Ectonucleoside triphosphate diphosphohydrolase 3

Overview
NameEctonucleoside triphosphate diphosphohydrolase 3
Smed IDSMED30010934
Length (bp)1763
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectonucleoside triphosphate diphosphohydrolase 3 (SMED30010934) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase 3 (SMED30010934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectonucleoside triphosphate diphosphohydrolase 3 (SMED30010934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectonucleoside triphosphate diphosphohydrolase 3 (SMED30010934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010934SMESG000010140.1 dd_Smed_v4_16337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010934SMESG000010140.1 dd_Smed_v4_16337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010934SMESG000010140.1 dd_Smed_v4_16337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30010934SMESG000010140.1 Contig15448newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010934SMESG000010140.1 Contig15448uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010934SMESG000010140.1 Contig43874newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010934SMESG000010140.1 Contig43874uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Match: ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:HGNC Symbol;Acc:HGNC:3365])

HSP 1 Score: 138.658 bits (348), Expect = 1.768e-34
Identity = 116/423 (27.42%), Postives = 186/423 (43.97%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLK-NTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF------ETKTGD--PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPED---SYTC------------RSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKY--NSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLF-QMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    VS+   C      I  + N  +D+ +  +  + K++      +    PI+L ATAGMR+L ++N+T    +   I+S F    ++F+   I+ G  EG+ GW T NYL  N + KN     +      T G LDLGG+STQI+F      +  T D   V L+   Y LY+ S+ CYG N    ++L   L ++ +         T    P D   S+T             R E+    D+ TF+    P+   C+ ++A          Q       V              +Y       ++G +  ++F  +T  FC+++++ L     K D  +A++YC   N+I  LF   Y      +  + F  ++   +  W+LGYM+  T  IP
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKN-----HLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSL--CKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Match: ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:HGNC Symbol;Acc:HGNC:3365])

HSP 1 Score: 138.658 bits (348), Expect = 1.768e-34
Identity = 116/423 (27.42%), Postives = 186/423 (43.97%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLK-NTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF------ETKTGD--PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPED---SYTC------------RSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKY--NSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLF-QMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    VS+   C      I  + N  +D+ +  +  + K++      +    PI+L ATAGMR+L ++N+T    +   I+S F    ++F+   I+ G  EG+ GW T NYL  N + KN     +      T G LDLGG+STQI+F      +  T D   V L+   Y LY+ S+ CYG N    ++L   L ++ +         T    P D   S+T             R E+    D+ TF+    P+   C+ ++A          Q       V              +Y       ++G +  ++F  +T  FC+++++ L     K D  +A++YC   N+I  LF   Y      +  + F  ++   +  W+LGYM+  T  IP
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKN-----HLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSL--CKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 131.724 bits (330), Expect = 4.114e-32
Identity = 120/436 (27.52%), Postives = 191/436 (43.81%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYF-QNRNE------DLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRF-----------STFGVLDLGGSSTQIAF-----ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV---NCFLKGTPTTM-PEDSY--TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAI-------------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---FCTEDYATLDAKY-GKDAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  F Q  NE      D M+  + ++   R+   + P+YL ATAGMR+L +E++ L   + + ++       ++F+   I+ G  EG  GW T+NYL   +GK S  +K R+            TFG LDLGG+STQ+ F       ++ D  +   L+ + Y +Y+ S+LCYG +    + L    +   S+E+    CF  G    +   D Y   C       +    F+     N   C   I +               G  +  +Q D                F+ K+  +T +  S  + T +   FC + +  +   Y G   K+   YC  G +I+ +L Q Y   A +++++ F  KI+G + GW LGYM+  T  IP  +  
Sbjct:   56 YGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIP--RSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYL---LGKFS--QKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKD-IQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGD--------FGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPL 475          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 131.339 bits (329), Expect = 5.468e-32
Identity = 120/436 (27.52%), Postives = 191/436 (43.81%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYF-QNRNE------DLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRF-----------STFGVLDLGGSSTQIAF-----ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV---NCFLKGTPTTM-PEDSY--TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAI-------------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---FCTEDYATLDAKY-GKDAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  F Q  NE      D M+  + ++   R+   + P+YL ATAGMR+L +E++ L   + + ++       ++F+   I+ G  EG  GW T+NYL   +GK S  +K R+            TFG LDLGG+STQ+ F       ++ D  +   L+ + Y +Y+ S+LCYG +    + L    +   S+E+    CF  G    +   D Y   C       +    F+     N   C   I +               G  +  +Q D                F+ K+  +T +  S  + T +   FC + +  +   Y G   K+   YC  G +I+ +L Q Y   A +++++ F  KI+G + GW LGYM+  T  IP  +  
Sbjct:   49 YGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIP--RSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYL---LGKFS--QKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKD-IQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGD--------FGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPL 468          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Match: ENTPD1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:HGNC Symbol;Acc:HGNC:3363])

HSP 1 Score: 130.954 bits (328), Expect = 7.705e-32
Identity = 120/436 (27.52%), Postives = 191/436 (43.81%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYF-QNRNE------DLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRF-----------STFGVLDLGGSSTQIAF-----ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV---NCFLKGTPTTM-PEDSY--TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAI-------------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---FCTEDYATLDAKY-GKDAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  F Q  NE      D M+  + ++   R+   + P+YL ATAGMR+L +E++ L   + + ++       ++F+   I+ G  EG  GW T+NYL   +GK S  +K R+            TFG LDLGG+STQ+ F       ++ D  +   L+ + Y +Y+ S+LCYG +    + L    +   S+E+    CF  G    +   D Y   C       +    F+     N   C   I +               G  +  +Q D                F+ K+  +T +  S  + T +   FC + +  +   Y G   K+   YC  G +I+ +L Q Y   A +++++ F  KI+G + GW LGYM+  T  IP  +  
Sbjct:   61 YGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIP--RSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYL---LGKFS--QKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKD-IQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGD--------FGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPL 480          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Match: mig-23 (Nucleoside-diphosphatase mig-23 [Source:UniProtKB/Swiss-Prot;Acc:Q21815])

HSP 1 Score: 85.5001 bits (210), Expect = 2.987e-17
Identity = 112/487 (23.00%), Postives = 208/487 (42.71%), Query Frame = 3
Query:  318 DHAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQIL--------YFQNRNEDLMKCIKSLL-LKLRAV--KFKP--PIYLAATAGMRILEIENK-TLTKVMFNEIKSL--FYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI-------RKDRFSTFGVLDLGGSSTQIAFETKTGDP--------VILFTR------KYLLYSRSYLCYGVNMFRIRY---LTTTLLDATSSEV--NCF---LKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAAD--CRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMT-------GKYNS--FVQATGLFCTEDYATLDAKYGK------DAKFAQNYCLVGNFII-VLFQMYGINASN--FDNVIFANKIRGQNTGWNLGYMIKQTKDIP---NSRAFKLNXXXXXXXXXXC-LLYITIAICIFLF 1571
            D   ++G++ DAGS GTR ++Y W    + ++ E+ +I   + D   ++         F  +     + ++ L+ L  R +  + +P  P+++ ATAGMR++  E K  + K + N++  +    VL    + + I++G +EGI  W  VNY      K +T+          R  T G++D+GG+S QIAFE    D         + L  R      KY L+  ++L YGVN    +Y   L + L D   + +  +C    L  T T    +++  R   +     +  KK   P ++   C+ + AK     V    +          +        ++Y+  T       G+Y++    + T  +C++ ++T+ A+  K      D +  +  C    +I  VL   + ++ ++  F +V   + I GQ   W LG MI   +  P   +SR   +         +   L +++   C+F+ 
Sbjct:   39 DQERSYGVICDAGSTGTRLFVYNWI---STSDSELIQIEPVIYDNKPVMKKISPGLSTFGTKPAQAAEYLRPLMELAERHIPEEKRPYTPVFIFATAGMRLIPDEQKEAVLKNLRNKLPKITSMQVLK---EHIRIIEGKWEGIYSWIAVNYALGKFNKTATLDFPGTSPAHARQKTVGMIDMGGASAQIAFELPDTDSFSSINVENINLGCREDDSLFKYKLFVTTFLGYGVNEGIRKYEHMLLSKLKDQNGTVIQDDCMPLNLHKTVTLENGENFVRRGTGNWNTCSNEVKKLLNPESSSEVCKAEAAKCYFGAVPAPSIP---------LSNIEMYGFSEYWYSTHDVLGLGGQYDAENIAKKTQQYCSKRWSTIQAESKKQLYPRADEERLRTQCFKSAWITSVLHDGFSVDKTHNKFQSV---STIAGQEVQWALGAMIYHMRFFPLRDSSRNLIVKETHSSSESLWAPLFFLSAVFCLFVL 507          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 66.2402 bits (160), Expect = 3.157e-11
Identity = 100/433 (23.09%), Postives = 177/433 (40.88%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDEN---TNTNDEVSEIGNCVADKLQILY-FQNRNEDLMKCIKSLLLKLRAVKFKPP--------IYLAATAGMRIL-EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKT---------------GDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADC--------RNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNS--------FVQATGLFCTEDYATLDAKYGK------DAKFAQNYCLVGNFII-VLFQMYGINASN--FDNVIFANKIRGQNTGWNLGYMIKQTKDI 1472
            +G++ DAGS GTR ++Y     +   TN +  + E    V      L  F ++ E +++ +  LL   R  +   P        + + ATAGMR+L E +   + K + N +KS+   L  +   + I+ G +EGI  W  VNY+   +G+     K+  S  G++D+GG+S QIAFE                  G        KY +YS ++L YG N    +Y   +L+ + +S  +C  +G    + E  +T        + L+         A           RN IA ++  N+  +Q+                   ++Y+  T  + S        F      +C +D+  +   + +      D +     C    ++  VL   + ++ +   F +V+   KI G+   W LG M+  +KD+
Sbjct:   83 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLL---RFAEEHIPYEQLGETDLLIFATAGMRLLPEAQKDAIIKNLQNGLKSV-TALRVSDSNIRIIDGAWEGIYSWIAVNYI---LGR---FDKENDSKVGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKY-ENSLVKSGNSNDSCSPRGLNRLIGE--FTVNGTGEWDVCLAQVSSLIGDKAQPSCPNPTCFLRNVIAPSV--NLSTVQL----------------YGFSEYWYTTSNFGSGGEYHYQKFTDEVRKYCQKDWNDIQDGFKRNEFPNADIERLGTNCFKAAWVTSVLHDGFNVDKTKHLFQSVL---KIAGEEMQWALGAMLYHSKDL 481          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 65.855 bits (159), Expect = 4.591e-11
Identity = 100/433 (23.09%), Postives = 177/433 (40.88%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDEN---TNTNDEVSEIGNCVADKLQILY-FQNRNEDLMKCIKSLLLKLRAVKFKPP--------IYLAATAGMRIL-EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKT---------------GDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADC--------RNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNS--------FVQATGLFCTEDYATLDAKYGK------DAKFAQNYCLVGNFII-VLFQMYGINASN--FDNVIFANKIRGQNTGWNLGYMIKQTKDI 1472
            +G++ DAGS GTR ++Y     +   TN +  + E    V      L  F ++ E +++ +  LL   R  +   P        + + ATAGMR+L E +   + K + N +KS+   L  +   + I+ G +EGI  W  VNY+   +G+     K+  S  G++D+GG+S QIAFE                  G        KY +YS ++L YG N    +Y   +L+ + +S  +C  +G    + E  +T        + L+         A           RN IA ++  N+  +Q+                   ++Y+  T  + S        F      +C +D+  +   + +      D +     C    ++  VL   + ++ +   F +V+   KI G+   W LG M+  +KD+
Sbjct:   49 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLL---RFAEEHIPYEQLGETDLLIFATAGMRLLPEAQKDAIIKNLQNGLKSV-TALRVSDSNIRIIDGAWEGIYSWIAVNYI---LGR---FDKENDSKVGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKY-ENSLVKSGNSNDSCSPRGLNRLIGE--FTVNGTGEWDVCLAQVSSLIGDKAQPSCPNPTCFLRNVIAPSV--NLSTVQL----------------YGFSEYWYTTSNFGSGGEYHYQKFTDEVRKYCQKDWNDIQDGFKRNEFPNADIERLGTNCFKAAWVTSVLHDGFNVDKTKHLFQSVL---KIAGEEMQWALGAMLYHSKDL 447          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Match: ntp-1 (Nucleoside-triphosphatase ntp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q18411])

HSP 1 Score: 65.855 bits (159), Expect = 4.591e-11
Identity = 100/433 (23.09%), Postives = 177/433 (40.88%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDEN---TNTNDEVSEIGNCVADKLQILY-FQNRNEDLMKCIKSLLLKLRAVKFKPP--------IYLAATAGMRIL-EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKT---------------GDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADC--------RNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNS--------FVQATGLFCTEDYATLDAKYGK------DAKFAQNYCLVGNFII-VLFQMYGINASN--FDNVIFANKIRGQNTGWNLGYMIKQTKDI 1472
            +G++ DAGS GTR ++Y     +   TN +  + E    V      L  F ++ E +++ +  LL   R  +   P        + + ATAGMR+L E +   + K + N +KS+   L  +   + I+ G +EGI  W  VNY+   +G+     K+  S  G++D+GG+S QIAFE                  G        KY +YS ++L YG N    +Y   +L+ + +S  +C  +G    + E  +T        + L+         A           RN IA ++  N+  +Q+                   ++Y+  T  + S        F      +C +D+  +   + +      D +     C    ++  VL   + ++ +   F +V+   KI G+   W LG M+  +KD+
Sbjct:   49 YGVICDAGSSGTRLFVYTLKPLSGGLTNIDTLIHESEPVVKKVTPGLSSFGDKPEQVVEYLTPLL---RFAEEHIPYEQLGETDLLIFATAGMRLLPEAQKDAIIKNLQNGLKSV-TALRVSDSNIRIIDGAWEGIYSWIAVNYI---LGR---FDKENDSKVGMIDMGGASVQIAFEIANEKESYNGGNVYEINLGSIETNEDYKYKIYSTTFLGYGANEGLKKY-ENSLVKSGNSNDSCSPRGLNRLIGE--FTVNGTGEWDVCLAQVSSLIGDKAQPSCPNPTCFLRNVIAPSV--NLSTVQL----------------YGFSEYWYTTSNFGSGGEYHYQKFTDEVRKYCQKDWNDIQDGFKRNEFPNADIERLGTNCFKAAWVTSVLHDGFNVDKTKHLFQSVL---KIAGEEMQWALGAMLYHSKDL 447          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Match: uda-1 (Nucleoside-diphosphatase uda-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XU84])

HSP 1 Score: 55.0694 bits (131), Expect = 1.076e-7
Identity = 63/247 (25.51%), Postives = 105/247 (42.51%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKW-YDENTNTNDEVSEIGNCVADKLQ--ILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRIL--EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI---RKDRFSTFGVLDLGGSSTQI--------AFETKTG--DPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPE 1004
            F IVIDAGS GTR +LYK+ +D    ++    ++   +  +++  +  F          ++ LL + R      +  K PI L ATAG+R+L  ++ +  L  V      S F+    +   V ++ G  EG+  W T+N L  T+  +      +     +    DLGG STQ+         F    G    +  F     L++ S+L  G+   R+  L       T +E+    +   + MPE
Sbjct:   43 FTIVIDAGSTGTRLHLYKFIHDPAIASHGMPFKVEKEIFQEVKPGLSSFAKSPSSAADSLEPLLQRARKEVPHFMWEKTPITLKATAGLRLLPGDMADDILESVEERIFNSGFFAAFPD--AVNVMPGSDEGVYSWFTLNILLETLFTDEPTVGHKPAAHRSVAAFDLGGGSTQLTYWPNNEAVFSEHVGYERDIDFFGHHIRLFTHSFLGNGLIAARLNILQL----ETDNEIESTHQLITSCMPE 283          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332460)

HSP 1 Score: 61.6178 bits (148), Expect = 1.036e-9
Identity = 61/215 (28.37%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  330 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKP-------PIYLAATAGMRILEIENKTLTKVMFNEIKSLFY--VLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILF----------TRKYLLYSRSYLCYGVNMFR 917
             +  +IDAGS G+R   YK ++ +   N  V         K  +  F +   +    IK LL + RA  F P       P+ L ATAG+R+L        + + N ++ LF       +   V I+ G  EGI  W TVN+L   + K +            LDLGG STQ+ F     D V ++          ++K  +++ SYL  G+   R
Sbjct:  141 QYAAIIDAGSTGSRVLAYK-FNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLDEARA--FIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVDMDAVEIMDGTDEGIFSWFTVNFLLGRLSKTNQA--------AALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAAR 341          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0332459)

HSP 1 Score: 61.2326 bits (147), Expect = 1.346e-9
Identity = 61/215 (28.37%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  330 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKP-------PIYLAATAGMRILEIENKTLTKVMFNEIKSLFY--VLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILF----------TRKYLLYSRSYLCYGVNMFR 917
             +  +IDAGS G+R   YK ++ +   N  V         K  +  F +   +    IK LL + RA  F P       P+ L ATAG+R+L        + + N ++ LF       +   V I+ G  EGI  W TVN+L   + K +            LDLGG STQ+ F     D V ++          ++K  +++ SYL  G+   R
Sbjct:   81 QYAAIIDAGSTGSRVLAYK-FNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLDEARA--FIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVDMDAVEIMDGTDEGIFSWFTVNFLLGRLSKTNQA--------AALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAAR 281          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Fly
Match: NTPase (gene:FBgn0024947 transcript:FBtr0077683)

HSP 1 Score: 60.8474 bits (146), Expect = 1.770e-9
Identity = 61/215 (28.37%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  330 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKP-------PIYLAATAGMRILEIENKTLTKVMFNEIKSLFY--VLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILF----------TRKYLLYSRSYLCYGVNMFR 917
             +  +IDAGS G+R   YK ++ +   N  V         K  +  F +   +    IK LL + RA  F P       P+ L ATAG+R+L        + + N ++ LF       +   V I+ G  EGI  W TVN+L   + K +            LDLGG STQ+ F     D V ++          ++K  +++ SYL  G+   R
Sbjct:   78 QYAAIIDAGSTGSRVLAYK-FNRSFIDNKLVLYEELFKERKPGLSSFADNPAEGAHSIKLLLDEARA--FIPKEHWSSTPLVLKATAGLRLLPASK---AENILNAVRDLFAKSEFSVDMDAVEIMDGTDEGIFSWFTVNFLLGRLSKTNQA--------AALDLGGGSTQVTFSPTDPDQVPVYDKYMHEVVTSSKKINVFTHSYLGLGLMAAR 278          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Match: entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:ZFIN;Acc:ZDB-GENE-030131-6186])

HSP 1 Score: 140.198 bits (352), Expect = 2.737e-35
Identity = 114/416 (27.40%), Postives = 184/416 (44.23%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYF-------QNRNEDLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGK----NSTIRKDRFSTFGVLDLGGSSTQIAFETKT---GDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTL---LDATSSEVNCFLKGTPTTMPEDSY---TCRSEN--SRGIDLSTFKKFYRPNAADCRNQIAKAIG-------KNVDVIQV-DKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  YLY+W  E  N    VS+   C+     I          Q     L +C+K++   + + +    P++L ATAGMR+L + N+  +  +  ++K+    L + F+   I+ G  EG+ GW TVNYLK    +    N+ +      T G LDLGG+STQIAF T     G+ +I   L+  +Y +Y+ S+LCYG N    R L       ++  + +  CF  G  T++P +      C   N  SR     +   F + N   C+  +            +N     V    +     A   +Y   L      +     F     LFC+ D+  L   Y       +++C   N++  +L   Y  N  N++N+ F+ ++   +  W+LGYM+  +  IP
Sbjct:   40 YGIVLDAGSSRTTVYLYEWPAEKENNTGVVSQTTKCLVKGPGISDLGLDGDQDQKTWNSLKECMKNMTEAIPSHQHNSTPVFLGATAGMRLLHMTNEGRSNDVLTQMKNYLSSLPFKFQNASIISGQEEGLYGWITVNYLKGNFLEKNLWNAWVHPHGAKTVGSLDLGGASTQIAFATSDDAKGEDIIKVSLYGYEYNIYTHSFLCYGKNEAEKRVLAKLAKEPINWANVKHPCFPTGYNTSIPAEEIFGSECTKNNVPSRYDPKRSITFFGQSNPEQCKALVRSIFDLTSCQGTENCSFDGVYQPPLNGDFTAYAGFYWTALALKVNGSNSMEKFNTNMKLFCSNDWKNLKQNYENKDSHLKSFCYSANYVHTILADGYKFNTDNWENLEFSKEVNNTSIAWSLGYMLALSNMIP 455          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 137.502 bits (345), Expect = 1.917e-34
Identity = 122/432 (28.24%), Postives = 188/432 (43.52%), Query Frame = 3
Query:  321 HAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQIL-YFQN---RNEDLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKN----STIRKDRFSTFGVLDLGGSSTQIAFETKTGDPV---------ILFTRKYLLYSRSYLCYGVNMFRIR---YLTTTLLDATSSEVNCFLKG------------TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGK--YNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRA 1487
            ++  FGIV DAGS  T  +LY+W     N    VS+  +C  D   I  Y QN     E L KC+      +   + K  P+YL ATAGMR+L ++N+T +  +  E+        ++F+   IL G  EG  GW T NYL  +  K+    S I        G LDLGG+STQI+F  K  DPV          L+  KY LY+ SYLCYG +    +   YL      ++S    C+ KG            +P  +P  S+  +       D   FK     N++ C + I   +      +  D     +            + Y+       +T K      +      C++++  L A+      K+ ++YC  G++I  +L + Y  N + +D + F  ++   + GW LGYM+  T  IP+ R+
Sbjct:   38 YSTQFGIVFDAGSSHTALFLYQWQGNKENNTGIVSQKQSCDVDGDGISSYVQNPAGAGESLKKCLDIAKAAIPTEQQKSTPVYLGATAGMRLLNLQNQTQSDSILAEVAKTIQTYPFDFRGARILTGMEEGAYGWITTNYLLESFIKHTFEGSWIHPKAGKIIGALDLGGASTQISFTPK--DPVRDPNSAFNLQLYGYKYELYTYSYLCYGKDQALKKLQAYLHKNAGSSSSISHPCYHKGYNLNLTLAELYNSPCVVPPSSFNPK-------DTILFKG--TGNSSLCLSLIENIVNLTGCALSPDCGFNGIYQPPVNGEFFAFSAYFYTFDFLGLTPKAPLTKVLSTIDTLCSKNWTALTAENPSIKPKYLKDYCASGHYITTILLKGYKFN-NTWDQISFVKQVADTDIGWTLGYMLNLTNMIPSERS 457          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Match: entpd8 (ectonucleoside triphosphate diphosphohydrolase 8 [Source:ZFIN;Acc:ZDB-GENE-040724-142])

HSP 1 Score: 137.502 bits (345), Expect = 1.917e-34
Identity = 122/432 (28.24%), Postives = 188/432 (43.52%), Query Frame = 3
Query:  321 HAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQIL-YFQN---RNEDLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKN----STIRKDRFSTFGVLDLGGSSTQIAFETKTGDPV---------ILFTRKYLLYSRSYLCYGVNMFRIR---YLTTTLLDATSSEVNCFLKG------------TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGK--YNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRA 1487
            ++  FGIV DAGS  T  +LY+W     N    VS+  +C  D   I  Y QN     E L KC+      +   + K  P+YL ATAGMR+L ++N+T +  +  E+        ++F+   IL G  EG  GW T NYL  +  K+    S I        G LDLGG+STQI+F  K  DPV          L+  KY LY+ SYLCYG +    +   YL      ++S    C+ KG            +P  +P  S+  +       D   FK     N++ C + I   +      +  D     +            + Y+       +T K      +      C++++  L A+      K+ ++YC  G++I  +L + Y  N + +D + F  ++   + GW LGYM+  T  IP+ R+
Sbjct:   38 YSTQFGIVFDAGSSHTALFLYQWQGNKENNTGIVSQKQSCDVDGDGISSYVQNPAGAGESLKKCLDIAKAAIPTEQQKSTPVYLGATAGMRLLNLQNQTQSDSILAEVAKTIQTYPFDFRGARILTGMEEGAYGWITTNYLLESFIKHTFEGSWIHPKAGKIIGALDLGGASTQISFTPK--DPVRDPNSAFNLQLYGYKYELYTYSYLCYGKDQALKKLQAYLHKNAGSSSSISHPCYHKGYNLNLTLAELYNSPCVVPPSSFNPK-------DTILFKG--TGNSSLCLSLIENIVNLTGCALSPDCGFNGIYQPPVNGEFFAFSAYFYTFDFLGLTPKAPLTKVLSTIDTLCSKNWTALTAENPSIKPKYLKDYCASGHYITTILLKGYKFN-NTWDQISFVKQVADTDIGWTLGYMLNLTNMIPSERS 457          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-040801-58])

HSP 1 Score: 131.724 bits (330), Expect = 2.135e-32
Identity = 114/412 (27.67%), Postives = 172/412 (41.75%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYF---QNRNEDLMKCIKSLLLKLRAVKF-KPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETK----TGDPVI---LFTRKYLLYSRSYLCYG------VNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKN-----------VDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQM-YGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  ++YKW  E  N    V +   C V  K    YF         L +C+K    K+ A +  + P+YL ATAGMR+L++E++  ++ +   +        ++++   IL G  EG  GW TVNYL   + K +        T G LDLGG+STQI F  +    + D  I   L+   Y LY+ S+LCYG      + M      T    DA      CF  G  TT   +S          +    F      N + C+  I K    +           V    V+ K    +   F      LT         +   Q   ++C+  +  +   + K   K+   YC    +I+ L +  Y   + N++++ F  KI   + GW LGYM+  T  IP
Sbjct:   45 YGIVLDAGSSHTSVFIYKWPAEKENNTGMVQQHHTCNVKGKGISSYFDKPHGAGASLEECMKEAKEKIPAHRHSETPVYLGATAGMRLLKMEDEMASEKVLTSVAHSLKTYPFSYQGARILSGQEEGAFGWITVNYLSENLRKPA-------GTLGALDLGGASTQITFVPQQIIESSDNSIDFRLYGNDYHLYTHSFLCYGKDQALKLAMAEKLRSTPDKTDAILLRDPCFHPGYNTTKTLESVNTPCMKPLKMPKEQFSHVGLGNWSQCQESIRKVFNTSHCPYSGCSFNGVFQPTVEGKFGAFSAFFFVMDFLNLT-----NDSLDKTKQRLAMYCSTPWQKIVQDHPKVKEKYLSEYCFSATYILTLLEHGYNFTSDNWNDIKFIKKIGDSDAGWTLGYMLNLTNMIP 444          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:ZFIN;Acc:ZDB-GENE-040801-58])

HSP 1 Score: 131.339 bits (329), Expect = 2.629e-32
Identity = 114/412 (27.67%), Postives = 172/412 (41.75%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYF---QNRNEDLMKCIKSLLLKLRAVKF-KPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETK----TGDPVI---LFTRKYLLYSRSYLCYG------VNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKN-----------VDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQM-YGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  ++YKW  E  N    V +   C V  K    YF         L +C+K    K+ A +  + P+YL ATAGMR+L++E++  ++ +   +        ++++   IL G  EG  GW TVNYL   + K +        T G LDLGG+STQI F  +    + D  I   L+   Y LY+ S+LCYG      + M      T    DA      CF  G  TT   +S          +    F      N + C+  I K    +           V    V+ K    +   F      LT         +   Q   ++C+  +  +   + K   K+   YC    +I+ L +  Y   + N++++ F  KI   + GW LGYM+  T  IP
Sbjct:   49 YGIVLDAGSSHTSVFIYKWPAEKENNTGMVQQHHTCNVKGKGISSYFDKPHGAGASLEECMKEAKEKIPAHRHSETPVYLGATAGMRLLKMEDEMASEKVLTSVAHSLKTYPFSYQGARILSGQEEGAFGWITVNYLSENLRKPA-------GTLGALDLGGASTQITFVPQQIIESSDNSIDFRLYGNDYHLYTHSFLCYGKDQALKLAMAEKLRSTPDKTDAILLRDPCFHPGYNTTKTLESVNTPCMKPLKMPKEQFSHVGLGNWSQCQESIRKVFNTSHCPYSGCSFNGVFQPTVEGKFGAFSAFFFVMDFLNLT-----NDSLDKTKQRLAMYCSTPWQKIVQDHPKVKEKYLSEYCFSATYILTLLEHGYNFTSDNWNDIKFIKKIGDSDAGWTLGYMLNLTNMIP 448          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Match: foxc2 (forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382])

HSP 1 Score: 135.191 bits (339), Expect = 1.320e-33
Identity = 120/414 (28.99%), Postives = 182/414 (43.96%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNE----DLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGK--NSTIRKDRFSTFGVLDLGGSSTQIAFETKTG-----DPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN--CFLKGTPTTMPEDS-YTCRSENSRGIDLS---TFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKYNSFVQATGL---FCTEDYATLDAKYGKDA-KFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPN 1478
            +G+V DAGS  T  YLY+W     N    + +  +C      I  + +        L  C+  +L  + A + +  P+ L ATAGMR+L IEN T T+++F+EI         +F+   IL G  EG  GW TVNYL  T      S +      TFG +DLGG+STQ+ F+  TG     D  +   L+   Y +Y+ SYLCYG +    R L   L   +S  V   C+ KG    +   S +      S   DLS   T +    P   +C   I      +    + D     V            + +Y       +T +  S  +A G    FC+ D+ATL   +  ++ K    YC  G +I+ +L   Y  ++  ++ + F+ +    + GW LGYM+  T  IP+
Sbjct:   14 YGMVFDAGSSHTTLYLYQWPANKENDTGIIRQAYSCDVQGPGISSYADTPSGAAASLQPCMDQVLSVIPAAQQRQTPVLLGATAGMRLLRIENATKTQLIFDEISKTLGGYPVDFRGARILTGSEEGSLGWVTVNYLLGTFHTYLGSWVHPTGGQTFGAMDLGGASTQMTFQ-PTGAIQDKDTEMFFRLYGYNYTIYTHSYLCYGQDQVFKRLLANILQGWSSGLVAHPCYAKGYRANISLASVFNSPCVPSGPADLSVNVTVEGTGDPT--ECHRAIGNVFNFSACQSKADCSFDGVYQPPAQGEFYAFSAFYYTFSFLNLTSR-QSLSEANGTVWNFCSSDWATLTGSFPLESRKRLLEYCSSGMYILTLLLDGYKFDSQTWNKIYFSKQAGSMDIGWTLGYMLNLTNMIPS 423          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Match: pgrmc1 (progesterone receptor membrane component 1 [Source:Xenbase;Acc:XB-GENE-6082492])

HSP 1 Score: 132.494 bits (332), Expect = 1.685e-32
Identity = 127/463 (27.43%), Postives = 204/463 (44.06%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED----LMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLK-NTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF--ETKTGDP-----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSS--EVNCFLKGTPTTMPED-------SYTCRSENSRGIDLSTFKKFYRP-----------NAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF-KLNXXXXXXXXXXCLLYITIAIC-IFLFKMWERKQKIH 1601
            +GIV+DAGS  T  Y+Y+W  E  N    V +   C      I  + N  +     +  CIK +   + A +    P YL ATAGMR+L ++N++  + +   I   F    + F+   I+ G  EG+ GW TVNYL  N + KN   + +R D   T G LDLGG+STQI+F  E    +P     V L+   Y +Y++S+ CYG +    R L +   D      E  C+ +     +  +       +   R  N     + TFK    P           N A C+ +   +    +   +V       A   +      LT Y+++    N F  +   FC +++  L     + D  +A++YC   NFI  +L   Y  ++  +  + F  ++   + GW+LGYM+  T  IP  R    L + + +   ++CL     A+C I L  ++ RK+  H
Sbjct:   43 YGIVLDAGSSRTTIYVYQWPAEKENNTGVVDQTLKCNVKGRGISSYANEPKKAPTYIDDCIKKVKEVIPASQHNSTPAYLGATAGMRLLRLKNESAAQGVLASIHDYFQTQPFAFRGANIITGQEEGMYGWITVNYLMGNFLEKNIWRAWVRPDGAETTGALDLGGASTQISFLPEKSEQNPNSTVEVTLYGYLYNVYTQSFQCYGRDEAEKRLLASLAQDPKLKFYENPCYPRNYMVNLTMEHTFGSLCTAQFRPANYDPSRVITFKGTGDPVLCSQKVSTLFNFAACQGKEDCSF-DGIYQPKVKGNFSAFAGFYYTTSALNLTGYFQL----NQFNLSMTSFCAKEWTQLPQILHRFDETYARSYCFSANFIYYLLVHGYKFDSETWLQINFQKEVGNSSIGWSLGYMLTLTNMIPAERRLIILPMSLSLFAGLLCLFTAISALCLIVLVILFMRKRGNH 500          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Match: foxc2 (forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382])

HSP 1 Score: 132.109 bits (331), Expect = 1.820e-32
Identity = 121/422 (28.67%), Postives = 185/422 (43.84%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNE----DLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNT-IGKN---------STIRKDRFSTFGVLDLGGSSTQIAFETKTG-----DPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN--CFLKGTPTTMPEDS-YTCRSENSRGIDLS---TFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKYNSFVQATGL---FCTEDYATLDAKYGKDA-KFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPN 1478
            +G+V DAGS  T  YLY+W     N    + +  +C      I  + +        L  C+  +L  + A + +  P+ L ATAGMR+L IEN T T+++F+EI         +F+   IL G  EG  GW TVNYL  T +G +         S +      TFG +DLGG+STQ+ F+  TG     D  +   L+   Y +Y+ SYLCYG +    R L   L   +S  V   C+ KG    +   S +      S   DLS   T +    P   +C   I      +    + D     V            + +Y       +T +  S  +A G    FC+ D+ATL   +  ++ K    YC  G +I+ +L   Y  ++  ++ + F+ +    + GW LGYM+  T  IP+
Sbjct:   12 YGMVFDAGSSHTTLYLYQWPANKENDTGIIRQAYSCDVQGPGISSYADTPSGAAASLQPCMDQVLSVIPAAQQRQTPVLLGATAGMRLLRIENATKTQLIFDEISKTLGGYPVDFRGARILTGSEEGSLGWVTVNYLLGTFVGVSRSGVHTYLGSWVHPTGGQTFGAMDLGGASTQMTFQ-PTGAIQDKDTEMFFRLYGYNYTIYTHSYLCYGQDQVFKRLLANILQGWSSGLVAHPCYAKGYRANISLASVFNSPCVPSGPADLSVNVTVEGTGDPT--ECHRAIGNVFNFSACQSKADCSFDGVYQPPAQGEFYAFSAFYYTFSFLNLTSR-QSLSEANGTVWNFCSSDWATLTGSFPLESRKRLLEYCSSGMYILTLLLDGYKFDSQTWNKIYFSKQAGSMDIGWTLGYMLNLTNMIPS 429          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 132.109 bits (331), Expect = 2.231e-32
Identity = 112/414 (27.05%), Postives = 179/414 (43.24%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAV-----KFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRK-----DRFSTFGVLDLGGSSTQIAFETK-------TGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV--NCFLKG---TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---------FCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQM-YGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    V +I  C  +   I  + +        ++  + K R V     + + P+YL ATAGMR+L + N T+ + + + +++      ++F+   I+ G  EG  GW T+NYL     ++S   K         T G LDLGG+STQI FE+K             L+ + Y +Y+ S+LCYG +      +  ++ DAT S +   CF  G     +T    S  C S+       ST       N   C+  + +AI               V            + YY +    N   +   L          C+  +  +   + K   K+   YC  G +I+ L +  YG ++ N++++ F  KI+  + GW LGYM+  T  IP
Sbjct:   49 YGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMNKARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLRSFPFDFQGARIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNFKPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQALRLQIANSIKDATDSILLDPCFNSGYRRNASTNDLYSSPCISKLRIPTAPSTLDIRGTGNYQLCKRNV-QAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVERHCSRPWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIP 461          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Match: n4bp2l1 (NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc:XB-GENE-1001194])

HSP 1 Score: 132.109 bits (331), Expect = 2.422e-32
Identity = 112/414 (27.05%), Postives = 179/414 (43.24%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAV-----KFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRK-----DRFSTFGVLDLGGSSTQIAFETK-------TGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV--NCFLKG---TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---------FCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQM-YGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    V +I  C  +   I  + +        ++  + K R V     + + P+YL ATAGMR+L + N T+ + + + +++      ++F+   I+ G  EG  GW T+NYL     ++S   K         T G LDLGG+STQI FE+K             L+ + Y +Y+ S+LCYG +      +  ++ DAT S +   CF  G     +T    S  C S+       ST       N   C+  + +AI               V            + YY +    N   +   L          C+  +  +   + K   K+   YC  G +I+ L +  YG ++ N++++ F  KI+  + GW LGYM+  T  IP
Sbjct:   47 YGIVLDAGSSHTSVYIYEWPAEKENDTGVVQQINECKVEGNGISSYGHEPLKAGLSLQKCMNKARQVIPEKQQRETPVYLGATAGMRLLRLTNATMAEEVLSSVENTLRSFPFDFQGARIITGQEEGAYGWITINYLLGNFIQDSGWFKYIPNFKPTETSGALDLGGASTQITFESKREIESQENSLHFRLYGKSYDIYTHSFLCYGKDQALRLQIANSIKDATDSILLDPCFNSGYRRNASTNDLYSSPCISKLRIPTAPSTLDIRGTGNYQLCKRNV-QAIFNRTHCTYSHCSFNGVFQPSLDGTFGAFSAYYFVMNFLNLTNEQMSLDKVKETVERHCSRPWDEVKKDFPKIKEKYLSEYCFSGTYILNLLEYGYGFSSENWNDIRFLGKIKDSDAGWTLGYMLNLTNMIP 459          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Match: Entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:MGI Symbol;Acc:MGI:1321386])

HSP 1 Score: 145.976 bits (367), Expect = 4.281e-37
Identity = 119/420 (28.33%), Postives = 188/420 (44.76%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPP--------IYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNY-LKNTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF------ETKTGD--PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN----CFLKGTPT--TMPEDSYTCRSENSRGIDLSTFKKFYRPNAAD---CRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKYN--SFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +G+V+DAGS  T  Y+Y+W  E  N    VS+   C      I  ++N  +D  K  +  +LK   VK + P        IYL ATAGMR+L ++N+T  + +   I+S F    ++F+   I+ G  EG+ GW T NY + N + KN     +      T G LDLGG+STQI+F      E    D   V L+   Y LY+ S+ CYG N    ++L   LL + S+E N    C+ +G  T  T+     +  +E  R    ++ K        D   CR ++A     N    Q       +              +Y       ++G ++  SF  ++  FC   ++ L A   + D  +A++YC   ++I  +L   Y      +  + F  ++   +  W+LGYM+  T  IP
Sbjct:   57 YGVVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFRCSVKGSGISSYENNPQDAPKAFEDCILK---VKEQVPEHLHGSTRIYLGATAGMRLLRLQNETAAREVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYIMGNFLEKNLWHMWVHPHGVDTTGALDLGGASTQISFVAGEKMEPNASDTVQVSLYGYTYTLYTHSFQCYGQNEAEKKFL-AMLLQSPSTEANISNPCYPQGYSTAFTLGHVFGSLCTEKQRPESYNSSKSVTFMGTGDPRLCREKVASVFDFNACQEQDACSFDGIYQPKVQGPFVAFAGFYYTASALNLSGSFSLTSFNDSSWDFCRHTWSELPALLSRFDETYARSYCFSAHYIYHLLVNGYKFTEETWPQIRFEKEVGNSSIAWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Match: Entpd2 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:MGI Symbol;Acc:MGI:1096863])

HSP 1 Score: 132.109 bits (331), Expect = 1.745e-32
Identity = 115/424 (27.12%), Postives = 178/424 (41.98%), Query Frame = 3
Query:  324 AENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQN----RNEDLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIR---KDRFSTFGVLDLGGSSTQIAFET--KTGDP-----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKG------------TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDK-KMRXXXXXXXXXXXXXLTKYYRM-----------TGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            A  +GIV+DAGS  T  ++YKW  +  N    V +  +C      I  + N      + L++C++  L  +   ++   P+YL ATAGMR+L + +   T  +   +        ++F+   IL G  EG+ GW T NYL     K   +    + R  T G +DLGG+STQI FET   + DP     + L+ + Y +Y+ S+LCYG +    R L + L         C+ KG            +P TM +   T  S  +  +  ++       NAA CR+ ++     N+      +     V     A      + +Y              G       AT   C + +A L A+         +YC V  FI  +L + Y  +  +F  V+F  K      GW LGYM+  T  IP
Sbjct:   37 ALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECLEQALRDVPKDRYASTPLYLGATAGMRLLNLTSPEATAKVLEAVTQTLTRYPFDFRGARILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASAL--QIHRFHPCWPKGYSTQVLLREVYQSPCTMGQRPQTFNSSATVSLSGTS-------NAALCRDLVSGLF--NISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLKTVMGLPVGTLKQLEDATETTCNQTWAELQARVPGQQTRLPDYCAVAMFIHQLLSRGYRFDERSFRGVVFEKKAADTAVGWALGYMLNLTNLIP 449          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Match: Entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:MGI Symbol;Acc:MGI:102805])

HSP 1 Score: 117.857 bits (294), Expect = 1.261e-27
Identity = 109/436 (25.00%), Postives = 176/436 (40.37%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED----LMKCIK-SLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI-----RKDRFSTFGVLDLGGSSTQIAFETKTGD--------PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN--CF------------LKGTPTT------MPEDSYTCRS----ENSRGIDLSTFKKFYRPNAADCRNQI--------AKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  +  + ++    L +C++ S  L   +   + P+YL ATAGMR+L +E++     +   + +      ++F+   I+ G  EG  GW T+NYL     +  +         +  TFG LDLGG+STQI F  +              L+   Y +Y+ S+LCYG +    + L   +  ++   +   CF            L GTP T      +P D +  +     E      L  F   + P +    N +          A      V+   KK+              +    +MT    +F   +       Y ++  KY  +  F+      G +I+ L Q Y    S+++ + F  KI+  N GW LGYM+  T  IP  +  
Sbjct:   49 YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKV----------AKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFS------GAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPL 468          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Match: Entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:MGI Symbol;Acc:MGI:102805])

HSP 1 Score: 103.219 bits (256), Expect = 5.807e-24
Identity = 71/241 (29.46%), Postives = 113/241 (46.89%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED----LMKCIK-SLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI-----RKDRFSTFGVLDLGGSSTQIAFETKTG---DP-----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMP 1001
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  +  + ++    L +C++ S  L   +   + P+YL ATAGMR+L +E++     +   + +      ++F+   I+ G  EG  GW T+NYL     +  +         +  TFG LDLGG+STQI F  +      P       L+   Y +Y+ S+LCYG +    + L    + A S+  +  L+  P   P
Sbjct:   49 YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKD-IQAISNPGHWRLRTVPPEHP 288          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Match: Entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:MGI Symbol;Acc:MGI:102805])

HSP 1 Score: 102.064 bits (253), Expect = 2.207e-22
Identity = 64/208 (30.77%), Postives = 100/208 (48.08%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED----LMKCIK-SLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI-----RKDRFSTFGVLDLGGSSTQIAFETKTGD--------PVILFTRKYLLYSRSYLCYG 902
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  +  + ++    L +C++ S  L   +   + P+YL ATAGMR+L +E++     +   + +      ++F+   I+ G  EG  GW T+NYL     +  +         +  TFG LDLGG+STQI F  +              L+   Y +Y+ S+LCYG
Sbjct:   78 YGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYG 285          

HSP 2 Score: 55.0694 bits (131), Expect = 1.964e-7
Identity = 25/79 (31.65%), Postives = 38/79 (48.10%), Query Frame = 3
Query: 1257 FCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            FC++ +      Y     K+   YC  G +I+ L Q Y    S+++ + F  KI+  N GW LGYM+  T  IP  +  
Sbjct:  419 FCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPL 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Match: sp|O75355|ENTP3_HUMAN (Ectonucleoside triphosphate diphosphohydrolase 3 OS=Homo sapiens OX=9606 GN=ENTPD3 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 8.490e-34
Identity = 116/423 (27.42%), Postives = 186/423 (43.97%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLK-NTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF------ETKTGD--PVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPED---SYTC------------RSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKY--NSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLF-QMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    VS+   C      I  + N  +D+ +  +  + K++      +    PI+L ATAGMR+L ++N+T    +   I+S F    ++F+   I+ G  EG+ GW T NYL  N + KN     +      T G LDLGG+STQI+F      +  T D   V L+   Y LY+ S+ CYG N    ++L   L ++ +         T    P D   S+T             R E+    D+ TF+    P+   C+ ++A          Q       V              +Y       ++G +  ++F  +T  FC+++++ L     K D  +A++YC   N+I  LF   Y      +  + F  ++   +  W+LGYM+  T  IP
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKN-----HLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSL--CKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Match: sp|Q9MYU4|ENTP1_PIG (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Sus scrofa OX=9823 GN=ENTPD1 PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.846e-32
Identity = 121/451 (26.83%), Postives = 195/451 (43.24%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKP-----PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTI------RKDRFSTFGVLDLGGSSTQIAFETKTGDPVI----------LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSS-EVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAAD---CRNQIAKAIGK--------NVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQAT-GLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSR--AFKLNXXXXXXXXXXCLLYITIAICIFLF 1571
            FGIV+DAGS  T  Y+YKW  E  N    VS++  C      I  F  +  ++   +++ + + R V  K      P+YL ATAGMR+L ++N+ L   + + +        ++F+   I+ G  EG  GW T+NYL +   + S        + D   T+G LDLGG+STQI F  +  + V+          L+ + Y +Y+ S+LCYG +   ++ LT  L +   +    CF  G    M            R +    F +       D   C+  I              + D + +       A     YY           G + S V +T   FC+  +A L   +G    K+   YC  G +I+ +L   Y   A  + N+ F  K++  + GW LGYM+  T  IP+    + +L+   +V  +++  L + I + I LF
Sbjct:   49 FGIVLDAGSSHTSLYIYKWPAEKENDTGVVSQVEECKLKGPGISEFAKKLGEIDIYLEACMERARTVVPKSQHAETPVYLGATAGMRLLRMKNENLASKILSTVAESITRYPFDFQGARIITGQEEGAYGWITINYLLDKFIQKSGWFNLKPRKGDTQETYGALDLGGASTQITFVPQ--NQVLESPENTLHFRLYGKNYSVYTHSFLCYGKDQALLQKLTKDLKNTNGTIHEPCFHSGYQRRMNVSHLYEAPCTRRFLTSLPFPELEIQGTGDFQKCQQSIRPLFNTSYCPYSRCSFDGVFLPLPQGDFAAFSAFYYVMGFLNLTSEEGSFQSKVTSTLEAFCSRPWAELQMYFGDVKEKYLSEYCFSGTYILTLLLSGYHFTAETWKNIHFMGKVQSTSVGWTLGYMLNLTNMIPSEEPSSTRLSHSTYVFLMVLFSLILVIVVIIGLF 497          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Match: sp|O55026|ENTP2_MOUSE (Ectonucleoside triphosphate diphosphohydrolase 2 OS=Mus musculus OX=10090 GN=Entpd2 PE=1 SV=2)

HSP 1 Score: 132.109 bits (331), Expect = 1.220e-31
Identity = 115/424 (27.12%), Postives = 178/424 (41.98%), Query Frame = 3
Query:  324 AENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQN----RNEDLMKCIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIR---KDRFSTFGVLDLGGSSTQIAFET--KTGDP-----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKG------------TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDK-KMRXXXXXXXXXXXXXLTKYYRM-----------TGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            A  +GIV+DAGS  T  ++YKW  +  N    V +  +C      I  + N      + L++C++  L  +   ++   P+YL ATAGMR+L + +   T  +   +        ++F+   IL G  EG+ GW T NYL     K   +    + R  T G +DLGG+STQI FET   + DP     + L+ + Y +Y+ S+LCYG +    R L + L         C+ KG            +P TM +   T  S  +  +  ++       NAA CR+ ++     N+      +     V     A      + +Y              G       AT   C + +A L A+         +YC V  FI  +L + Y  +  +F  V+F  K      GW LGYM+  T  IP
Sbjct:   37 ALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVRGGGISSYANDPSRAGQSLVECLEQALRDVPKDRYASTPLYLGATAGMRLLNLTSPEATAKVLEAVTQTLTRYPFDFRGARILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPDNEVHLRLYGQHYRVYTHSFLCYGRDQVLQRLLASAL--QIHRFHPCWPKGYSTQVLLREVYQSPCTMGQRPQTFNSSATVSLSGTS-------NAALCRDLVSGLF--NISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLKTVMGLPVGTLKQLEDATETTCNQTWAELQARVPGQQTRLPDYCAVAMFIHQLLSRGYRFDERSFRGVVFEKKAADTAVGWALGYMLNLTNLIP 449          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Match: sp|O35795|ENTP2_RAT (Ectonucleoside triphosphate diphosphohydrolase 2 OS=Rattus norvegicus OX=10116 GN=Entpd2 PE=1 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.670e-31
Identity = 119/416 (28.61%), Postives = 184/416 (44.23%), Query Frame = 3
Query:  324 AENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQN----RNEDLMKCIKSLLLKL-RAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIR---KDRFSTFGVLDLGGSSTQIAFET--KTGDP-----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPT-TMPEDSYTC---RSENSRGIDLSTFKKFY-RPNAADCRNQIAKAIGKNV---------DVIQVDKKMRXXXXXXXXXXXXXLTKYYRM-TGKYNSFVQATGLFCTEDYATLDAKY-GKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            A  +GIV+DAGS  T  ++YKW  +  N    V +  +C      I  + N      + L++C++  L  + R      P+YL ATAGMR   + +   T  +   +        ++F+   IL G  EG+ GW T NYL     K   +    + R  T G +DLGG+STQI FET   + DP     + L+ + Y +Y+ S+LCYG +   +R L + L         C+ KG  T  + ++ Y       +  R  + S         NA  CR+ +++    +           V Q      F+A + F Y   FLT    +  G      +AT + C + +  L A+  G+  + A +YC V  FI  +L + Y  +  +F  V+F  K      GW LGYM+  T  IP
Sbjct:   37 ALKYGIVLDAGSSHTSMFVYKWPADKENDTGIVGQHSSCDVQGGGISSYANDPSKAGQSLVRCLEQALRDVPRDRHASTPLYLGATAGMRPFNLTSPEATARVLEAVTQTLTQYPFDFRGARILSGQDEGVFGWVTANYLLENFIKYGWVGRWIRPRKGTLGAMDLGGASTQITFETTSPSEDPGNEVHLRLYGQHYRVYTHSFLCYGRDQILLRLLASAL--QIHRFHPCWPKGYSTQVLLQEVYQSPCTMGQRPRAFNGSAIVSLSGTSNATLCRDLVSRLFNISSCPFSQCSFNGVFQPPVAGNFIAFSAFYYTVDFLTTVMGLPVGTLKQLEEATEITCNQTWTELQARVPGQKTRLA-DYCAVAMFIHQLLSRGYHFDERSFREVVFQKKAADTAVGWALGYMLNLTNLIP 449          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Match: sp|P49961|ENTP1_HUMAN (Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.626e-31
Identity = 120/436 (27.52%), Postives = 191/436 (43.81%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYF-QNRNE------DLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRF-----------STFGVLDLGGSSTQIAF-----ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV---NCFLKGTPTTM-PEDSY--TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAI-------------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGL---FCTEDYATLDAKY-GKDAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAF 1490
            +GIV+DAGS  T  Y+YKW  E  N    V ++  C      I  F Q  NE      D M+  + ++   R+   + P+YL ATAGMR+L +E++ L   + + ++       ++F+   I+ G  EG  GW T+NYL   +GK S  +K R+            TFG LDLGG+STQ+ F       ++ D  +   L+ + Y +Y+ S+LCYG +    + L    +   S+E+    CF  G    +   D Y   C       +    F+     N   C   I +               G  +  +Q D                F+ K+  +T +  S  + T +   FC + +  +   Y G   K+   YC  G +I+ +L Q Y   A +++++ F  KI+G + GW LGYM+  T  IP  +  
Sbjct:   49 YGIVLDAGSSHTSLYIYKWPAEKENDTGVVHQVEECRVKGPGISKFVQKVNEIGIYLTDCMERAREVIP--RSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPFDFQGARIITGQEEGAYGWITINYL---LGKFS--QKTRWFSIVPYETNNQETFGALDLGGASTQVTFVPQNQTIESPDNALQFRLYGKDYNVYTHSFLCYGKDQALWQKLAKD-IQVASNEILRDPCFHPGYKKVVNVSDLYKTPCTKRFEMTLPFQQFEIQGIGNYQQCHQSILELFNTSYCPYSQCAFNGIFLPPLQGD--------FGAFSAFYFVMKFLNLTSEKVSQEKVTEMMKKFCAQPWEEIKTSYAGVKEKYLSEYCFSGTYILSLLLQGYHFTADSWEHIHFIGKIQGSDAGWTLGYMLNLTNMIPAEQPL 468          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Match: A0A443QZF5 (Ectonucleoside triphosphate diphosphohydrolase 2-like protein (Fragment) OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_00573 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 7.901e-38
Identity = 127/424 (29.95%), Postives = 198/424 (46.70%), Query Frame = 3
Query:  330 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED--------LMKCIKSL--LLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVG-----ILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFE-------TKTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEV----NCFLKGTPTTMPEDSYT---CRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMR-----XXXXXXXXXXXXXLTKYYRMTGKYNSFVQATG-----------LFCTEDYATLDAKYGKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQT 1463
            ++GIVIDAGS  +   L+KW  ++TN    V E+ +C   +       + NED        L+KC+K++   + L   K   P+Y  ATAGMRIL++   +L + + N IK  F  L  N K +      I+ G  EG+  W +VNYL   I   +   + R  T G+LD+GG+S QIA+E       T   + V+LF  +Y + + S LC+G +    RYL T +   +SS+      C  +    T+     +   C   +S GI L +    Y    +  R + +KAI K VDV +  K  +                  ++ YY  T   NSF  A             L+C+  +A +        +F  +YC + N+I + L ++Y  +   F+N+IF  ++ GQ+  W+LGYMI  T
Sbjct:   33 DYGIVIDAGSARSEVSLFKWLGDHTNRTGVVFEVTDCETHE-----GIDDNEDNVKPTINHLVKCVKTISQFIDLDK-KSVTPLYFGATAGMRILQVGKPSLAEFIINSIKKAFAKLKVNGKVISARDIRIIPGKEEGVFSWISVNYLLKNIAPLAG-GEMRNRTVGILDMGGASAQIAYEVSNTTARTAEEEDVVLFGTEYRVLADSNLCFGKDEALKRYLVTLIQSHSSSDSIITDPCLQEDAQRTIHGSELSKSACLHSSSPGIKLFSHDIAYLFKGSAKRRECSKAIEKVVDVEECRKTFKYCIKVRSNPPPRDMLFYAISNYYFATS--NSFPSAHNVSAKEFQANIQLWCSRKWADIVDNVKYPLRFVIDYCFLLNYIYVTLTKVYKFDELLFENIIFQKRVDGQSISWSLGYMINST 447          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Match: A0A4W3J2C4 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=entpd8 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.491e-34
Identity = 125/427 (29.27%), Postives = 190/427 (44.50%), Query Frame = 3
Query:  324 AENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQIL-YFQN---RNEDLMKCIKSLLLKLRAVKFKPPI-YLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVG--ILKGYYEGISGWTTVNYLKNTIGKNS----TIRKDRFSTFGVLDLGGSSTQIAF------ETKTGDPVI-LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSS---EVNCFLKGTPTTMPEDSY---TCRSENSR----GIDLSTFKKFYRPNAADCRNQIAKAI------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFV---QATGLFCTEDYATLDAKYGKD-AKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRA 1487
              N+G+V DAGS  T  +LY W  +  N    VS++ +C  +   I  Y +N     E L  C+ ++   +     K  I YL ATAGMR+L+I+N+T + ++  E+     +  + FKF G  I+ G  EG  GWTT+NYL N+  K S        +  +  G LDLGG+STQI F      E KT D    L+   Y++Y+ SYLCYG   F+ +++   L     +   E+ C+LKG  + M  DS     C S+       G  +       +P   +CR  +          G          +              +   ++ +T    S     +    FC+ ++  + A Y K   K+ QNYCL    I  +L   Y  ++  ++N+IF  K      GW LGYM+  T  IP+  A
Sbjct:   26 GHNYGMVFDAGSTHTSIFLYHWPADEQNGTGIVSQLHHCEVNGPGISGYAENPPKAGESLRPCLDNVSSYIPVESQKETIIYLGATAGMRLLKIQNETKSDMILEEVSKT--IKSYPFKFQGARIISGMEEGAYGWTTINYLLNSFIKYSFDGKWTHPESANIHGALDLGGASTQITFTPKESIEDKTTDVRFKLYGYNYIIYTHSYLCYGQQHFKKKHIAMQLQGKNLTDLIEIPCYLKGFKSNMTLDSIFDSPCTSDQKPLPYDGTQIIALVGTGKP--GECREAVKTLFNFTACGGSQTCAFDGVYQPPINGPFFAFSAFFYTFDFFNLTSGNPSLSTVNKTIKEFCSREWQEVKASYPKQKVKYLQNYCLSATQIYTLLVDAYNFDSRTWNNIIFQQKADNTEIGWTLGYMLNLTNIIPSEIA 448          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Match: A0A5E4AJ84 (Uncharacterized protein OS=Marmota monax OX=9995 GN=MONAX_5E044841 PE=3 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.516e-34
Identity = 120/417 (28.78%), Postives = 185/417 (44.36%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNY-LKNTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF--ETKTG------DPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN----CFLKGTPTTMPE----DSYTCRSENSRGIDLSTFKKFY-RPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKY--NSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    VS+   C      I  + N  +D  K  +  +LK++      +     IYL ATAGMR+L ++N+T    +   I+S F    ++F+   I+ G  EG+ GW T NY + N + KN     +      T G LDLGG+STQI+F  E K G        V L+   Y LY+ S+ CYG N    R+L   LL  + +E N    C+ +   TT       DS     +     D ++   F    N + CR ++A          Q                      +Y       ++G +  +SF  +T  FC++D++ L     K D  +A++YC   ++I  +L   Y      +  + F  ++   + GW+LGYM+  T  IP
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDAPKAFEDCMLKVKGQVPEHLHGSTRIYLGATAGMRLLRLQNETAANEVLASIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYIMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAEEKMGLNISDIVQVSLYGYTYTLYTHSFQCYGRNEAEKRFL-AMLLQNSPTETNLTNPCYPRNYSTTFTVDHVFDSLCTEKQRPTSYDPNSLITFEGTGNPSLCREKVASIFDFKACHDQEGCSFDGTYQPKVQGPFVAFAGFYYTASALNLSGSFSLDSFNSSTWNFCSQDWSELPFLLPKFDEVYARSYCFSAHYIYHLLINGYKFTEETWPRIRFEKEVGNSSIGWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Match: M3ZEV6 (Ectonucleoside triphosphate diphosphohydrolase 3 OS=Xiphophorus maculatus OX=8083 PE=3 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.250e-34
Identity = 118/422 (27.96%), Postives = 193/422 (45.73%), Query Frame = 3
Query:  318 DHAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMK-------CIKSLLLKLRAVKFKP-PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGK----NSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDP------VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSE--VN-CFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCR--NQIAKAI-------GKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYN--SFVQATGLFCTEDYATLDA-KYGKDAKFAQNYCLVGNFIIVLF-QMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNS 1481
            ++   FGIVID+GS  +  YLY+W  E  N    V+E  NC  + L I   +  ++D  K       C+  +   +   K K  P++L ATAGMR+LE++++     +  +++       + F    I+ G  EG+ GW TVNYLK    +    N+ IR +   T G +DLGG+STQIAF+ +          V L+   Y +Y+ S+LCYG N    R L   + +++     +N C+ +G   T    S        +  + ++ ++FY    +D     QI K+I        K      V++        +      F+ +     GK +   F  A G FC  D+A L   K+     + + YC   ++++ L    Y  +   + N+ F  KI+  N GW+LGYM+  +  IP+ 
Sbjct:   41 EYGLEFGIVIDSGSSRSNVYLYEWPGEKENETGVVTERKNCKVNGLPISELEVSSKDDKKTFEGFQYCMDEIKNHIPEEKHKTTPLFLGATAGMRLLEMKDQERASKIMGKLRDFLSKQNFQFHNASIITGQEEGLYGWITVNYLKENFLQKNMWNTYIRPNGAETVGSMDLGGASTQIAFQVQERGEGPDYMHVKLYGYPYTVYTHSFLCYGKNEADKRVLDKVIRESSDPAYIINPCYPRGFNITTKASSIYDTECIPKPKNYNSGQEFYMVGGSDSEKCGQIVKSIFNFQNCPSKQCSFNGVEQP-PVTGDFMAYAGFYFIARALEQGGKSDLGQFNIAVGNFCNTDWAKLKVQKHWISDTYLKTYCFASHYVLTLLADGYKFDNETWKNIHFEQKIKETNIGWSLGYMLSMSNMIPSE 461          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Match: I3ME34 (Ectonucleoside triphosphate diphosphohydrolase 3 OS=Ictidomys tridecemlineatus OX=43179 GN=ENTPD3 PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 2.388e-34
Identity = 119/417 (28.54%), Postives = 185/417 (44.36%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRA-----VKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNY-LKNTIGKN---STIRKDRFSTFGVLDLGGSSTQIAF--ETKTG------DPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVN----CFLKGTPTTMPE----DSYTCRSENSRGIDLSTFKKFY-RPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYY------RMTGKY--NSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    VS+   C      I  + N  +D  K  +  +LK++      +     IYL ATAGMR+L ++N+T    +   I++ F    ++F+   I+ G  EG+ GW + NY + N + KN     +      T G LDLGG+STQI+F  E K G        V L+   Y LY+ S+ CYG N    R+L   LL  + +E N    C+ +   TT       DS     +     D S+   F    N + CR ++A          Q                      +Y       ++G +  +SF  +T  FC++D++ L     K D  +A++YC   ++I  +L   Y      +  + F  ++   + GW+LGYM+  T  IP
Sbjct:   57 YGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDAPKAFEDCMLKVKGQVPEHLHGSTRIYLGATAGMRLLRLQNETAANEVLASIQNYFKSQPFDFRGAQIISGQEEGVYGWISANYIMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAEEKMGLNISDIVQVSLYGYTYTLYTHSFQCYGRNEAEKRFL-AMLLQNSPTETNLTNPCYPRNYSTTFTVDHIFDSLCTEKQRPTSYDPSSLITFEGTGNPSLCREKVASIFDIKACHDQEGCSFDGTYQPKVQGPFVAFAGFYYTASALNLSGSFSLDSFNSSTWNFCSQDWSELPFLLPKFDEVYARSYCFSAHYIYHLLINGYKFTEETWPQIRFEKEVGNSSIGWSLGYMLSLTNQIP 472          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 127.487 bits (319), Expect = 4.559e-31
Identity = 108/418 (25.84%), Postives = 179/418 (42.82%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAV-----KFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAF----ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMF-------RIRYLTTTLLDATSSEVNCFLKG----------------TPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGK-DAKFAQNYCLVGNFIIVLFQ-MYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    V ++  C    + I  +          +KS + K R++       + P+YL ATAGMR+LE++N   ++ +   ++ +     ++++   I+ G  EG  GW TVNYL  ++ + S        T G LDLGG+STQI F    + ++ D  I   L+   Y +Y+ S+LCYG +          IR + T   +    E  CF  G                T  + PE ++      +     +  +K +  N + C   I    G  +   +V+ +    +   F      LT     T   +   +  G +C   +  +   +     K+   YC  G +I+ L +  Y   + N+ ++ F  KI   + GW LGYM+  T  IP
Sbjct:   49 YGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCMDKARSIIPNHRHPETPVYLGATAGMRLLEMKNAAASEKVLESVERVLQTYPFSYQGARIISGQEEGAFGWITVNYLNESLRQAS-------GTLGALDLGGASTQITFVSGQKQESPDNSIDFRLYGHDYHVYTHSFLCYGKDQVLKLSLANEIRPVHTK-TETIVVEDPCFHPGYRMNKNFQSVFNSPCVTGLSYPEKNFVHMGSGNGTKCHAAVRKVF--NDSGCSYSICSFNG--IFQPRVEGQFGAFSAFFFVMDFLNLT-----TLSLDEAKEELGKYCATPWEIIKQNHPNVKEKYLAEYCFSGTYILTLLEDGYNFTSHNWQDIKFIKKIGNSDAGWTLGYMLNLTNMIP 449          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Match: entpd3 (ectonucleoside triphosphate diphosphohydrolase 3 [Source:NCBI gene;Acc:103030351])

HSP 1 Score: 120.939 bits (302), Expect = 8.262e-29
Identity = 87/242 (35.95%), Postives = 125/242 (51.65%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPP-------IYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLK-NTIGK---NSTIRKDRFSTFGVLDLGGSSTQIAF---ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATS-SEVN--CFLKGTPTTM 998
            +GIV+DAGS  T  YLY+W  E  N    VS+   C+     I      N+D  K +K+ +  +   K  PP       I+L ATAGMR+L I+N+  +  +  +I+     L +NF+   I+ G  EG+ GW TVNYL  N + K   N+ +      T G LDLGG+STQIAF   +  TG+ +I   L+  +Y +Y+ S+LCYG N    + L   +  +T  S VN  C+      TM
Sbjct:   61 YGIVLDAGSSRTTVYLYQWPAEKENNTGVVSQTTKCLVKGPGI---SEMNDDSWKYLKTCMDDI--TKHVPPSQHSSTPIFLGATAGMRLLHIKNEEASNTILQDIQKYLRSLPFNFQNASIISGQEEGLYGWITVNYLMGNFLEKNMWNAWVHPHGAKTVGSLDLGGASTQIAFTAPDDATGEDLIRVSLYGYEYNVYTHSFLCYGKNEAEKKVLAELVKSSTDWSRVNHPCYPADYSITM 297          

HSP 2 Score: 52.373 bits (124), Expect = 1.136e-6
Identity = 24/74 (32.43%), Postives = 41/74 (55.41%), Query Frame = 3
Query: 1257 FCTEDYATLDAKYGKDAKFAQNYCLVGNFI-IVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            FC++ +ATL   Y    K  ++YC   N++  +L   Y  N  N++N+ F  ++   +  W+LGYM+ Q+  IP
Sbjct:  397 FCSKPWATLKKNYEITEKHLKSYCYSANYVHTILADGYKFNDDNWENLNFQKEVNQTSIAWSLGYMLAQSNMIP 470          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:103024136])

HSP 1 Score: 112.849 bits (281), Expect = 2.759e-26
Identity = 76/224 (33.93%), Postives = 107/224 (47.77%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRN----EDLMKCIKSLLLKLRAVKF-KPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRK---DRFSTFGVLDLGGSSTQIAFETKTGDPVI-------LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSS 959
            +GIV+DAGS  T  ++YKW     N    VS+   C  D   I  +  +       L KC+   + K+  V+  + PIYL ATAGMR+L I    ++  +  E+        ++ K   IL G  EG  GW TVNYL     K   +         T G LD GG+STQI FETK     +       L+ R Y +Y++S+LCYG +   +R L   L++   S
Sbjct:   42 YGIVLDAGSSHTAMFIYKWPANKQNGTGIVSQHSECDVDGGGISSYAGQKGGAARSLEKCMDHAIQKIPKVRHHQTPIYLGATAGMRLLNISQPKVSDEILKEVGEKLKTYPFSVKGATILTGQEEGAYGWVTVNYLLENFIKYGFVGHWLSPGKKTVGALDFGGASTQITFETKEKVENVENLMKLRLYGRDYHIYTQSFLCYGRDQM-LRKLLAHLVETQGS 264          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:103029336])

HSP 1 Score: 112.849 bits (281), Expect = 2.890e-26
Identity = 66/202 (32.67%), Postives = 105/202 (51.98%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAV-----KFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAF----ETKTGDPVI---LFTRKYLLYSRSYLCYG 902
            +GIV+DAGS  T  Y+Y+W  E  N    V ++  C    + I  +          +KS + K R++       + P+YL ATAGMR+LE++N   ++ +   ++ +     ++++   I+ G  EG  GW TVNYL  ++ + S        T G LDLGG+STQI F    + ++ D  I   L+   Y +Y+ S+LCYG
Sbjct:   49 YGIVLDAGSSHTSVYIYQWPAEKENNTGMVQQMDACNVPGVGISGYSTEPNRAGDSLKSCMDKARSIIPNHRHPETPVYLGATAGMRLLEMKNAAASEKVLESVERVLQTYPFSYQGARIISGQEEGAFGWITVNYLNESLRQAS-------GTLGALDLGGASTQITFVSGQKQESPDNSIDFRLYGHDYHVYTHSFLCYG 243          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Match: entpd2a.1 (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:103024136])

HSP 1 Score: 112.079 bits (279), Expect = 7.968e-26
Identity = 76/224 (33.93%), Postives = 107/224 (47.77%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRN----EDLMKCIKSLLLKLRAVKF-KPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRK---DRFSTFGVLDLGGSSTQIAFETKTGDPVI-------LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSS 959
            +GIV+DAGS  T  ++YKW     N    VS+   C  D   I  +  +       L KC+   + K+  V+  + PIYL ATAGMR+L I    ++  +  E+        ++ K   IL G  EG  GW TVNYL     K   +         T G LD GG+STQI FETK     +       L+ R Y +Y++S+LCYG +   +R L   L++   S
Sbjct:   42 YGIVLDAGSSHTAMFIYKWPANKQNGTGIVSQHSECDVDGGGISSYAGQKGGAARSLEKCMDHAIQKIPKVRHHQTPIYLGATAGMRLLNISQPKVSDEILKEVGEKLKTYPFSVKGATILTGQEEGAYGWVTVNYLLENFIKYGFVGHWLSPGKKTVGALDFGGASTQITFETKEKVENVENLMKLRLYGRDYHIYTQSFLCYGRDQM-LRKLLAHLVETQGS 264          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003192.1 (pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 gene:ENSPMAG00000002913.1 transcript:ENSPMAT00000003192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 8.599e-25
Identity = 73/223 (32.74%), Postives = 116/223 (52.02%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYFQNRN-------EDLMKCI---KSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFST----FGVLDLGGSSTQIAFETK---TGDP----VILFTRKYLLYSRSYLCYGVNMFRIRYLTT 935
            +GIV+DAGS  T  ++Y+W  E  N    +++   C V D+L      + +       E L  C+   K+++ K R      P+ L ATAGMR+LE+ +    K + + ++ +     ++++   I+ G  EG  GW T NY      + + + K +++T     G LDLGG+STQI F T+    G P    + L+ RKY +YS SYLCYG +    R+L+T
Sbjct:   42 YGIVLDAGSSHTALFVYEWPAEKQNDTGVIAQRHLCDVDDELAGGGISSYSSSPSGAGESLRACMDKAKAIVPKDRWAD--TPLALGATAGMRLLEMSDSVAAKAVLSSVREVLGSYPFSYREGRIISGQEEGTYGWITANYFLYNFIQFTWLGKWQWTTSTKPIGALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLST 262          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008355.1 (pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 gene:ENSPMAG00000007537.1 transcript:ENSPMAT00000008355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 8.636e-23
Identity = 72/238 (30.25%), Postives = 112/238 (47.06%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPP-------IYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKN---STIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILFTRKYLLY-------SRSYLCYGVNMFRIRYLTTTLLDATSSEVN----CFLKG 983
            +G+V+DAGS  T  ++Y+W  +  N    V+++ +   +   I  +++  E   + +   L    A K  PP       I + ATAGMR+L  +N    + +   +K+      + F    IL G  EG  GW T+NYL+    +    S +R     T G LDLGG+STQIAF    G   +  T+++ LY       + SYLCYG +   +R   T     +SS+V     C+  G
Sbjct:    1 YGVVLDAGSSHTSLFVYQWPADKENDTGVVTQVAHIDVEGGGISSYKDHPEMAGQSLVPSLFN--ATKLVPPERHHETPISVGATAGMRLLRKQNPEAAERVMESVKTALRATPFLFCSARILTGQEEGAFGWVTINYLQGNFLQRDWLSWVRPRGAKTVGALDLGGASTQIAFVPAGG--ALSGTQRFRLYGYDHAVFTHSYLCYGKDEALMRVAATLSRGNSSSDVEVTFPCYHSG 234          

HSP 2 Score: 49.2914 bits (116), Expect = 1.748e-6
Identity = 25/78 (32.05%), Postives = 40/78 (51.28%), Query Frame = 3
Query: 1257 FCTEDYATLDAKYGKDAKFAQNYCLVGNFII-VLFQMYGINASNFDNVIFANKIRG----QNTGWNLGYMIKQTKDIP 1475
            FC + +  + A    + K  ++YC   N+++ +LF  Y  N S + N+ F  K+ G       GW LGYM+ +T  IP
Sbjct:  350 FCNKPWNEVRASSQTEQKHLKSYCFSANYLLQLLFHGYKFNLSTWMNIKFVKKVEGIQAIGEAGWALGYMLNETNLIP 427          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Sea Lamprey
Match: entpd6 (ectonucleoside triphosphate diphosphohydrolase 6 [Source:ZFIN;Acc:ZDB-GENE-050417-412])

HSP 1 Score: 69.3218 bits (168), Expect = 8.237e-13
Identity = 68/221 (30.77%), Postives = 104/221 (47.06%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDEN-TNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKP-------PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFK--FVGILKGYYEG-ISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAF-ETKTG------DPVI----LFTRKYLLYSRSYLCYGVNMFRIRYL 929
            +GI+ DAGS GTR +++ +   N  N  +  SE+   V   L    + +  E  ++ I+ LL K  A K  P       P+ L ATAG+R+L         V+  +++++F    +      V I+ G  EG IS W T+N+L   +      R      FG+LDLGG STQ+ F   K G      D  +    +F + + +YS SYL  G+   R+  L
Sbjct:   63 YGIMFDAGSTGTRIHVFIFKQLNKANLPELTSEVFLSVKPGLSA--YADHPEQSVQSIEELLAK--AKKAIPETQWQETPVVLRATAGLRLLPGRK---ADVLLEQVRNVFDRSPFKVPKNSVEIMDGANEGGISSWITINFLLGFL------RGPEDKLFGILDLGGGSTQVTFLPQKQGLLQSASDADVTSFKMFNKTFKIYSHSYLGLGLMSARLAIL 270          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007714.1 (pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-1 gene:ENSPMAG00000006963.1 transcript:ENSPMAT00000007714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.345e-9
Identity = 66/263 (25.10%), Postives = 109/263 (41.44%), Query Frame = 3
Query:  783 GVLDLGGSSTQIAFETK---TGDP----VILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATS-SEVN--------------CFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYN------SFVQATGLF---CTEDYATLDAK-YGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            G LDLGG+STQI F T+    G P    + L+ RKY +YS SYLCYG +    R+L+T    A+S + VN               F+  +P T   D+     + ++ +   TF+    P  A+C N I+ +I         +     V       +    + +Y     +N          AT  F   C + +  L ++ +  D+     Y      +     +Y  +  +++N+ F  +  G   GW LG+M+  T  +P
Sbjct:    1 GALDLGGASTQITFMTEEPLQGSPDSLTIQLYGRKYHVYSHSYLCYGRDQAIKRFLSTLYKKASSGAHVNNPCYPTLYSVAYNLSFIYDSPCT--SDARPANYDPNQSV---TFRGTANP--AECSNTIS-SIFNFSACSSPNCTFDGVWQPPVRGHFLAFSSFYHAMAAFNLTNPKPPLNDATNAFDYYCRKTWNELVSRSHPLDSNHCYCYRSTCKLLFSKVSIYNYDKESWENINFQKEAGGGELGWALGFMLNVTNMVP 255          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Yeast
Match: YND1 (Apyrase with wide substrate specificity; helps prevent inhibition of glycosylation by hydrolyzing nucleoside tri- and diphosphates that inhibit glycotransferases; partially redundant with Gda1p; mediates adenovirus E4orf4-induced toxicity [Source:SGD;Acc:S000000807])

HSP 1 Score: 83.1889 bits (204), Expect = 2.989e-17
Identity = 69/242 (28.51%), Postives = 111/242 (45.87%), Query Frame = 3
Query:  327 ENFGIVIDAGSGGTRAYLYKWYDENT---NTNDEVSEIGNCVADKLQ-----------ILYFQNRNEDLMKC-IKSLLLKLRAVKFKP-----PIYLAATAGMRIL--EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTG--------DPVILFTR-------KYLLYSRSYLCYGVNMFRIRYLTTTL 941
            + FGIVIDAGS G+R +++KW D  +    TN +   I   V    Q           +  F+ + +D  K  IK LL   + +  +      P+++ ATAGMR+L  +I++  L  +         +++      + ++ G  EG+ GW  +NYL       +    D F TFG +D+GG+STQIAF             D   +F R       K+ ++  ++L +G N  R RYL   +
Sbjct:    8 DRFGIVIDAGSSGSRIHVFKWQDTESLLHATNQDSQSILQSVPHIHQEKDWTFKLNPGLSSFEKKPQDAYKSHIKPLLDFAKNIIPESHWSSCPVFIQATAGMRLLPQDIQSSILDGLCQGLKHPAEFLVEDCSAQIQVIDGETEGLYGWLGLNYLYGHFNDYNPEVSDHF-TFGFMDMGGASTQIAFAPHDSGEIARHRDDIATIFLRSVNGDLQKWDVFVSTWLGFGANQARRRYLAQLI 248          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Yeast
Match: GDA1 (Guanosine diphosphatase located in the Golgi; involved in the transport of GDP-mannose into the Golgi lumen, converting GDP to GMP after mannose is transferred to substrates; null mutants are defective in sporulation and pre-meiotic S phase entry; orthologous to human ENTPD6, a meiosis-associated non-obstructive azoospermia (NOA) related gene identified in GWAS studies [Source:SGD;Acc:S000000768])

HSP 1 Score: 67.781 bits (164), Expect = 1.730e-12
Identity = 65/216 (30.09%), Postives = 98/216 (45.37%), Query Frame = 3
Query:  339 IVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILY--FQNRNEDLMKCIKSL--LLKLRAVKFKP-------PIYLAATAGMRIL-EIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFET------KTGDPVILFTRK-----YLLYSRSYLCYGVNMFR 917
            I+IDAGS G+R ++YK+        D  +     + +K  +L     + + D +    SL  LLK+ A+ + P       P+ + ATAG+R+L + ++  +   + + ++  +         V I+ G  EG+  W T NYL   IG N      +  T  V DLGG STQI FE       K  D    F  K     Y LY  S+L YG+   R
Sbjct:   95 IMIDAGSTGSRVHIYKF--------DVCTSPPTLLDEKFDMLEPGLSSFDTDSVGAANSLDPLLKV-AMNYVPIKARSCTPVAVKATAGLRLLGDAKSSKILSAVRDHLEKDYPFPVVEGDGVSIMGGDEEGVFAWITTNYLLGNIGANGP----KLPTAAVFDLGGGSTQIVFEPTFPINEKMVDGEHKFDLKFGDENYTLYQFSHLGYGLKEGR 297          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Nematostella
Match: EDO43911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX67])

HSP 1 Score: 74.7146 bits (182), Expect = 2.347e-14
Identity = 64/218 (29.36%), Postives = 104/218 (47.71%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQ--ILYFQNRNEDLMKCIKSLLLKLRAV-----KFKPPIYLAATAGMRILEIENKTLTKVMFNEI--------KSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVIL---FTRKYL-LYSRSYLCYGVNMFRIRYL 929
            + ++ DAGS GTR  +YK     T    +V+++     +K +  +  F      +   +++L+   + V     + + P+YL ATAGMR+L ++ K     + NE+        KS F     N K   ++ G  E    W TVN+L   +   S       + +GVLD+GG+STQ AF+T     + +    T+  L LY+ SYL YG    R R++
Sbjct:   30 YAVLFDAGSSGTRCKVYKLIQRQTLHVRDVTQLNVPKPNKAKPGLSSFGESPAGVGPYLQTLIEGAKKVVPVQYQAQTPVYLFATAGMRLLPVDQKI---AVINEVNNFLRDSKKSPFAFKKGNAK---VISGIDEATYDWVTVNFLMGALTGESD------TEYGVLDMGGASTQNAFDTNNTQHITVVLDLTKGMLPLYAHSYLGYGEQEARKRFI 235          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Nematostella
Match: EDO42571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S133])

HSP 1 Score: 70.8626 bits (172), Expect = 4.264e-14
Identity = 64/212 (30.19%), Postives = 103/212 (48.58%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQ--ILYFQNRNEDLMKCIKSLL-LKLRAV----KFKPPIYLAATAGMRILEIENKT-----LTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTI-GKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGD--PVILFTRKYL--LYSRSYLCYGVNMFR 917
            + ++ DAGS GTR  +YK    ++    +VS+I     +K    + +F +    +   ++ L+   + AV    + + P+Y+ ATAGMR+L     T     + +++ N  KS F     N K   ++ G  E I  W TVN+L   + G++ST        +G L++GG+S+Q AFE         IL  R     LY+ SYL YG +  R
Sbjct:    1 YAVMFDAGSSGTRCKVYKLQTRHSLRISDVSQIKVPKPNKATPGLSFFGDSPSGVGPYLQPLIDAAINAVPSQYQSQAPVYVFATAGMRLLPDNKATAVIRAVEQMLSNSSKSPFLFQTGNIK---VISGKDEAIYDWVTVNFLMGVLTGESST-------EYGALEMGGASSQNAFEVPVNQLHTAILNLRHGTRRLYAHSYLGYGESEAR 202          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 132.88 bits (333), Expect = 7.461e-33
Identity = 117/453 (25.83%), Postives = 198/453 (43.71%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYFQN---RNEDLMKCIKSLLLKLRAVKFKP--PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAF------ETKTGDPVI---LFTRKYLLYSRSYLCYGVNM-FRIRYLTTTLLDATSSEV--NCFLKGTPTTMPEDSY---TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYN---------SFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVL-FQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDI----PNSRAFKLNXXXXXXXXXXCLLYITIAICIFLFKMWER 1586
            +GIV+DAGS  T  Y+Y+W  E  N    V +  +C VA K    Y        E L+ C+K     +   K  P  P+YL ATAGMR+L++EN + +  +F  ++       ++++   +L G  EG  GW TVNYL + + +          T G LDLGG+STQI+F       +++ D  +   L+   Y LY+ S+LCYG +   R+     T +++  + +   CF KG   T    +     C S+    I   TF      N   C+ ++ K++               +            + Y+ +    N         + +Q    +C   +  +  ++    K+   YC  G +I+ L  + Y   +  + ++ +  KI+  + GW LGYM+  T  I    P+S        + VVTV+  LL++     + L+ +W +
Sbjct:   49 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLKEAKENIPQ-KMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPFSYQGARLLAGQEEGAFGWVTVNYLDDRLTQG-------LETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLALAHQTKVNSGPTAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQIVSETFIHLGGGNFTQCQ-EVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTVMQKLSDYCATPWTQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVI--FILILYSLWPK 490          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 129.413 bits (324), Expect = 9.976e-32
Identity = 122/458 (26.64%), Postives = 198/458 (43.23%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYFQN---RNEDLMKCIKSLLLKLRAVKFKP--PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNS------TIRKDRFSTFGVLDLGGSSTQIAF------ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSY---TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYN---------SFVQATGLFCTEDYATLDAKYGKDA--KFAQNYCLVGNFIIVL-FQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDI----PNSRAFKLNXXXXXXXXXXCLLYITIAICIFLFKMWER 1586
            +GIV+DAGS  T  Y+Y+W  E  N    V +  +C VA K    Y        E L+ C+K     +   K  P  P+YL ATAGMR+L++EN + +  +F  ++       ++++   +L G  EG  GW TVNYL + + + S      T      S  G LDLGG+STQI+F       +++ D  +   L+   Y LY+ S+LCYG    + + L   L   T+    CF KG   T    +     C S+    I   TF      N   C+ ++ K++               +            + Y+ +    N         + +Q    +C   +  + A +  D   K+   YC  G +I+ L  + Y   +  + ++ +  KI+  + GW LGYM+  T  I    P+S        + VVTV+  LL++     + L+ +W +
Sbjct:   29 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLKEAKENIPQ-KMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPFSYQGARLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTSVHGNESAKGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYG----KDQALRLALSGPTAIMDPCFHKGYNETKHYAAVYDSPCVSDQKPQIVSETFIHLGGGNFTQCQ-EVIKSVFNFTSCRYSRCSFNGIFQPPLQGQFGAFSAYFFVMNFLNLTDTSVPLKTVMQKLSDYCATPWTQVCAYFKHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKIKNSDAGWTLGYMLNLTNMIPAEAPDSPPLTYTSYVSVVTVMAILLFVI--FILILYSLWPK 478          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 117.857 bits (294), Expect = 7.325e-28
Identity = 110/409 (26.89%), Postives = 176/409 (43.03%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYFQN---RNEDLMKCIKSLLLKLRAVKFKP--PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIG-------KNSTIRKDR--FSTFGVLDLGGSSTQIAF------ETKTGDPVI---LFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSY---TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVL-FQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            +GIV+DAGS  T  Y+Y+W  E  N    V +  +C VA K    Y        E L+ C+K     +   K  P  P+YL ATAGMR+L++EN + +  +F  ++       ++++   +L G  EG  GW TVNYL + +        K +++  +     T G LDLGG+STQI+F       +++ D  +   L+   Y LY+ S+LCYG +        T ++D       CF KG   T    +     C S+    I   TF      N   C+  I     K+V      +  R     +F          + +      F+  +  F       +  ++    K+   YC  G +I+ L  + Y   +  + ++ +  K+   + GW LGYM+  T  IP
Sbjct:   31 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLKEAKENIPQ-KMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPFSYQGARLLAGQEEGAFGWVTVNYLDDRLTQVSMGGFKYTSVHGNESGLETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLSGPTAIMDP------CFHKGYNETKHYAAVYDSPCVSDQKPQIVSETFIHLGGGNFTQCQEVI-----KSVFNFTSCRYSRCSFNGIFQPPLQGQFGTFVLFIYTQRFLIISIHFSPSQRLQIKKEHDIPLKYLAEYCFSGTYILTLMMEGYNFTSETYSSIKYIQKVSC-DAGWTLGYMLNLTNMIP 426          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Match: entpd1 (ectonucleoside triphosphate diphosphohydrolase 1 [Source:NCBI gene;Acc:101166588])

HSP 1 Score: 112.079 bits (279), Expect = 4.707e-26
Identity = 78/233 (33.48%), Postives = 116/233 (49.79%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNC-VADKLQILYFQN---RNEDLMKCIKSLLLKLRAVKFKP--PIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAF------ETKTGDPVI---LFTRKYLLYSRSYLCYGVNM-FRIRYLTTTLLDATSSEVNCFLKG 983
            +GIV+DAGS  T  Y+Y+W  E  N    V +  +C VA K    Y        E L+ C+K     +   K  P  P+YL ATAGMR+L++EN + +  +F  ++       ++++   +L G  EG  GW TVNYL + + +          T G LDLGG+STQI+F       +++ D  +   L+   Y LY+ S+LCYG +   R+     T    T+    CF KG
Sbjct:   49 YGIVLDAGSSHTSLYIYQWPAEKDNNTGRVEQKHHCQVAGKGISSYTATPYKAGESLISCLKEAKENIPQ-KMHPETPLYLGATAGMRLLKLENSSASDEVFKAVEKTLRGFPFSYQGARLLAGQEEGAFGWVTVNYLDDRLTQG-------LETTGALDLGGASTQISFVSDEYNGSESPDNAVSFRLYGYDYTLYTHSFLCYGKDQALRLALAHQTKSGPTAIMDPCFHKG 273          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Match: entpd2b (ectonucleoside triphosphate diphosphohydrolase 2 [Source:NCBI gene;Acc:101169627])

HSP 1 Score: 111.694 bits (278), Expect = 1.176e-25
Identity = 72/215 (33.49%), Postives = 103/215 (47.91%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNR----NEDLMKCIKSLLLKLRAVKFK-PPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRK---DRFSTFGVLDLGGSSTQIAFET-------KTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLT 932
            +GIV+DAGS  T  ++Y+W  +  N    V++   C      I  +  +     E L+ C+   +  +   K +  P+YL ATAGMR+L I N   +  +  E+        + F+   IL G  EG  GW TVNYL     K   I +      +T G LDLGG+STQI F T       +    + L+  KY LY+ S+LCYG+N    R L 
Sbjct:   40 YGIVLDAGSSHTALFIYRWPADKQNGTGVVTQHAECHVQGEGISSYAGQKGEAGESLVACLDQAVRDIPKDKHQLTPVYLGATAGMRLLNISNPKQSDQILKEVGDKIKSYPFKFEGAAILSGQEEGAYGWVTVNYLLENFIKYGFIGRWMSPGRATVGALDLGGASTQITFATQERVEGKQNMMEMRLYGHKYSLYTHSFLCYGINQVYNRMLA 254          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Match: SMESG000010140.1 (SMESG000010140.1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 516/520 (99.23%), Postives = 517/520 (99.42%), Query Frame = 3
Query:   54 MYGKPNTKVNKPVPESSHVPTFKPKCKPKCEPASKQTCISHCTPNKTFVYKTCRHLFRKEKRRXXXXXXXXXXXXXXXXXXXXXXXXYDHAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAFKLNXXXXXXXXXXCLLYITIAICIFLFKMWERKQKIHNIRV 1613
            MYGKPNTKVNKPVPES HVPTFKPKCKPKCEPASK TCISHCTPNKTFVYKTCRHLFRKEKRRFIILLAIFVFCVVLLIIMIILISIYDHAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCV DKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNST+RKDRFSTFGVLDLGGSSTQIAFETKTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRFVAVAVFAYYNAFLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAFKLNVVIFVVTVIVCLLYITIAICIFLFKMWERKQKIHNIRV
Sbjct:    1 MYGKPNTKVNKPVPESPHVPTFKPKCKPKCEPASKPTCISHCTPNKTFVYKTCRHLFRKEKRRFIILLAIFVFCVVLLIIMIILISIYDHAENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVTDKLQILYFQNRNEDLMKCIKSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTVRKDRFSTFGVLDLGGSSTQIAFETKTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRFVAVAVFAYYNAFLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAFKLNVVIFVVTVIVCLLYITIAICIFLFKMWERKQKIHNIRV 520          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Match: SMESG000068450.1 (SMESG000068450.1)

HSP 1 Score: 134.035 bits (336), Expect = 4.025e-33
Identity = 126/439 (28.70%), Postives = 200/439 (45.56%), Query Frame = 3
Query:  330 NFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRN---EDLMKCIKSLLLKL--RAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFK----FVGILKGYYEGISGWTTVNYLKNTI--GKNSTIRKDRFSTFGVLDLGGSSTQIAFET----KTGDP-VILFTRKYLLYSRSYLCYGVNMFRIR---YLTTTLL-------DATSSEVNCFLKGTPT--------TMPEDSYTCRSEN-SRGIDLSTFKKFYRPNAADCRNQIAKAIGKNV-----------------DVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNS-FVQATGLFCTEDYATLDAKYGKDAKFAQNY----CLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIP 1475
            ++GI+IDAGS  T+ +L+KW +  T TN EV+++  C +      +  + N   + +  C+   ++ L  + ++ K  +YL ATAGMRI+E  N    +++F  ++      G   K     V I+ G  EG++ W T NYLK+T+   K ++    +  TFG LDLGG+STQI F +    ++G+  V L+   Y +YS SYLCYG +    R   +L+ T +         T  +  C LKG           T+P  S     +N    +DL    K    N          A  K V                 +V Q     +F+A A FA     L K ++   K N+ F+  +  +C+ +   +     +  +  +N+    C    ++  L   YG N  N+ ++ F N I   N GW+LGYMI +T  IP
Sbjct:   46 SYGIIIDAGSTSTKMFLFKWPEIATRTNGEVTQVKMCKSAPGISDFINDPNGAIDGIEMCLNDEMMPLIPKRLRTKSFVYLGATAGMRIIEYRNPKAMRLIFEVVERFLLSTGLKMKDGLRDVKIISGSVEGVAAWITTNYLKDTLQGDKVTSGFMSKKETFGALDLGGASTQITFVSNGTIESGNTKVRLYGENYNVYSHSYLCYGKSQAEYRLLAFLSKTWIANYNPNQPLTPIDNPCMLKGDTASYILQKIITIPCVSGNYSQQNFGTSVDLPDSLKNIVLNVTYVGTADPDACQKAVKNLFLQSPCSQTNCGFNNVYQPKITGKFIAFAGFALVYNQLVKVFKSPPKDNADFIAKSRDYCSRNAPPVVTPTTQKEREKENWRKWRCFGFIYVFELLSAYGFNNPNWHSITFTNTIYNANLGWSLGYMINKTSMIP 484          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Match: SMESG000064312.1 (SMESG000064312.1)

HSP 1 Score: 108.227 bits (269), Expect = 1.174e-24
Identity = 99/424 (23.35%), Postives = 180/424 (42.45%), Query Frame = 3
Query:  327 ENFGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCIKSLLLKLRAVKFK-PPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKT-GDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDATSSEVNCFLKGTPTTMPEDSY--TCRSENSRGIDLSTFKKFYRPNAADCRNQIAKAIGKNVDVIQVDKKMRXXXXXXXXXXXXXLTKYYRMTGKYNSFVQATGLFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIFANKIRGQNTGWNLGYMIKQTKDIPNSRAFKLNXXXXXXXXXXCLLYITIAICIFLFKMWER 1586
             N+ I++DA  G T+ +LYKW   +      +  I  C    L+I+Y     E +  C + L  K+     K PP++L +T   R  + ++   T      +K+      W    + +++     I  W T+N+  + I  +    K       +++    + QI    K   + V +  R   +++R+Y CYG      +Y    ++DA+  E NC    +P  +P++ +  TC  + SR +  ++      P+ + CR  +    G  +    +    +F  +A+       L   Y +    +S   AT   CTEDY  +  +Y  + ++A+ YC   N+   +F++ G +  NF  + F   +  +   W LGY+      IP      LN +I  + V +    +   I IF+F MW R
Sbjct:   73 HNYAIILDARIGRTQVFLYKWKQTSRANYSGIRMIDKCHTADLEIIYNNREIEKIFDCFQYLKSKIDIWYIKTPPVHLISTEPYRAYKNDSTDKTMKRMKYLKTNLVKSKWLVATMTVIEEKALAIHIWKTLNF--DIIMGDGNYSK----AISIVNYKEDNMQIVSAIKNQAEAVTINGRMLPIFARNYQCYGAYFVYEKY-RANVIDASKKEFNCLSSNSP--IPDNLFARTCWKDVSRTLPTTSNAV---PDPSKCRGDLQPIAGIIIKPGIIGVGQKFYGIALMGRVMNLLISLYGLGMSVDSVRVATTKLCTEDYLDMLRRYPNNPEYAKKYCFGANYASYVFELMGFDNENFKQIEFPKNLPIE---WTLGYISASAHFIPPYMFLLLNKIIGYILVTIFTATLFTMIVIFIFYMWTR 481          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Match: SMESG000051033.1 (SMESG000051033.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.532e-21
Identity = 66/214 (30.84%), Postives = 109/214 (50.93%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED---LMKCIKSLLLKLRAVKF--KPPIYLAATAGMRILEIENKTLT-KVMF---NEIKSLFYVLGWNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGD------PVILFTRKYLLYSRSYLCYGVNMFRIRYL 929
            + ++IDAGS  ++ YLY W       N +V ++  C AD     ++ N N+    +  C+ + ++ L   +   K  +YL ATAGMR+L + N   + ++M+   N +      +  +   + I+ G  EG+ GWTTVN+L   + KN   + +     G LD+GG+STQI F   + +       + L+   Y +YS SYLCYG +    R+L
Sbjct:  136 YSVIIDAGSTSSKIYLYYWESNKYINNADVLQVAMCKADPGISSFYTNPNKSYNGIKNCLDTKIIPLIPAEMRKKTFVYLGATAGMRMLSLNNPNASQQIMYFIRNSLTKSPLKVNNSISDIAIITGAQEGLYGWTTVNFLLKNLPKNIVKKPN---VIGALDMGGASTQITFIDNSPNNWTETIKLKLYGNSYSIYSHSYLCYGKSQAEYRFL 346          
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Match: SMESG000077431.1 (SMESG000077431.1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.247e-21
Identity = 70/218 (32.11%), Postives = 111/218 (50.92%), Query Frame = 3
Query:  333 FGIVIDAGSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNED--LMKCIKSLLLKLRAVKF------KPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLGWNFK--FVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGGSSTQIAFETKTGDPV------ILFTRKYLLYSRSYLCYGVNMFRIRYLTTT 938
            F +V+D GS GTR + +++     N  D      + ++ K+ +  F +   D  LM+ +   L      K         PIY+  TAG+R +   N+T++  + N I+S+ + L + FK  FVGIL    EGI  W +VN+L   + KN  +      T GVLDLGG STQ+AF T   + +      I+F ++Y +YS  Y   G++  RI+Y+  +
Sbjct:   34 FTVVVDGGSTGTRLHFFEFIG---NQTDMKMSFTDKISSKVALSKFSDARADWGLMRIMFINLTSFAMSKIPKECFNNTPIYVQVTAGVRQI---NQTMSNKILNHIRSILFKLQFKFKAEFVGILSTDKEGILAWVSVNFLLGKLQKNKCL-----DTVGVLDLGGGSTQVAFATINVNLIPKTTRMIIFNQEYYVYSGGYDYMGMDETRIKYVNAS 240          
The following BLAST results are available for this feature:
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENTPD31.768e-3427.42ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
ENTPD31.768e-3427.42ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
ENTPD14.114e-3227.52ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
ENTPD15.468e-3227.52ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
ENTPD17.705e-3227.52ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mig-232.987e-1723.00Nucleoside-diphosphatase mig-23 [Source:UniProtKB... [more]
ntp-13.157e-1123.09Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-14.591e-1123.09Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
ntp-14.591e-1123.09Nucleoside-triphosphatase ntp-1 [Source:UniProtKB... [more]
uda-11.076e-725.51Nucleoside-diphosphatase uda-1 [Source:UniProtKB/... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NTPase1.036e-928.37gene:FBgn0024947 transcript:FBtr0332460[more]
NTPase1.346e-928.37gene:FBgn0024947 transcript:FBtr0332459[more]
NTPase1.770e-928.37gene:FBgn0024947 transcript:FBtr0077683[more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd32.737e-3527.40ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
entpd81.917e-3428.24ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
entpd81.917e-3428.24ectonucleoside triphosphate diphosphohydrolase 8 [... [more]
entpd12.135e-3227.67ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd12.629e-3227.67ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxc21.320e-3328.99forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382... [more]
pgrmc11.685e-3227.43progesterone receptor membrane component 1 [Source... [more]
foxc21.820e-3228.67forkhead box C2 [Source:Xenbase;Acc:XB-GENE-481382... [more]
n4bp2l12.231e-3227.05NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
n4bp2l12.422e-3227.05NEDD4 binding protein 2-like 1 [Source:Xenbase;Acc... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Entpd34.281e-3728.33ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
Entpd21.745e-3227.12ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
Entpd11.261e-2725.00ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
Entpd15.807e-2429.46ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
Entpd12.207e-2230.77ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75355|ENTP3_HUMAN8.490e-3427.42Ectonucleoside triphosphate diphosphohydrolase 3 O... [more]
sp|Q9MYU4|ENTP1_PIG1.846e-3226.83Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
sp|O55026|ENTP2_MOUSE1.220e-3127.12Ectonucleoside triphosphate diphosphohydrolase 2 O... [more]
sp|O35795|ENTP2_RAT1.670e-3128.61Ectonucleoside triphosphate diphosphohydrolase 2 O... [more]
sp|P49961|ENTP1_HUMAN2.626e-3127.52Ectonucleoside triphosphate diphosphohydrolase 1 O... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443QZF57.901e-3829.95Ectonucleoside triphosphate diphosphohydrolase 2-l... [more]
A0A4W3J2C41.491e-3429.27Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A5E4AJ841.516e-3428.78Uncharacterized protein OS=Marmota monax OX=9995 G... [more]
M3ZEV62.250e-3427.96Ectonucleoside triphosphate diphosphohydrolase 3 O... [more]
I3ME342.388e-3428.54Ectonucleoside triphosphate diphosphohydrolase 3 O... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd14.559e-3125.84ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd38.262e-2935.95ectonucleoside triphosphate diphosphohydrolase 3 [... [more]
entpd2a.12.759e-2633.93ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
entpd12.890e-2632.67ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2a.17.968e-2633.93ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000003192.18.599e-2532.74pep scaffold:Pmarinus_7.0:GL484058:1986:12022:-1 g... [more]
ENSPMAT00000008355.18.636e-2330.25pep scaffold:Pmarinus_7.0:GL477173:2090:22790:1 ge... [more]
entpd68.237e-1330.77ectonucleoside triphosphate diphosphohydrolase 6 [... [more]
ENSPMAT00000007714.11.345e-925.10pep scaffold:Pmarinus_7.0:GL476707:293032:299205:-... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YND12.989e-1728.51Apyrase with wide substrate specificity; helps pre... [more]
GDA11.730e-1230.09Guanosine diphosphatase located in the Golgi; invo... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO439112.347e-1429.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425714.264e-1430.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
entpd17.461e-3325.83ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd19.976e-3226.64ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd17.325e-2826.89ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd14.707e-2633.48ectonucleoside triphosphate diphosphohydrolase 1 [... [more]
entpd2b1.176e-2533.49ectonucleoside triphosphate diphosphohydrolase 2 [... [more]
back to top
BLAST of Ectonucleoside triphosphate diphosphohydrolase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010140.10.000e+099.23SMESG000010140.1[more]
SMESG000068450.14.025e-3328.70SMESG000068450.1[more]
SMESG000064312.11.174e-2423.35SMESG000064312.1[more]
SMESG000051033.11.532e-2130.84SMESG000051033.1[more]
SMESG000077431.14.247e-2132.11SMESG000077431.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010934 ID=SMED30010934|Name=Ectonucleoside triphosphate diphosphohydrolase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1763bp
CGCATTCATGGAGAAAAAAATTATTATATTTTTGAACATTTTGTAATCAA
CATATGTATGGTAAACCGAATACTAAAGTAAACAAACCAGTACCAGAATC
ATCACATGTACCAACATTTAAACCGAAATGTAAACCGAAATGCGAACCGG
CATCTAAGCAAACTTGTATATCACACTGCACTCCAAATAAAACATTTGTT
TACAAAACATGTCGGCATTTGTTCAGAAAGGAAAAAAGGAGATTTATAAT
TTTACTAGCCATATTTGTATTTTGTGTCGTATTGCTTATTATTATGATTA
TTCTTATATCTATTTATGATCACGCAGAAAATTTTGGTATTGTAATTGAC
GCTGGCTCAGGTGGTACAAGAGCTTATTTATATAAATGGTATGACGAAAA
CACTAACACAAATGATGAAGTTTCAGAGATAGGTAATTGTGTAGCAGATA
AATTGCAAATTCTTTATTTCCAAAACAGAAATGAAGATTTAATGAAATGT
ATCAAATCTCTTTTACTTAAACTTCGTGCTGTTAAATTTAAACCACCAAT
ATATTTAGCTGCAACTGCTGGAATGAGAATACTCGAGATAGAAAATAAAA
CATTAACCAAAGTAATGTTTAATGAAATCAAGTCGCTGTTTTATGTTTTG
GGGTGGAACTTTAAATTTGTTGGAATTCTGAAAGGTTATTATGAAGGGAT
TTCTGGGTGGACTACGGTAAATTATTTGAAAAACACCATTGGCAAGAATT
CGACCATTCGAAAGGATCGTTTTAGTACTTTTGGTGTACTCGATCTCGGG
GGCAGTAGTACTCAAATTGCCTTTGAAACAAAAACTGGTGATCCTGTGAT
TTTATTTACTAGAAAATATCTATTATATTCTCGCAGTTATCTCTGTTATG
GAGTGAATATGTTTAGGATTCGATATCTTACTACTACATTGCTAGATGCT
ACATCCAGTGAAGTTAATTGTTTTTTAAAAGGAACTCCTACTACTATGCC
CGAAGATTCCTACACTTGTAGATCCGAAAATTCAAGAGGCATTGACCTTT
CAACTTTTAAAAAATTTTATCGTCCTAATGCTGCCGATTGTCGTAATCAG
ATAGCAAAGGCTATAGGGAAAAATGTTGATGTTATACAAGTAGATAAGAA
AATGCGTTTTGTGGCTGTGGCTGTATTTGCTTATTACAATGCTTTTCTTA
CAAAATATTACCGAATGACTGGAAAATATAATTCCTTCGTTCAGGCCACT
GGACTTTTTTGTACTGAGGATTATGCTACATTAGATGCTAAGTACGGTAA
AGATGCTAAATTCGCTCAAAACTATTGCTTAGTTGGGAATTTTATAATCG
TTTTGTTCCAAATGTATGGAATTAATGCCTCCAATTTTGATAACGTAATA
TTTGCCAATAAGATTAGAGGGCAAAATACCGGTTGGAATCTCGGATATAT
GATCAAGCAAACTAAAGACATTCCAAATTCGCGAGCTTTTAAATTGAACG
TTGTTATATTCGTTGTAACTGTAATTGTATGCCTCCTCTATATTACAATT
GCTATTTGTATATTTTTATTCAAGATGTGGGAAAGAAAACAAAAGATTCA
CAATATTAGAGTTTAAAAAGATACTATCACTCATTATATTTATCGGTTAT
TTGATACATTTTCATACAATGATATTCATGTCGCAGCTACAGATATATAT
AATATATAATATGTATATGTATACACAAGTTTTATTCTGGCAATTTATAT
ACTTTTAGATGCG
back to top

protein sequence of SMED30010934-orf-1

>SMED30010934-orf-1 ID=SMED30010934-orf-1|Name=SMED30010934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MYGKPNTKVNKPVPESSHVPTFKPKCKPKCEPASKQTCISHCTPNKTFVY
KTCRHLFRKEKRRFIILLAIFVFCVVLLIIMIILISIYDHAENFGIVIDA
GSGGTRAYLYKWYDENTNTNDEVSEIGNCVADKLQILYFQNRNEDLMKCI
KSLLLKLRAVKFKPPIYLAATAGMRILEIENKTLTKVMFNEIKSLFYVLG
WNFKFVGILKGYYEGISGWTTVNYLKNTIGKNSTIRKDRFSTFGVLDLGG
SSTQIAFETKTGDPVILFTRKYLLYSRSYLCYGVNMFRIRYLTTTLLDAT
SSEVNCFLKGTPTTMPEDSYTCRSENSRGIDLSTFKKFYRPNAADCRNQI
AKAIGKNVDVIQVDKKMRFVAVAVFAYYNAFLTKYYRMTGKYNSFVQATG
LFCTEDYATLDAKYGKDAKFAQNYCLVGNFIIVLFQMYGINASNFDNVIF
ANKIRGQNTGWNLGYMIKQTKDIPNSRAFKLNVVIFVVTVIVCLLYITIA
ICIFLFKMWERKQKIHNIRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0017110nucleoside-diphosphatase activity
GO:0017111nucleoside-triphosphatase activity
GO:01024908-oxo-dGTP phosphohydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000407GDA1_CD39_NTPase
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0009134nucleoside diphosphate catabolic process
GO:0009143nucleoside triphosphate catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000407Nucleoside phosphatase GDA1/CD39PFAMPF01150GDA1_CD39coord: 90..477
e-value: 3.3E-48
score: 164.4
IPR000407Nucleoside phosphatase GDA1/CD39PANTHERPTHR11782ADENOSINE/GUANOSINE DIPHOSPHATASEcoord: 64..499
NoneNo IPR availableGENE3DG3DSA:3.30.420.150coord: 210..455
e-value: 1.5E-69
score: 237.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 94..467
e-value: 1.5E-69
score: 237.0
NoneNo IPR availableTMHMMTMhelixcoord: 484..506
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 369..386
NoneNo IPR availableTMHMMTMhelixcoord: 423..440