKPIETMDGRILQVTSFPGEVIKYGHFKCIRNEGMPLQRDPFEKGLLIIQFEVAFP 330          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Match: Dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:MGI Symbol;Acc:MGI:1916637])

HSP 1 Score: 392.504 bits (1007), Expect = 4.214e-136
Identity = 185/315 (58.73%), Postives = 238/315 (75.56%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYY++L + RN++D  IKKAYR  ALK HPLK+ S+P A E F  I+EAY+VLSDP KR +YD+FGEEGLK GIP        WT GY +HGNPDK F  FFG DNPF EF+D    D+ L+FGGL+GR    QDP IERDL L+LE+++ GC KK+KISRRV+NED ++S+I+DKIL+++V+ GW++GT+ITF KEGDQGPNIIPAD++FI+K++ H RFRR+  NL +   I L  AL  CT+++ TLDDRLL+IPI DI++P Y KIVPGEGMP P  P  KGDL I F I+FP +LTP++K+ ++  L
Sbjct:    1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKS-SEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Match: Dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:MGI Symbol;Acc:MGI:1916637])

HSP 1 Score: 308.145 bits (788), Expect = 7.847e-104
Identity = 147/267 (55.06%), Postives = 190/267 (71.16%), Query Frame = 1
Query:  220 ISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            I+EAY+VLSDP KR +YD+FGEEGLK GIP        WT GY +HGNPDK F  FFG DNPF EF+D    D+ L+FGGL+GR    QDP IERDL L+LE+++ GC KK+KISRRV+NED ++S+I+DKIL+++V+ GW++GT+ITF KEGDQ              ++ H RFRR+  NL +   I L  AL  CT+++ TLDDRLL+IPI DI++P Y KIVPGEGMP P  P  KGDL I F I+FP +LTP++K+ ++  L
Sbjct:    2 IAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQ--------------EKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 254          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Match: Dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:MGI Symbol;Acc:MGI:1914285])

HSP 1 Score: 310.842 bits (795), Expect = 1.146e-103
Identity = 161/337 (47.77%), Postives = 220/337 (65.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A D D+KKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP I  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H +F+RD +N++Y++ ISL +AL GC++++ T+D R L + +TDI+ PG  + V G G+P P  PD +GDL I+F + FP  ++   KE ++  L
Sbjct:    1 MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Match: Dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:MGI Symbol;Acc:MGI:1914285])

HSP 1 Score: 310.842 bits (795), Expect = 1.146e-103
Identity = 161/337 (47.77%), Postives = 220/337 (65.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A D D+KKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP I  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H +F+RD +N++Y++ ISL +AL GC++++ T+D R L + +TDI+ PG  + V G G+P P  PD +GDL I+F + FP  ++   KE ++  L
Sbjct:    1 MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Match: Dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:MGI Symbol;Acc:MGI:1914285])

HSP 1 Score: 310.842 bits (795), Expect = 1.146e-103
Identity = 161/337 (47.77%), Postives = 220/337 (65.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A D D+KKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP I  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H +F+RD +N++Y++ ISL +AL GC++++ T+D R L + +TDI+ PG  + V G G+P P  PD +GDL I+F + FP  ++   KE ++  L
Sbjct:    1 MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Match: sp|Q80Y75|DJB13_MOUSE (DnaJ homolog subfamily B member 13 OS=Mus musculus OX=10090 GN=Dnajb13 PE=1 SV=1)

HSP 1 Score: 392.504 bits (1007), Expect = 2.948e-135
Identity = 185/315 (58.73%), Postives = 238/315 (75.56%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYY++L + RN++D  IKKAYR  ALK HPLK+ S+P A E F  I+EAY+VLSDP KR +YD+FGEEGLK GIP        WT GY +HGNPDK F  FFG DNPF EF+D    D+ L+FGGL+GR    QDP IERDL L+LE+++ GC KK+KISRRV+NED ++S+I+DKIL+++V+ GW++GT+ITF KEGDQGPNIIPAD++FI+K++ H RFRR+  NL +   I L  AL  CT+++ TLDDRLL+IPI DI++P Y KIVPGEGMP P  P  KGDL I F I+FP +LTP++K+ ++  L
Sbjct:    1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKS-SEPGAPEIFKQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGNDIDLNFGGLWGRGVQKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Match: sp|P59910|DJB13_HUMAN (DnaJ homolog subfamily B member 13 OS=Homo sapiens OX=9606 GN=DNAJB13 PE=1 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 8.413e-134
Identity = 182/315 (57.78%), Postives = 239/315 (75.87%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MGQDYYS+L I RN++D  IK+AYR  ALK HPLK+ ++PS+ E F  I+EAY+VLSDP KR +YD+FGEEGLK GIP        WT GY +HG P+K F  FFG +NPF EF+D    ++ L+FGGL GR    QDP +ERDL L+LE+++ GC KK+KISRRV+NEDG++S+I+DKIL+++V+ GW++GT+ITF KEGDQGPNIIPAD++FI+K++ H RFRR+  NL + + I L  AL  CT+++ TLDDRLL+IPI DII+P Y K VPGEGMP P  P  KGDL I F I+FP +LTP++K+ ++  L
Sbjct:    1 MGQDYYSVLGITRNSEDAQIKQAYRRLALKHHPLKS-NEPSSAEIFRQIAEAYDVLSDPMKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGKPEKVFHEFFGGNNPFSEFFDAEGSEVDLNFGGLQGRGVKKQDPQVERDLYLSLEDLFFGCTKKIKISRRVLNEDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQAL 314          
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Match: sp|Q5R8J8|DNJB4_PONAB (DnaJ homolog subfamily B member 4 OS=Pongo abelii OX=9601 GN=DNAJB4 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 1.847e-104
Identity = 163/337 (48.37%), Postives = 221/337 (65.58%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I++ A D DIKKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            MDGD   +FG             G S++ QDP +  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VFI+KD+ H +F+RD +N+IY++ ISL +AL GC+I++ TLD R + + + DI+ PG  + + G G+P P  PD +GDL I+F++ FP  ++   KE ++  L
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEMDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Match: sp|Q9UDY4|DNJB4_HUMAN (DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 9.224e-104
Identity = 162/337 (48.07%), Postives = 221/337 (65.58%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I++ A D DIKKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP +  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VFI+KD+ H +F+RD +N+IY++ ISL +AL GC+I++ TLD R + + + DI+ PG  + + G G+P P  PD +GDL I+F++ FP  ++   KE ++  L
Sbjct:    1 MGKDYYCILGIEKGASDEDIKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPVIHELRVSLEEIYSGCTKRMKISRKRLNADGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFIIKDKDHPKFKRDGSNIIYTAKISLREALCGCSINVPTLDGRNIPMSVNDIVKPGMRRRIIGYGLPFPKNPDQRGDLLIEFEVSFPDTISSSSKEVLRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Match: sp|Q9D832|DNJB4_MOUSE (DnaJ homolog subfamily B member 4 OS=Mus musculus OX=10090 GN=Dnajb4 PE=1 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 8.016e-103
Identity = 161/337 (47.77%), Postives = 220/337 (65.28%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSFG----------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A D D+KKAYR  ALK HP KN S P A EKF  ++EAYEVLSDP KR +YDQFGEEGLK G      + G +   YT+HG+P  TF  FFG  NPF+ F+ R            +DGD   +FG             G S++ QDP I  +L ++LEEIY GC K++KISR+ +N DG +    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H +F+RD +N++Y++ ISL +AL GC++++ T+D R L + +TDI+ PG  + V G G+P P  PD +GDL I+F + FP  ++   KE ++  L
Sbjct:    1 MGKDYYHILGIDKGATDEDVKKAYRKQALKFHPDKNKS-PQAEEKFKEVAEAYEVLSDPKKREIYDQFGEEGLKGGAGGTDGQGGTFR--YTFHGDPHATFAAFFGGSNPFEIFFGRRMGGGRDSEEMEIDGDPFSAFGFSMNGYPRDRNSVGPSRLKQDPPIIHELKVSLEEIYSGCTKRMKISRKRLNPDGRSYRSEDKILTIEIKKGWKEGTKITFPREGDETPNSIPADIVFVIKDKEHPKFKRDGSNIVYTAKISLREALCGCSLNVPTMDGRNLPMSVTDIVKPGMRRRVIGYGLPFPKNPDQRGDLLIEFDVSFPDVISAASKEILRKHL 334          
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Match: A0A159X4H0 (DNAJB13-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=DNAJB13 PE=2 SV=1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 285/289 (98.62%), Postives = 286/289 (98.96%), Query Frame = 1
Query:  157 ALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAILR 1023
            ALKL PLKNISDPSAFEKFSLISEAYEVL DPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLK SRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEH+KAILR
Sbjct:    1 ALKLXPLKNISDPSAFEKFSLISEAYEVLXDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKTSRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHVKAILR 289          
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Match: A0A3S1A3L7 (J domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_010330 PE=4 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 7.247e-156
Identity = 211/315 (66.98%), Postives = 255/315 (80.95%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYY+IL + R+A D DIKK YR  +LK HP KN  D +A +KF  ++EAY+VLSDP KRAVYDQFGEEGLKNG+P GS EAGAWT GYT+HGNP+K F +FFG DNPFQEF+DR+DGD+ + FGGL+GR    QDP IERDL L+LEE+YHGC KK+KISRRVMNEDGHTSSIRDKIL++ V+ GWK GTKITFP+EGDQGPN +PAD+VFI+KD+ H RFRR EANLI+++ + L  AL GCT++I TLD+R+LHIPI DI+ PGY K+VPGEGMP    P  KGDL I+F IEFP  LTPE+K+H++  L
Sbjct:    1 MGVDYYNILGLTRSATDADIKKFYRKLSLKYHPDKNQGDQNAADKFMQVAEAYDVLSDPRKRAVYDQFGEEGLKNGVPSGSGEAGAWTSGYTFHGNPEKVFRDFFGGDNPFQEFHDRIDGDLSMGFGGLHGRGAKKQDPPIERDLYLSLEEVYHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKKGWKPGTKITFPQEGDQGPNNVPADIVFIVKDKPHPRFRRCEANLIHTAKVPLGKALTGCTVEIHTLDERILHIPINDIVKPGYKKVVPGEGMPLVVAPCDKGDLIIEFDIEFPTSLTPEKKDHVRRAL 315          
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Match: C8CBM4 (Heat shock protein 40A OS=Ruditapes philippinarum OX=129788 PE=2 SV=1)

HSP 1 Score: 450.284 bits (1157), Expect = 1.443e-155
Identity = 207/315 (65.71%), Postives = 253/315 (80.32%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYY++L + R+A D DIKK YR  +LK HP K+  D +A +KF  ++EAY+VLSDP KRAVYDQFGEEGLKNG+P G +E GAWT+GYT+HGN DK F +FFG DNPFQEFYDR+DGDM +SFGGL GR +  QDP IERDL L+LEE++HGC KK+KISRRVMNEDGHTSSIRDKIL++ V+ GWK  T+ITFP+EGDQGPN +PAD+VFI+KD+ H RFRR+  NLI+++ + L  AL GCT+DI+TLD+R+LHIPI DII PGY K VP EGMP  + P  KGDL I+F IEFP  LTPE+K+ +KA L
Sbjct:    1 MGVDYYNLLNLTRSATDADIKKHYRKLSLKFHPEKSPGDQAAADKFKQVAEAYDVLSDPRKRAVYDQFGEEGLKNGVPSGQVETGAWTQGYTFHGNADKVFRDFFGGDNPFQEFYDRVDGDMSMSFGGLVGRGRKKQDPPIERDLYLSLEEVFHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKKGWKPNTRITFPEEGDQGPNNVPADIVFIVKDKQHQRFRREGVNLIHTAKVPLGKALTGCTVDILTLDERMLHIPINDIIKPGYRKCVPKEGMPLSADPTQKGDLIIEFDIEFPATLTPEKKDLVKAAL 315          
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Match: V3ZQN7 (J domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_221747 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 2.260e-155
Identity = 208/315 (66.03%), Postives = 253/315 (80.32%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYYSIL + R+A D DIKK YR  +LK HP KN  + +A +KF  +SEAY+VLSDP KRAVYDQFGEEGLKNG+P GS E GAWT+GYT+HGN +K F +FFG DNPFQEFYDR+DGD+ + FGGL+GR    QDPSIERDL L LEE++HGC KK+KISRRVMNEDGHTSSIRDKIL++ V+ GWK GT+ITFPKEGDQGPN +PAD+VF++KD+ H RFRR+  NLI+++ + L  AL GCT++I TLDDR+LHIPI DII PG+ K+VPGEGMP  + P  KGDL I+F IEFP  LTPE+K+ ++  L
Sbjct:    1 MGVDYYSILNLTRSAADADIKKHYRKLSLKFHPDKNEGNHNAIDKFRQVSEAYDVLSDPRKRAVYDQFGEEGLKNGVPVGSGETGAWTQGYTFHGNAEKVFRDFFGGDNPFQEFYDRVDGDLSMGFGGLHGRGHKKQDPSIERDLYLGLEEVFHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKTGWKPGTRITFPKEGDQGPNNVPADIVFVVKDKPHPRFRREGTNLIHTARVPLGKALTGCTVEINTLDDRVLHIPINDIIKPGFKKVVPGEGMPVSTDPSEKGDLVIEFDIEFPHSLTPEKKDMVRKAL 315          
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Match: A0A1S3K330 (dnaJ homolog subfamily B member 13 OS=Lingula unguis OX=7574 GN=LOC106178147 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 3.329e-154
Identity = 207/315 (65.71%), Postives = 250/315 (79.37%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MGQDYYS+L + R+A D DIKKAYR  AL+ HP KN  D  A EKF  I+EAY+VLSDP KRA YDQFGEEGLK G+P GS E+GAWT+GYT+HGNPDK F +FFG DNPFQEFYDR+DGDM + FGGL+GR    +DP IERDL L+LEE +HGC KK+KISRRVMNEDGHTSSIRDKIL++ V+ GW  GTKITF +EGDQGPN +PAD+VFI+KD+ H RFRR   +LIY++ I L  AL GCT+++ TLD+R+L+IPI DI++PGY K VP EGMP    P  KGDL I+F IEFP++LTPE+K+ I+  L
Sbjct:    1 MGQDYYSVLGLSRSAADADIKKAYRKLALRYHPEKNFGDQVAAEKFKHIAEAYDVLSDPRKRATYDQFGEEGLKGGVPQGSGESGAWTQGYTFHGNPDKVFRDFFGGDNPFQEFYDRVDGDMVMGFGGLHGRGAKKKDPPIERDLALSLEETFHGCTKKMKISRRVMNEDGHTSSIRDKILTITVKKGWLPGTKITFQEEGDQGPNNVPADIVFIVKDKPHPRFRRSGTDLIYTAKIPLGQALTGCTVEVTTLDERILNIPINDIVHPGYTKRVPTEGMPISKDPSQKGDLIIEFNIEFPRQLTPEKKDLIRKAL 315          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:ZFIN;Acc:ZDB-GENE-040910-4])

HSP 1 Score: 288.886 bits (738), Expect = 2.632e-96
Identity = 151/315 (47.94%), Postives = 192/315 (60.95%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY+ L I R+A D DIKKAYR  ALK HP  N  +P + E+F  ++EAY+VLSD  K+A YD FGEEGLK GIP      GAW+ GY YHGNPDKTF  FFG DNPF                                       E+Y    KK                I+DKIL+++V+ GW EGT+ITF KEGDQGPN IPAD++FI++ + H RF R  A+L Y++ ISL  AL G  +++ TLD RLL+IP+ DI++P Y K+VPGEGMP  S P  KGDL IQFK ++P+KLTPE+++ +K  L
Sbjct:    1 MGRDYYASLEINRSATDADIKKAYRRLALKFHPQSN-RNPGSEERFIELAEAYDVLSDLRKKATYDTFGEEGLKGGIPPEIAANGAWSSGYVYHGNPDKTFRQFFGGDNPFAV-------------------------------------EMYILSTKK--------------HFIKDKILTISVKPGWNEGTRITFQKEGDQGPNNIPADIIFIVRQKPHPRFTRQNADLTYTAHISLEMALTGFAVEVATLDGRLLNIPVNDIVHPEYSKVVPGEGMPLSSNPSTKGDLIIQFKTQYPEKLTPEKRQLLKQAL 263          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 290.812 bits (743), Expect = 7.157e-96
Identity = 158/342 (46.20%), Postives = 218/342 (63.74%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRM-----DGDMHLS----FG-----------------GLYGRSQML-QDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A + DIKKAYR  ALK HP KN + P+A EKF  I+EAYEVLSDP KR +YDQ GEEGLK G      +   +T  YT+HG+P  TF  FFG  NPF+ F+ R      D DM +     FG                 GL G+ +   QDP+I  +L ++LEE++HGC K++KISR+ +N DG T    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H+ FRR+ ++++Y   +SL  +L GC++ + T+D +  +I ITD+I PG  K + G+G+P P  PD +GDL ++F + FP  L    K+ +K  L
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKA-PNASEKFKEIAEAYEVLSDPKKREIYDQHGEEGLKGGGGPTDGQGSNFT--YTFHGDPHATFATFFGGANPFEMFFGRKVNGRDDDDMEVDGSDPFGSFTSFNINGFPRGERPVGLGGQPRSRKQDPAIHHELRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDEAPNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGCSVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLKRHL 339          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Match: dnajb1b (dnaJ homolog subfamily B member 1 [Source:NCBI gene;Acc:103047132])

HSP 1 Score: 285.034 bits (728), Expect = 1.128e-93
Identity = 154/344 (44.77%), Postives = 221/344 (64.24%), Query Frame = 1
Query:   67 IVKMGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-------DRMDGD-------------------MHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            +VKMG+DYYS+L I++ A D +IKKAYR  ALK HP KN S P A EKF  I+EAY+VLSD  K+ +YD+FGEEGLK G   G          YT+ G+P   F  FFG  NPF++F+       + M+ D                    ++  GG  G+ +  QDP +  +L ++LEE++ GC KK+KISRR +N DG ++   DKIL+V V+ GWKEGTK+TFPKEGD+ P  IPADVVF++KD+ H  F+RD +++IY + ++L +AL GC++   TLD R + + + DI+ PG  + V GEG+P P  PD +GDL ++F+++FP++L+ + K+ I  +L
Sbjct:    1 MVKMGKDYYSVLGIKKGASDDEIKKAYRKQALKYHPDKNKS-PGAEEKFKEIAEAYDVLSDSKKKDIYDRFGEEGLKGGAGGGGPNGPGGFT-YTFQGDPHAMFSEFFGGRNPFEQFFGHGYGPEEDMETDNPFMNFGMGGMGGMGGGRPFNMRPGGPGGKLEKRQDPPVTHELKVSLEEVFSGCTKKMKISRRRLNPDGRSTRSEDKILTVEVKKGWKEGTKVTFPKEGDETPTNIPADVVFVVKDKPHPVFKRDGSDIIYPAKVTLKEALCGCSVKAPTLDGRSVTVTVQDIVRPGMKRRVTGEGLPFPKTPDRRGDLIVEFEVKFPERLSQDAKDTIARVL 342          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:103027306])

HSP 1 Score: 279.641 bits (714), Expect = 2.611e-92
Identity = 146/315 (46.35%), Postives = 201/315 (63.81%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + A + DIKKAYR  ALK HP KN + P+A EKF  I+EAYEVLSDP KR +YDQ GEEGLK G      +   +T  YT+HG+P  TF  FFG  NPF+ F+ R                           L ++LEE++HGC K++KISR+ +N DG T    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H+ FRR+ ++++Y   +SL  +L GC++ + T+D +  +I ITD+I PG  K + G+G+P P  PD +GDL ++F + FP  L    K+ +K  L
Sbjct:    1 MGKDYYKILGISKGAAEEDIKKAYRKQALKWHPDKNKA-PNASEKFKEIAEAYEVLSDPKKREIYDQHGEEGLKGGGGPTDGQGSNFT--YTFHGDPHATFATFFGGANPFEMFFGR--------------------------KLRVSLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDEAPNTIPADIVFVIKDKPHAHFRREGSDIVYPVRVSLRQSLCGCSVTVSTIDGKTCNIKITDVIKPGMRKTIAGQGLPFPKNPDQRGDLIVEFDVNFPDTLPTNAKDVLKRHL 286          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Match: dnajb1a (dnaJ homolog subfamily B member 1-like [Source:NCBI gene;Acc:103024650])

HSP 1 Score: 274.248 bits (700), Expect = 2.152e-89
Identity = 154/346 (44.51%), Postives = 215/346 (62.14%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-----DRMD-GDMHLSF-------------------------GGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL IQ+ A + +IKKAYR  AL+ HP KN + P A +KF  I+EAY+VLSD  K+ +YD++GEEGLK    H      A    YT+HG+P   F  FFG  +PF +F+     D MD  D   +F                         GG +G  +  +DP +  +L ++LEE+Y GC KK+KISR+ +N DG +    DKIL+V+++ GWKEGTKITFP+EGD+ P  IPAD+VF++KD++H  FRRD +++IY++ ISL DAL GCTI+  TLD R + +   D+I PG  K + GEG+P    PD +GD+ ++F ++FP+KLT    E +  IL
Sbjct:    2 MGKDYYKILGIQKGASEEEIKKAYRKQALRFHPDKNKA-PGAEDKFKEIAEAYDVLSDSKKKEIYDRYGEEGLKG---HSGGGGSANGPSYTFHGDPHAMFAEFFGGRSPFDQFFAHGGDDDMDVEDPFAAFGMGGMGGMGGMGGMGGFPRSFKSRVGGGHGCREKKKDPPVIHELKVSLEEVYSGCTKKMKISRKRLNTDGCSMRNEDKILTVDIKRGWKEGTKITFPREGDETPTNIPADIVFVVKDKSHPVFRRDGSDIIYTARISLRDALCGCTINAPTLDGRSITVTSRDVIKPGMKKRIVGEGLPLSKCPDKRGDMVLEFLVKFPEKLTQNTCEALMQIL 343          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005773.1 (pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 gene:ENSPMAG00000005230.1 transcript:ENSPMAT00000005773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.682 bits (522), Expect = 2.209e-64
Identity = 99/268 (36.94%), Postives = 158/268 (58.96%), Query Frame = 1
Query:  325 AGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-----------------------DRMDGDMHLSFGGLYGRS-------------QMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
             G++T  Y++HG+P  TF  FFG  +PF+ F+                       + M+ D    F                    +  QDP +  +L ++LE+IY GC K+++ISRR +N DG ++   +KIL++ ++ GWKEGTKITFP+EGD+G   IPADVVF++KD+AH  FRRD ++++Y++S+SL +AL GC++ + TLD R L + +T+++ PG  + V GEG+P P  P  +GDL + F + FP ++ P  ++ ++  L
Sbjct:    8 GGSFT--YSFHGDPHATFRAFFGGADPFEMFFGSGRGGGGPGGLGGLGMNGGGGGEAMEIDSDDPFAAFGLGGGGGGGGGGPSHHRRRTQDPPVVHELQVSLEDIYRGCTKRMRISRRRLNPDGRSTRTEEKILTLEIKKGWKEGTKITFPREGDEGGRNIPADVVFVVKDKAHPLFRRDGSDIVYTASVSLREALCGCSVKVPTLDGRKLSLSMTEVVRPGLTRRVAGEGLPFPRAPSRRGDLVVDFSVRFPDRIPPASRDVLRQHL 273          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 110.923 bits (276), Expect = 1.799e-27
Identity = 103/359 (28.69%), Postives = 142/359 (39.55%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVM-----NEDGHTSSI------RDKILSVNVQ-----------------------------CGWKEGTKITFPK---------------------EGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPI--TDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFP 975
            YY  L +  NA   ++KKAYR  ALK HP KN   P+  EKF  IS+AYEVL DP KR +YD  GE+ LK             +       +P   F  FF                MH    G     Q          L++ LEE+Y+G  +KL + + V+        G   ++      R   + + +Q                             C +  G KI   K                     EGDQ P++ P  ++ +L  + H  F R E +L+    I L +AL G    I TLD+R + I     ++I  G VK +  EGMP    P  KG L IQF ++FP
Sbjct:    7 YYDTLGVNPNATHEELKKAYRKLALKYHPDKN---PNEGEKFKQISQAYEVLLDPKKRELYDMGGEQALKG----------GSSNSGNGFSSPMDIFDLFFNGGT-----------RMHRERRGKNAVHQ----------LSVGLEEMYNGSTRKLALQKNVLCAKCEGRGGRKGAVERCVPCRGTGMYLQIQQIGLGMVQQIQSVCPECHGHGERINPRHRCRYCNGRKIVREKKILEVHISKGMKDGQKITFYGEGDQDPDLEPGHIIIVLDQKEHPVFHRREDDLVMKMEIELVEALCGFQRSIKTLDNRTILITSHQGEVIKEGDVKCILNEGMPLYRDPFEKGRLIIQFSVKFP 331          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 90.5077 bits (223), Expect = 1.291e-20
Identity = 98/361 (27.15%), Postives = 145/361 (40.17%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNE--DGHTSSIRDKILSVN-----------VQCGWKEGTKITF---------------PKE--GDQGPNIIPADV-----------------------------------VFILKD-RAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPI--TDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKI 966
            YY +L ++ N+   ++KKAYR  ALK HP KN   P+  EKF  IS+AYEVLSD  KR +YD+ GE+ +K               G     +P   F  FFG     Q                     +  +  ++   ++++LE++Y+G  +KL + + V+ +  +G ++ +  K  + N           V+C    G    F               PK+  G      IPA V                                   V I+ D + H  FRR   +L+    ISL +AL G    I TLD+R + I     ++I    +K V  EGMP    P  KG L I FK+
Sbjct:    7 YYDLLGVKPNSTADELKKAYRKLALKYHPDKN---PNEGEKFKQISQAYEVLSDAKKRELYDRGGEQAIKE----------GGAGGSGGFSSPMDIFNMFFGGGGSMQ---------------------RETKGKNVVHQISVSLEDLYNGATRKLSMQKNVICDKCEGESNFLVTKPFNQNWCPRGVMTGYSVRCCVFGGGVFVFCAGHCFCLSQVKTVSPKQHVGWCCQQFIPASVKIYLLAINSAKGMTDNQKISFYGEGDQEPGLDPGDVIIVLDQKEHDVFRRKGQDLLMEMEISLTEALCGFRRPIKTLDNRTIVITSHPGEVIKYDAIKCVLNEGMPFHRNPFEKGRLIIHFKV 333          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 84.3445 bits (207), Expect = 1.320e-19
Identity = 50/115 (43.48%), Postives = 64/115 (55.65%), Query Frame = 1
Query:  637 GWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPI--TDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFP 975
            G K+G KI F  EGDQ P + P DV+ +L+ + H  F R   +LI    I L +AL G    I TLDDR++ I     ++I  G VK +  EGMP    P  KG L IQFK+ FP
Sbjct:    1 GMKDGQKIQFGGEGDQEPGLEPGDVIIVLEQKEHPVFHRQGQDLIREMEIELVEALCGFQRPISTLDDRVIVITSHPGEVIKHGEVKCILNEGMPILRNPFEKGRLIIQFKVVFP 115          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Match: dnaja3b (DnaJ heat shock protein family (Hsp40) member A3b [Source:ZFIN;Acc:ZDB-GENE-040115-3])

HSP 1 Score: 86.2705 bits (212), Expect = 6.522e-19
Identity = 93/342 (27.19%), Postives = 145/342 (42.40%), Query Frame = 1
Query:   82 QDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGA--WTKGYTYHGNPDKTFINFFG--ADNPFQEFYDRMDGD----MHLSFG----GLYGRSQMLQDPSIERD----------------LNLT-LEEIYHGCIKKLKISRRVMNED-----------GHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLT 987
            +DYY IL + ++    DIKK+Y   A K HP  N  DP A EKF+ ++EAYEVLSD +KR  YD +G  G   G   G+   G   W  G T   +P++ F   FG  + + F +F    D      M L+F     G+     +  + + +R                  N T +E I  G        RR   +            G   + + K + V V  G ++G  +  P        +   ++    + +  + FRR+ A++     IS+A AL+G T  +  L D    I I   + P +   + G+G+   +     GD +I  KI  PK+L+
Sbjct:   12 KDYYQILGVAKDVAQKDIKKSYYQLAKKYHPDTNKDDPKAKEKFAELAEAYEVLSDDAKRKQYDTYGSAGFDAGFGSGAGTGGQQYWRAGSTV--DPEELFRKIFGEFSRSNFGDFSSMFDQPQEFFMELTFTQAAKGVNKEIALFLNDTCQRCEGRGNEPGTKLQRCHYCNGTGMETINTGPFVMRSTCRRCSGKGTIMTNPCTLCHGSGETKQKKTVVVPVPAGVEDGQTVRMP--------VGKKEIFITFRVQKSATFRREGADVHSDLHISVAQALLGGTARVQGLYDSFT-ITIPSGVQPDHRIRMAGKGINRVNSYGY-GDHYIHVKIRIPKRLS 341          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 147.517 bits (371), Expect = 7.122e-41
Identity = 113/340 (33.24%), Postives = 160/340 (47.06%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNP-------------------FQEFYDRMDGDMHLS----------FGGLYGRSQMLQDPS------IERDLNLTLE------EIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPIT--DIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPK 978
            +Y IL +   A D +IKKAYR  ALK HP KN S+ +A EKF   S AYE+LSDP KR +YDQFGE+GL       S   GA        G  D  F  FFGA                       +E Y      + L+           GG  G  +     +      + R +   ++      ++ HG    +    R  + +G       KIL V+V+ G K+G +I F  E DQ P++IP DVVFI+ +R H  F+RD  +L+Y + I L  A+ G    +  +    L + I   ++I PG  K++ G+GMP P K    G+L I+F I+FP+
Sbjct:    7 FYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAA-EKFKEASAAYEILSDPEKRDIYDQFGEDGL-------SGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIP-KYGGYGNLIIKFTIKFPE 337          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 107.071 bits (266), Expect = 1.563e-26
Identity = 54/176 (30.68%), Postives = 101/176 (57.39%), Query Frame = 1
Query:  484 QDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVV-FILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHI 1008
            ++ +++ +L ++LE+++ G  K  KI R+      H +S + +I  + ++ GWK GTKIT+  +GD  P       + F++++++H  F+RD  +LIY+  +S  ++L+G +  I T+D R L +     + P      PG+GMP P  P  +G+L +++K+++P  L   QK  I
Sbjct:  178 EEETVQVNLPVSLEDLFVGKKKSFKIGRK----GPHGASEKTQI-DIQLKPGWKAGTKITYKNQGDYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAI 348          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Match: SCJ1 (One of several homologs of bacterial chaperone DnaJ; located in the ER lumen where it cooperates with Kar2p to mediate maturation of proteins [Source:SGD;Acc:S000004827])

HSP 1 Score: 79.7221 bits (195), Expect = 5.332e-17
Identity = 37/74 (50.00%), Postives = 50/74 (67.57%), Query Frame = 1
Query:   79 GQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKN 300
             QDYY+IL I ++A + +IK AYR  + K HP KN     A +KF  + EAY+VLSDP K+ +YDQFG + +KN
Sbjct:   21 AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIYDQFGADAVKN 94          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Match: DJP1 (Cytosolic J-domain-containing protein; required for peroxisomal protein import and involved in peroxisome assembly; facilitates import of Mim1p and Mim2p into the mitochondrial outer membrane; homologous to E. coli DnaJ [Source:SGD;Acc:S000001443])

HSP 1 Score: 74.7146 bits (182), Expect = 3.586e-15
Identity = 40/99 (40.40%), Postives = 57/99 (57.58%), Query Frame = 1
Query:   85 DYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFI 381
            +YY +L +   A   +IKKAYR  +++ HP KN +DP+A E+F  ISEAY+VL D   RA YD++G    K  IP G  E  A      + G+   ++I
Sbjct:    6 EYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYDKYGR---KEAIPQGGFEDAAEQFSVIFGGDAFASYI 101          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Match: HLJ1 (Co-chaperone for Hsp40p; anchored in the ER membrane; with its homolog Ydj1p promotes ER-associated protein degradation (ERAD) of integral membrane substrates; similar to E. coli DnaJ [Source:SGD;Acc:S000004771])

HSP 1 Score: 71.633 bits (174), Expect = 5.894e-15
Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 1
Query:   82 QDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEE 288
             ++Y IL + R A D +IKKAYR  A+KLHP KN S P A E F +I+ A+EVLS+  KR++YD+ G +
Sbjct:   20 HEFYEILKVDRKATDSEIKKAYRKLAIKLHPDKN-SHPKAGEAFKVINRAFEVLSNEEKRSIYDRIGRD 87          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Match: EDO38685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC61])

HSP 1 Score: 390.193 bits (1001), Expect = 7.370e-136
Identity = 188/315 (59.68%), Postives = 235/315 (74.60%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG DYY IL + R+A D DIKK YR  +LK HP KN  +PSA  KF   +EAY+VLSDP KRA+Y+QFGEEGLK+G+P    E  AWT+GYT+HG+ ++ F  FFG +NPF E +D  D D  + FGG++GR +  QDP IER+L LTLEE++ GC+KK+KISRRVMNEDGHTS+IRDKIL++NV+ GW+  TKITFPKEGDQGPN IPAD+VFI+KD+ H  F+RD  NLIY +++ L  AL GC +D+ TLD RL+ IP+ DI+ P Y K+VP EGMP    PD +GDL IQF IEFP  L+PEQK  +K  L
Sbjct:    1 MGLDYYDILGLTRSATDADIKKEYRKLSLKYHPDKN-QEPSAEVKFRQAAEAYDVLSDPKKRAIYNQFGEEGLKSGVP----EKDAWTQGYTFHGDANRVFREFFGGNNPFSELFDSYDPD--IGFGGIHGRGRRKQDPPIERELYLTLEEVFKGCVKKMKISRRVMNEDGHTSNIRDKILTINVKRGWRASTKITFPKEGDQGPNNIPADIVFIVKDKPHPIFKRDNDNLIYIATVPLGKALTGCVVDVPTLDGRLISIPVNDIVKPEYQKVVPEEGMPISKNPDKRGDLIIQFNIEFPNHLSPEQKRLLKEAL 308          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Match: EDO46721 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPE1])

HSP 1 Score: 286.574 bits (732), Expect = 1.315e-94
Identity = 151/349 (43.27%), Postives = 217/349 (62.18%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIP---HGSIEAGAWTKGYTY---HGNPDKTFINFFGADNPFQEFYDR-MDGDMHLSFG----------------------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRD-EANLIYSSSISLADALIG----CTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG++YY IL ++++A D ++KKAY+  A K HP KN  DP A EKF  I+EAYEVLSDP KR ++DQ+GEEGLK G+P    G  +     +G+TY   HG+P  TF   FG ++PF++F D    G+M   F                       G + + Q +QDP +E++L ++LE++  G  KKLKI +RV+N  GH +   +KIL+VNV+ GWK GT+ITFPKEGDQ P  IPAD+VF +KD+ H  F RD + N++Y+  ISL DAL G     T+ + TLD R++++P+ DI+ PG  K + GEG+P P  P  + D+ + F++ FP +L P   + ++ IL
Sbjct:    1 MGKNYYDILGVKKDASDQELKKAYKKQAFKYHPDKN-KDPGAEEKFKEIAEAYEVLSDPQKREIFDQYGEEGLKGGVPPPGAGDADGFQMPEGFTYFQFHGDPRATFSRVFGDEDPFKDFMDTAFRGNMPFGFSQSNVTSGPSYSRQRSSSYEDIPGFFSQCQRMQDPPVEKELFVSLEKLLTGTTKKLKIIKRVLNSIGHGTRSEEKILTVNVKKGWKAGTRITFPKEGDQKPGRIPADIVFTIKDKKHEHFTRDNDNNILYTVKISLRDALTGYSSNITVPVPTLDHRVVNVPLNDIVKPGSKKRIKGEGLPLPKIPGQRMDMLVTFEVVFPSRLAPANVDALRNIL 348          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Match: EDO49360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG53])

HSP 1 Score: 281.567 bits (719), Expect = 5.871e-93
Identity = 159/328 (48.48%), Postives = 209/328 (63.72%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLK------NGIPHGSIEA--GAWTKGYTY-HGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLY---GRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRD-EANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY++L + + A   DIKKAYR  ALK HP KN S P A EKF  ISEAYEVLSDP K+ +YDQ+GEEGLK      NG  HG   A  G     +TY  G+  +TF   FG ++PF +    + G    +  G +   GR Q +QDP +ERDL ++LEE+Y G  KK+KISR+V + +G +  + +KIL+VNV+ GWKEGTKITFPKEGD+ P +IPADVVF +KD+ H  F RD + NL+Y + ISL DAL G TI + TL  R + +   D+I PG  K + GEG+P P     KGDL I++ +  P  +TP QK+ +   L
Sbjct:    1 MGKDYYAVLNVDKAASADDIKKAYRKQALKYHPDKNKS-PGAEEKFKEISEAYEVLSDPKKKEIYDQYGEEGLKGTPPPQNGGGHGFSGANFGPGFTTFTYTSGDARETFSRVFGDEDPFADLIGGLGGFSFFNGMGSHQRKGRKQKVQDPPLERDLLVSLEELYKGTTKKMKISRKVPDPNG-SQRLEEKILTVNVKPGWKEGTKITFPKEGDRKPGVIPADVVFKIKDKPHKHFTRDGDNNLVYKAKISLRDALGGTTISVPTLSGRTVQVHNADVIQPGSSKRIVGEGLPMPKDNSRKGDLIIKYDVYLPNNITPAQKQVLMNTL 326          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Match: EDO38741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC40])

HSP 1 Score: 234.572 bits (597), Expect = 1.298e-74
Identity = 139/327 (42.51%), Postives = 204/327 (62.39%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQE---FYDRMDGDMHLSFGGL--------YGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIR-DKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRD-EANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAI 1017
            MG++YY+IL + RNA D DIKKAYR  AL  HP KN  +  A EKF  ISEAY+VL+DP +R ++D +GEEGLK G             G+++  +P K F   F  + PF+E   F     G     F G+        + +   +Q+P++E+ L ++LEE+Y G ++KL+I+ +V++ +     IR DKIL + V+ GWK GTKITFP+EGD  P II +D++FI+ D+ H  F+RD E NLIY S ++L DAL+GC I + T+D R+L I + ++I PG  K + GEG+P    P  + DL + F++EFP  LT EQ+E++ ++
Sbjct:    1 MGRNYYAILGVPRNASDDDIKKAYRRQALIFHPDKN-KNSGAEEKFKEISEAYKVLTDPRQRDIFDMYGEEGLK-GTSDSPFGGPCGGFGFSFSEDPMKIFAEVFRDEEPFKETGNFSSYSTGQKGFGFEGMDFGPGPDPFKKEGPIQEPAVEKILPVSLEELYIGSVRKLRINHQVLSMNNEY--IREDKILQIEVKPGWKAGTKITFPREGDMKPGIIASDIIFIIADKPHQFFKRDSENNLIYVSKLTLKDALVGCVIQVPTIDGRVLSIQVNEVIRPGMQKRIQGEGLPLSKNPIERADLIVTFEVEFPTNLTGEQREYLASL 323          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Match: EDO31903 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWL1])

HSP 1 Score: 198.364 bits (503), Expect = 2.267e-60
Identity = 122/352 (34.66%), Postives = 182/352 (51.70%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQ-----------------FGEE----GLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFG---------------ADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRD-EANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            M  +YY +L ++RNA   DI++AYR  ALK HP KN       E F  +SEAYEVL DP +R  +D+                 F  E    G +N     + E        ++        I  FG                D+ F EF D MD +          +   +QDP IERDL + LEE+  G  K++K+SR++  +DG +S   +K L VN++ GWK+GT+I FP+EGD+ P   P+D+VF +KD+ H  F RD + NLIY +++SL  AL G  I + +L   ++ +    II PG V+ + GEG+P P  P ++ D+ ++F + FP  L+ EQ++ +   L
Sbjct:    1 MESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTE---ENFKEVSEAYEVLCDPQQRERFDKKFAPDTFRYSYSKRATSFDYEVNCGGFRNSHFSCTTEEAKRMFSRSFCDEDFSDLIGGFGDFGLFSREKSRKSSRYDDFFNEFKDEMDFETPF-------KKFKVQDPPIERDLLIGLEELLRGSTKRMKLSRKIF-QDGLSSKTEEKTLIVNIKPGWKQGTRIVFPREGDRRPGKDPSDIVFKIKDKPHRHFTRDKDNNLIYKATVSLRTALGGMNIHVPSLCGEVIDLENKGIIQPGMVRTIKGEGLPIPGNPSVRADMIVEFDVHFPNFLSREQRQGLLDFL 341          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:101160432])

HSP 1 Score: 347.436 bits (890), Expect = 1.835e-118
Identity = 173/317 (54.57%), Postives = 222/317 (70.03%), Query Frame = 1
Query:   70 VKMGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            + +   YY  L I R A D +IKKAYR  A+K HP +N    SA EK+SL+ EAY+VLSDP K+A+YD+FGEEGLK GIP      GAW+  YTYHGNPDKTF  FFG DNPF +F+ +   D  L FG    + +  QDP IER+L LTLE+++ GC KK+KISRRV+N+DGHTS I+DKIL+V+V+ GW+EGT++ FPKEGDQGP+  PADVV I++ ++H  F R   +LIY   ISL +AL   ++DI TLD RLL IPI DI++P Y K+V GEGMP       +GDL I F+I+FP+KL+ + K  IK  L
Sbjct:    1 MSLNNAYYEALEINRTASDAEIKKAYRRLAVKFHPKRNAEAGSA-EKYSLLGEAYDVLSDPRKKAIYDKFGEEGLKAGIPPEFGSDGAWSSKYTYHGNPDKTFRQFFGGDNPFADFFTK---DAPLQFGVPQTKLEKTQDPPIERELYLTLEDLFLGCTKKIKISRRVLNDDGHTSCIKDKILTVDVKPGWREGTRVVFPKEGDQGPDRTPADVVLIVRHKSHPLFIRQHNDLIYKLKISLMNALTDFSVDIPTLDGRLLSIPINDIVHPAYNKVVTGEGMPLSQDSSQRGDLIITFEIQFPEKLSSDSKGLIKQAL 313          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:NCBI gene;Acc:101160432])

HSP 1 Score: 324.709 bits (831), Expect = 7.056e-110
Identity = 162/294 (55.10%), Postives = 209/294 (71.09%), Query Frame = 1
Query:  139 KAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            + YR  A+K HP +N    SA EK+SL+ EAY+VLSDP K+A+YD+FGEEGLK GIP      GAW+  YTYHGNPDKTF  FFG DNPF +F+ +   D  L FG    + +  QDP IER+L LTLE+++ GC KK+KISRRV+N+DGHTS I+DKIL+V+V+ GW+EGT++ FPKEGDQGP+  PADVV I++ ++H  F R   +LIY   ISL +AL   ++DI TLD RLL IPI DI++P Y K+V GEGMP       +GDL I F+I+FP+KL+ + K  IK  L
Sbjct:    5 RRYRRLAVKFHPKRNAEAGSA-EKYSLLGEAYDVLSDPRKKAIYDKFGEEGLKAGIPPEFGSDGAWSSKYTYHGNPDKTFRQFFGGDNPFADFFTK---DAPLQFGVPQTKLEKTQDPPIERELYLTLEDLFLGCTKKIKISRRVLNDDGHTSCIKDKILTVDVKPGWREGTRVVFPKEGDQGPDRTPADVVLIVRHKSHPLFIRQHNDLIYKLKISLMNALTDFSVDIPTLDGRLLSIPINDIVHPAYNKVVTGEGMPLSQDSSQRGDLIITFEIQFPEKLSSDSKGLIKQAL 294          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Match: dnajb4 (DnaJ heat shock protein family (Hsp40) member B4 [Source:NCBI gene;Acc:101170125])

HSP 1 Score: 313.153 bits (801), Expect = 9.750e-105
Identity = 160/341 (46.92%), Postives = 217/341 (63.64%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNG-IPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDR---------MDGDMHLSFG----------------GLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY  L I + A D DIKKAYR  ALK HP KN S  +A EKF  ++EAYEVLSDP KR +YDQ+GEEGLK G  P G  +   +T  YT+HG+P  TF  FFG  NPF+ F+ R         MD D +  FG                GL G+ +  QDP I  +L +TLEE++HGC K++KISR+ +N DG T    DKIL++ ++ GWKEGTKITFP+EGD+ PN IPAD+VF++KD+ H  FRR+ +N++Y   +SL  +L GC++ + T+D +  ++ ITD+I PG  K V G+G+P P  P+ +GDL ++F + FP  L    K+ +K  L
Sbjct:    2 MGKDYYKTLGISKGATDEDIKKAYRKQALKWHPDKNKS-ANADEKFKEVAEAYEVLSDPKKRDIYDQYGEEGLKGGSAPAGDGQGTNFT--YTFHGDPHATFATFFGGSNPFEMFFGRKANGRDDEDMDVDGNDPFGSFTSFNMNGFPRDGHVGLGGQQRRKQDPPIVHELRVTLEEVFHGCTKRMKISRKRLNPDGRTMRTEDKILTIEIKRGWKEGTKITFPREGDESPNTIPADIVFVIKDKPHPHFRREGSNIVYPVRVSLRQSLCGCSVTVSTIDGKTCNMKITDVIKPGLRKTVTGQGLPLPKNPEQRGDLVVEFDVNFPDALPGNAKDVLKRHL 339          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 310.842 bits (795), Expect = 9.338e-104
Identity = 163/346 (47.11%), Postives = 220/346 (63.58%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-----DRMD---------------GDMHLSFGGLY-----------GRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + + + +IKKAYR  AL+ HP KN +D +A EKF  I+EAYEVLSDP KR VYDQ GEEGLK G    S   G+ T  YT+HG+P  TF +FFG  NPF  F+       MD               G M+  F G             G ++  QDP +  +L ++LEEI+HGC K++KI+RR +N DG +    DKIL++ ++ GWKEGTKITFPKEGD+ P  IPAD+ F+LKD+ H+ FRRD +N+IY+  ISL +AL GCT+ I TL++R++ +P  DII PG VK + GEG+P P  P  +GDL ++F + FP ++ P+ +E I+  L
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKN-TDANAEEKFKEIAEAYEVLSDPKKRVVYDQLGEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNRNTEMDEDEPFTHFGRQFGFPGGMNNGFPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGCTVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQHL 345          
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Match: dnajb5 (DnaJ heat shock protein family (Hsp40) member B5 [Source:NCBI gene;Acc:101161491])

HSP 1 Score: 302.368 bits (773), Expect = 4.346e-100
Identity = 163/366 (44.54%), Postives = 220/366 (60.11%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFY-------------------------DRMD---------------GDMHLSFGGLY-----------GRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYY IL I + + + +IKKAYR  AL+ HP KN +D +A EKF  I+EAYEVLSDP KR VYDQ GEEGLK G    S   G+ T  YT+HG+P  TF +FFG  NPF  F+                           MD               G M+  F G             G ++  QDP +  +L ++LEEI+HGC K++KI+RR +N DG +    DKIL++ ++ GWKEGTKITFPKEGD+ P  IPAD+ F+LKD+ H+ FRRD +N+IY+  ISL +AL GCT+ I TL++R++ +P  DII PG VK + GEG+P P  P  +GDL ++F + FP ++ P+ +E I+  L
Sbjct:    1 MGKDYYKILGIPKGSNEEEIKKAYRRMALRFHPDKN-TDANAEEKFKEIAEAYEVLSDPKKRVVYDQLGEEGLKTGGSSSSGAPGSSTYHYTFHGDPHATFASFFGGSNPFDMFFGSNRSHSRSNGFPFHGDHSNDPDQDTEMDEDEPFTHFGRQFGFPGGMNNGFPGEARRRRGAPSDRPGNNRKHQDPPVVHELKVSLEEIFHGCTKRMKITRRRLNPDGRSMRTEDKILNIVIKKGWKEGTKITFPKEGDETPENIPADIAFVLKDKGHTHFRRDGSNIIYNCKISLKEALCGCTVSIPTLENRVISLPCLDIIKPGMVKRLRGEGLPFPKNPSQRGDLIVEFSVRFPDRIPPQSREIIRQHL 365          
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Match: SMESG000076708.1 (SMESG000076708.1)

HSP 1 Score: 653.67 bits (1685), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAILR 1023
            MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAILR
Sbjct:    1 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAILR 316          
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Match: SMESG000005055.1 (SMESG000005055.1)

HSP 1 Score: 388.267 bits (996), Expect = 1.150e-134
Identity = 180/308 (58.44%), Postives = 234/308 (75.97%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQK 999
            M +DYY IL I R+A   +I KAYR   +K HP KN     ++++F L+SEAY+VLSD  KR +YDQFGE GLK+G+P      GAWT+GYTYHGNP+KTF  F+ ++NPF+E++D +DGD+H+SFGGLYGR    +D SIER+L +TLEE++HGC+KK+KI+RRV+N D  T+S+ DKIL+V V+ GW EGTKI FP+EGDQGPN +PAD++F+LKDR H RF R++ NLIY + I LA AL+GC +DIV LDDR+LHIP+T+I+ P Y   V GEGMP     D KGDL I+F+I FP+ LT EQK
Sbjct:    1 MSKDYYEILNIPRHATIIEINKAYRKLGVKYHPKKNPESDCSYDQFFLVSEAYDVLSDDRKRGIYDQFGEYGLKHGVPRSDTFNGAWTEGYTYHGNPEKTFFEFYSSNNPFREYFDHIDGDLHMSFGGLYGRGVKTKDDSIERNLMITLEEVFHGCVKKMKITRRVLNADIRTTSVHDKILTVFVKKGWLEGTKIVFPEEGDQGPNNVPADIIFVLKDRPHPRFYREKFNLIYKTKIDLAKALLGCIVDIVMLDDRVLHIPVTNIVDPTYTMTVKGEGMPLTEVGDEKGDLIIKFEIVFPRYLTAEQK 308          
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Match: SMESG000073794.1 (SMESG000073794.1)

HSP 1 Score: 243.047 bits (619), Expect = 2.074e-77
Identity = 149/339 (43.95%), Postives = 210/339 (61.95%), Query Frame = 1
Query:   76 MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTK-GYTYHGNPDKTFINFFGADNPFQEFYDR------------MDGDMHLSF---------GGLYGRSQMLQDPSIERDLNLTLEEIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQG-PNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGC-TIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKKLTPEQKEHIKAIL 1020
            MG+DYYSIL  Q+ A D +IKKAYR  ALK HP KN S P+A  KF  I+EAYEVLSDP K+ +YD++GEEGLK G+  GS  +G      YT+HG+P + F NFFG D+PF   +              +D D H            GG +  +QM QDP I  DL+++LE++  G +KK+KI+R+  +  G++    +KIL ++V+ GWK GTKITFP+EGD+   + IPAD+VF++KDR H  F+RD  ++     ISL DAL G   + I TL+++++++PI  +I P   K +PG G+P    P  +GD+ ++F+I FP  LT   K+ IK  L
Sbjct:    1 MGKDYYSILGTQKGASDDEIKKAYRKMALKYHPDKNKS-PNAEAKFKEIAEAYEVLSDPKKKEIYDKYGEEGLKGGMGGGSDGSGGPGGFTYTFHGDPREIFKNFFGTDDPFANIFGNHSRRRGADNFMDVDDDFHPGISLFSGFNTGGGSFPHAQMKQDPPIYHDLSVSLEDVLSGTLKKIKITRKRPSPAGNSLIDEEKILEIDVKKGWKAGTKITFPREGDKYLTDNIPADIVFVIKDRTHRHFKRDGCDIRIKVKISLKDALCGIPNLQIPTLENQMINLPINTVIKPDTQKRIPGRGLPDNKNPSRRGDIVVEFEIIFPDSLTDNAKKVIKQSL 338          
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Match: SMESG000077692.1 (SMESG000077692.1)

HSP 1 Score: 139.428 bits (350), Expect = 1.616e-37
Identity = 104/350 (29.71%), Postives = 161/350 (46.00%), Query Frame = 1
Query:   79 GQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLEEIYHG---------CIKKLKISRRVMNEDGHTSSIR-------------------------DKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPKK--LTPEQKEHIKAIL 1020
            G+D+Y IL + R+A    IKKAYR  A +LHP KN  DP+A  +F  ++ AYE LSDP KR ++D  GEEGLK+    GS                         + +PF  F+    GD+    GG   +  + +   +  DL ++LEE+Y+G          +KK     R  N      +I+                         +K+L V ++ G ++G    F  EG+   +  P D+ F ++  +H RF R   +L  + +ISL DAL G +++I  LD   + +    + +PG       EGMP+     +KG L+I   + FPK    + E+KE +K +L
Sbjct:   19 GRDFYKILNVPRSANSNQIKKAYRNLAKQLHPDKNKDDPNAESQFQDLNAAYEALSDPEKRKIFDARGEEGLKDSHGGGS-------------------------SMDPFSSFF----GDVFFDMGGSRRQKDIPRGGDVVMDLFVSLEELYNGNFVEVVRYKSVKKSAHGTRRCNCRHEMKTIQTGPGRFTMTQEQVCDECPNVRFVPEEKLLEVEIEPGMRDGQLYPFVAEGEPHIDGEPGDLKFRIRQSSHPRFERRGDDLYTNVTISLLDALQGFSMEIKHLDGHKVKVIREKVTWPGATIKKSMEGMPNYENNHVKGSLYITIDVAFPKDKVYSEEEKEILKKLL 339          
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Match: SMESG000012107.1 (SMESG000012107.1)

HSP 1 Score: 134.035 bits (336), Expect = 3.986e-35
Identity = 102/341 (29.91%), Postives = 160/341 (46.92%), Query Frame = 1
Query:   88 YYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLISEAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKTFINFFGADNPFQEFYDRMDGD----MHLSFGGLY----------------------GRSQMLQDPSIERDLNLT--LEEIYHGCIKKLKIS-------RRVMNE-------DGHTSSIRDKILSVNVQCGWKEGTKITFPKEGDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDIVTLDDRLLHIPIT--DIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFPK 978
            YY IL +  N  + ++KKAYR  ALK HP KN   P A +KF  IS+A+EVL+D  KR +YD+ GE+ LK G             G +   NP   F  FFG     +    R   D    ++++   LY                      G+   +Q  +  R + +   + ++  G +++++ +       R V+NE       +G       K+L V++  G  +G +I F  EGDQ P + P D+  +L+++ H+ F R +A+LIY+  + L D+L G    I TLD R L +     ++I     + +  EGMP    P   G L IQF++ FP+
Sbjct:    7 YYDILGVHPNVSEQELKKAYRKLALKYHPDKN---PDAGDKFKEISQAFEVLADAKKRQIYDEGGEQALKEG------------GGDSGFHNPMDIFDMFFGGMGGGRSRGPRKGKDVIHQLNVTLDELYKGNTRKLAIQKNVICDKCSGRGGKEGAVQKCTTCRGMGVEVHIRQLGPGMVQQMQTTCRTCKGEREVINERDRCKRCEGQKVVREKKVLEVHIDKGMSDGQQIKFSGEGDQEPGLEPGDICIVLEEKPHNVFTRKKADLIYTMKLDLVDSLCGFKRTITTLDSRTLVVETKPGEVIKNLEYRALENEGMPKHKNPFEHGKLIIQFEVVFPE 332          
The following BLAST results are available for this feature:
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJB131.752e-13457.78DnaJ heat shock protein family (Hsp40) member B13 ... [more]
DNAJB41.921e-10448.07DnaJ heat shock protein family (Hsp40) member B4 [... [more]
DNAJB55.038e-10046.70DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB55.038e-10046.70DnaJ heat shock protein family (Hsp40) member B5 [... [more]
DNAJB52.206e-9946.31DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-137.882e-8041.67DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-137.882e-8041.67DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-121.977e-3030.21DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-121.977e-3030.21DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
dnj-192.717e-1940.16DNaJ domain (Prokaryotic heat shock protein) [Sou... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG50011.038e-9043.87gene:FBgn0031322 transcript:FBtr0307057[more]
CG50014.654e-9043.38gene:FBgn0031322 transcript:FBtr0335379[more]
CG50014.654e-9043.38gene:FBgn0031322 transcript:FBtr0307056[more]
CG50014.654e-9043.38gene:FBgn0031322 transcript:FBtr0077972[more]
DnaJ-14.035e-8241.79gene:FBgn0263106 transcript:FBtr0077123[more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb132.395e-13157.46DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb132.395e-13157.46DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb51.557e-10045.40DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb51.557e-10045.40DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb1b2.410e-9747.06DnaJ heat shock protein family (Hsp40) member B1b ... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb131.195e-13659.37DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb41.506e-9746.02DnaJ heat shock protein family (Hsp40) member B4 [... [more]
chd92.200e-9744.32chromodomain helicase DNA binding protein 9 [Sourc... [more]
dnajb18.524e-9043.84DnaJ heat shock protein family (Hsp40) member B1 [... [more]
dnaja4.12.512e-3932.15DnaJ heat shock protein family (Hsp40) member A4 [... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajb134.214e-13658.73DnaJ heat shock protein family (Hsp40) member B13 ... [more]
Dnajb137.847e-10455.06DnaJ heat shock protein family (Hsp40) member B13 ... [more]
Dnajb41.146e-10347.77DnaJ heat shock protein family (Hsp40) member B4 [... [more]
Dnajb41.146e-10347.77DnaJ heat shock protein family (Hsp40) member B4 [... [more]
Dnajb41.146e-10347.77DnaJ heat shock protein family (Hsp40) member B4 [... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80Y75|DJB13_MOUSE2.948e-13558.73DnaJ homolog subfamily B member 13 OS=Mus musculus... [more]
sp|P59910|DJB13_HUMAN8.413e-13457.78DnaJ homolog subfamily B member 13 OS=Homo sapiens... [more]
sp|Q5R8J8|DNJB4_PONAB1.847e-10448.37DnaJ homolog subfamily B member 4 OS=Pongo abelii ... [more]
sp|Q9UDY4|DNJB4_HUMAN9.224e-10448.07DnaJ homolog subfamily B member 4 OS=Homo sapiens ... [more]
sp|Q9D832|DNJB4_MOUSE8.016e-10347.77DnaJ homolog subfamily B member 4 OS=Mus musculus ... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A159X4H00.000e+098.62DNAJB13-like protein (Fragment) OS=Schmidtea medit... [more]
A0A3S1A3L77.247e-15666.98J domain-containing protein OS=Elysia chlorotica O... [more]
C8CBM41.443e-15565.71Heat shock protein 40A OS=Ruditapes philippinarum ... [more]
V3ZQN72.260e-15566.03J domain-containing protein OS=Lottia gigantea OX=... [more]
A0A1S3K3303.329e-15465.71dnaJ homolog subfamily B member 13 OS=Lingula ungu... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb132.632e-9647.94DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb47.157e-9646.20DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb1b1.128e-9344.77dnaJ homolog subfamily B member 1 [Source:NCBI gen... [more]
dnajb42.611e-9246.35DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb1a2.152e-8944.51dnaJ homolog subfamily B member 1-like [Source:NCB... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005773.12.209e-6436.94pep scaffold:Pmarinus_7.0:GL480846:50332:51737:1 g... [more]
DNAJA41.799e-2728.69DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja11.291e-2027.15DnaJ heat shock protein family (Hsp40) member A1 [... [more]
DNAJA41.320e-1943.48DnaJ heat shock protein family (Hsp40) member A4 [... [more]
dnaja3b6.522e-1927.19DnaJ heat shock protein family (Hsp40) member A3b ... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YDJ17.122e-4133.24Type I HSP40 co-chaperone; involved in regulation ... [more]
SIS11.563e-2630.68Type II HSP40 co-chaperone that interacts with the... [more]
SCJ15.332e-1750.00One of several homologs of bacterial chaperone Dna... [more]
DJP13.586e-1540.40Cytosolic J-domain-containing protein; required fo... [more]
HLJ15.894e-1550.72Co-chaperone for Hsp40p; anchored in the ER membra... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO386857.370e-13659.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467211.315e-9443.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493605.871e-9348.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387411.298e-7442.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319032.267e-6034.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb131.835e-11854.57DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb137.056e-11055.10DnaJ heat shock protein family (Hsp40) member B13 ... [more]
dnajb49.750e-10546.92DnaJ heat shock protein family (Hsp40) member B4 [... [more]
dnajb59.338e-10447.11DnaJ heat shock protein family (Hsp40) member B5 [... [more]
dnajb54.346e-10044.54DnaJ heat shock protein family (Hsp40) member B5 [... [more]
back to top
BLAST of dnaJ homolog subfamily B member 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076708.10.000e+0100.00SMESG000076708.1[more]
SMESG000005055.11.150e-13458.44SMESG000005055.1[more]
SMESG000073794.12.074e-7743.95SMESG000073794.1[more]
SMESG000077692.11.616e-3729.71SMESG000077692.1[more]
SMESG000012107.13.986e-3529.91SMESG000012107.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010941 ID=SMED30010941|Name=dnaJ homolog subfamily B member 13|organism=Schmidtea mediterranea sexual|type=transcript|length=1168bp
CAACGATATTAGAAATTAAATTGAATATTTTAAATTAATATTTTCGATTA
TTAAGAGTAGAGAAATATAGTGAAAATGGGCCAAGATTATTATTCAATAC
TCTGCATTCAAAGAAATGCAAAAGATGGCGACATTAAGAAAGCATATAGG
ATGTTTGCACTGAAGCTCCATCCATTAAAAAACATTTCTGATCCGTCAGC
ATTTGAGAAATTTTCTTTAATTTCAGAAGCATATGAAGTTCTTTCTGACC
CAAGTAAACGAGCTGTTTATGATCAATTTGGAGAAGAAGGTTTGAAAAAT
GGCATACCTCATGGCAGTATTGAAGCTGGTGCATGGACTAAAGGTTATAC
ATATCATGGAAATCCAGATAAAACATTTATAAACTTCTTTGGAGCAGATA
ATCCTTTCCAAGAATTTTATGATCGTATGGATGGAGATATGCATTTGAGC
TTTGGGGGACTTTACGGACGAAGTCAAATGCTACAAGATCCGTCAATTGA
AAGAGATTTGAATTTAACATTAGAAGAAATATATCATGGATGCATTAAAA
AATTGAAAATTTCAAGGAGGGTTATGAATGAAGACGGACACACTAGCAGT
ATCAGAGACAAAATTCTGTCAGTCAATGTTCAATGTGGATGGAAAGAAGG
CACTAAAATTACATTCCCGAAGGAAGGCGATCAAGGTCCCAATATAATTC
CAGCTGATGTTGTTTTCATTCTCAAAGACCGGGCACATTCCAGATTTCGG
CGAGACGAAGCTAATTTAATTTATTCATCTAGCATATCATTGGCTGATGC
TCTGATTGGCTGCACAATTGATATAGTGACCTTGGATGATCGCTTGTTGC
ACATACCAATCACAGATATTATCTATCCGGGATATGTGAAAATCGTTCCC
GGCGAAGGAATGCCCCACCCATCAAAACCGGATATGAAGGGAGATTTACA
TATTCAATTCAAAATAGAATTTCCTAAAAAACTCACTCCTGAACAGAAAG
AGCATATAAAGGCCATTCTACGATAACAATGATTAAAACAATGAAATTGA
TTTTTATTATTTGTGCTTTTTCATACTTAGAAAATGTAAAATTGAAAATC
TGAAAAATAATTTGAAATTTATCTCAGATTTTGTTTATCATTAAATAAAA
TAATAATTAATAGCAAAA
back to top

protein sequence of SMED30010941-orf-1

>SMED30010941-orf-1 ID=SMED30010941-orf-1|Name=SMED30010941-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MGQDYYSILCIQRNAKDGDIKKAYRMFALKLHPLKNISDPSAFEKFSLIS
EAYEVLSDPSKRAVYDQFGEEGLKNGIPHGSIEAGAWTKGYTYHGNPDKT
FINFFGADNPFQEFYDRMDGDMHLSFGGLYGRSQMLQDPSIERDLNLTLE
EIYHGCIKKLKISRRVMNEDGHTSSIRDKILSVNVQCGWKEGTKITFPKE
GDQGPNIIPADVVFILKDRAHSRFRRDEANLIYSSSISLADALIGCTIDI
VTLDDRLLHIPITDIIYPGYVKIVPGEGMPHPSKPDMKGDLHIQFKIEFP
KKLTPEQKEHIKAILR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR001623DnaJ_domain
IPR002939DnaJ_C
IPR018253DnaJ_domain_CS
IPR008971HSP40/DnaJ_pept-bd
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: molecular function
TermDefinition
GO:0051082unfolded protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 24..39
score: 44.54
coord: 41..61
score: 54.82
coord: 6..24
score: 45.54
coord: 61..80
score: 40.5
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 3..61
e-value: 1.7E-20
score: 84.1
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 4..66
e-value: 1.7E-22
score: 79.3
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 4..69
score: 20.479
IPR001623DnaJ domainCDDcd06257DnaJcoord: 4..58
e-value: 1.09858E-18
score: 76.4301
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 221..316
e-value: 3.8E-26
score: 93.2
NoneNo IPR availableGENE3DG3DSA:2.60.260.20coord: 140..220
e-value: 1.0E-28
score: 101.1
NoneNo IPR availablePANTHERPTHR24078DNAJ HOMOLOG SUBFAMILY C MEMBERcoord: 1..315
NoneNo IPR availablePANTHERPTHR24078:SF525DNAJ HOMOLOG SUBFAMILY B MEMBER 5coord: 1..315
NoneNo IPR availableCDDcd10747DnaJ_Ccoord: 139..303
e-value: 6.29634E-51
score: 163.75
IPR002939Chaperone DnaJ, C-terminalPFAMPF01556DnaJ_Ccoord: 141..300
e-value: 1.3E-39
score: 135.7
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 2..119
e-value: 2.4E-26
score: 94.4
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 3..90
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 46..65
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 141..221
IPR008971HSP40/DnaJ peptide-bindingSUPERFAMILYSSF49493HSP40/DnaJ peptide-binding domaincoord: 223..310