HIT domain-containing protein

Overview
NameHIT domain-containing protein
Smed IDSMED30010928
Length (bp)626
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HIT domain-containing protein (SMED30010928) t-SNE clustered cells

Violin plots show distribution of expression levels for HIT domain-containing protein (SMED30010928) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HIT domain-containing protein (SMED30010928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HIT domain-containing protein (SMED30010928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010928

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30010928h1SMcG0021366 dd_Smed_v4_11146_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010928h1SMcG0021366 dd_Smed_v4_11146_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of HIT domain-containing protein vs. Ensembl Human
Match: HINT3 (histidine triad nucleotide binding protein 3 [Source:HGNC Symbol;Acc:HGNC:18468])

HSP 1 Score: 68.9366 bits (167), Expect = 4.305e-14
Identity = 40/138 (28.99%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQ-RDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK--YSPDSYWFKTIDWALDYL 515
            S+C+FC +   +    + +  +NE+++ F+DI+PA+ +HYL +P  H  N + L +  + +++ M+  G   LE+N   D  + R+GFH  PF     I    +  +    +     K  Y  +SYWF T D  ++ L
Sbjct:   46 STCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPF---CSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKL 180          
BLAST of HIT domain-containing protein vs. Ensembl Celegans
Match: hint-3 (HIstidiNe Triad nucleotide-binding protein [Source:UniProtKB/TrEMBL;Acc:Q18227])

HSP 1 Score: 54.299 bits (129), Expect = 3.384e-9
Identity = 33/97 (34.02%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCL-----EKNGADIND--CRIGFHWSPF 386
             C FCD+V  K++++    +N++ VV  DI+P +  HYL +   H      L  +D+P+++EM K G   L     +K  AD  +   RIGFH  P 
Sbjct:   10 GCKFCDIV--KNKKELQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEMEKTGRELLREHLKKKGEADTVEDMLRIGFHLPPL 104          
BLAST of HIT domain-containing protein vs. Ensembl Celegans
Match: hint-3 (HIstidiNe Triad nucleotide-binding protein [Source:UniProtKB/TrEMBL;Acc:Q18227])

HSP 1 Score: 54.299 bits (129), Expect = 3.384e-9
Identity = 33/97 (34.02%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCL-----EKNGADIND--CRIGFHWSPF 386
             C FCD+V  K++++    +N++ VV  DI+P +  HYL +   H      L  +D+P+++EM K G   L     +K  AD  +   RIGFH  P 
Sbjct:   10 GCKFCDIV--KNKKELQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEMEKTGRELLREHLKKKGEADTVEDMLRIGFHLPPL 104          
BLAST of HIT domain-containing protein vs. Ensembl Celegans
Match: hint-3 (HIstidiNe Triad nucleotide-binding protein [Source:UniProtKB/TrEMBL;Acc:Q18227])

HSP 1 Score: 53.5286 bits (127), Expect = 1.045e-8
Identity = 33/97 (34.02%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCL-----EKNGADIND--CRIGFHWSPF 386
             C FCD+V  K++++    +N++ VV  DI+P +  HYL +   H      L  +D+P+++EM K G   L     +K  AD  +   RIGFH  P 
Sbjct:   35 GCKFCDIV--KNKKELQLKENKSCVVINDIKPKAKNHYLVLSKQHIAKPTDLTVADVPLLEEMEKTGRELLREHLKKKGEADTVEDMLRIGFHLPPL 129          
BLAST of HIT domain-containing protein vs. Ensembl Fly
Match: CG34015 (gene:FBgn0054015 transcript:FBtr0100070)

HSP 1 Score: 78.9518 bits (193), Expect = 1.557e-18
Identity = 48/140 (34.29%), Postives = 79/140 (56.43%), Query Frame = 3
Query:  105 IGKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEKR 524
            +   +CIFC + +G+     +  +N++ V+F+DI+PAS +HYLA+   H  ++K LN+S   +++ M     + L   G  ++D   GFH  PF ++ H+H+H ISP   T+  F        S WFKT+D A  YL ++
Sbjct:    1 MADDNCIFCLISDGRIPSTVLEVENDDFVIFQDIKPASQHHYLAVTKKHYASLKDLNKSHDSLVQLMENALKDLLVSKGVSVDDALFGFHLPPFITVKHLHMHAISPR--TQMTFLSKMIFRPSVWFKTVDEARIYLSQK 138          
BLAST of HIT domain-containing protein vs. Ensembl Fly
Match: CG15362 (gene:FBgn0031378 transcript:FBtr0077814)

HSP 1 Score: 61.6178 bits (148), Expect = 8.372e-12
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSI-RFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPF 386
            C FCD  + +     I   + +  V+F+D  PA+  HYLAIP  H +++K LN+S + +++ M +  +  L     D  +  +GFH  PF
Sbjct:   33 CFFCDFAHRRQGPPPILEVETDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEFLRSQNVDPKEAIVGFHLPPF 122          
BLAST of HIT domain-containing protein vs. Ensembl Zebrafish
Match: hint3 (histidine triad nucleotide binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-100922-168])

HSP 1 Score: 84.3445 bits (207), Expect = 2.424e-20
Identity = 45/133 (33.83%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYL 515
            CIFC ++ G+   + +   +E V  F+DI P + +HYL +P+ H  N K L++  +P++++ML+ G   LEKN   D++D R GFHW PF          +    +         Y  +SYWF T D  L  L
Sbjct:   26 CIFCKILKGEMGTELLH-SDETVSCFQDIHPGAPHHYLVVPSKHVGNCKSLSKEHVPLVEKMLETGKEILEKNNVTDLSDVRFGFHWPPF-CSVTHLHLHVLAPVSQMGFMSRLIYRLNSYWFVTADQLLQRL 156          
BLAST of HIT domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-25e12.3 (si:dkey-25e12.3 [Source:NCBI gene;Acc:678527])

HSP 1 Score: 65.855 bits (159), Expect = 2.831e-13
Identity = 32/91 (35.16%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPF 386
            +CIFC +  G  +   I  ++E+ V F DI P + +HYL IP  H  +   L   DI +++ M + G N L+ N   D+ D  +GFH  P+
Sbjct:   22 TCIFCTIAKGDDRYTEILAEDEDFVCFRDINPGAPHHYLVIPKKHIYSCLSLYADDISLVRGMAEMGRNVLKANNVTDLKDISLGFHVPPY 112          
BLAST of HIT domain-containing protein vs. Ensembl Zebrafish
Match: si:dkey-25e12.3 (si:dkey-25e12.3 [Source:NCBI gene;Acc:678527])

HSP 1 Score: 65.855 bits (159), Expect = 2.890e-13
Identity = 32/91 (35.16%), Postives = 49/91 (53.85%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPF 386
            +CIFC +  G  +   I  ++E+ V F DI P + +HYL IP  H  +   L   DI +++ M + G N L+ N   D+ D  +GFH  P+
Sbjct:   22 TCIFCTIAKGDDRYTEILAEDEDFVCFRDINPGAPHHYLVIPKKHIYSCLSLYADDISLVRGMAEMGRNVLKANNVTDLKDISLGFHVPPY 112          
BLAST of HIT domain-containing protein vs. Ensembl Xenopus
Match: cks2 (CDC28 protein kinase regulatory subunit 2 [Source:Xenbase;Acc:XB-GENE-922081])

HSP 1 Score: 82.4185 bits (202), Expect = 1.573e-19
Identity = 44/135 (32.59%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLE 518
            SCIFC + N +     +   ++++V F+DIRPA  +HYL +P  H    K L +  + +IK M++ G + L+KN   D+ D R+GFH+ PF          +    +         Y  +SYWF T D  +D L+
Sbjct:   18 SCIFCRIANKQESGAELLHSDDDLVCFKDIRPAVTHHYLVVPKKHVGTCKTLTKDHVQLIKTMMEVGKSTLQKNNVTDLEDIRLGFHYPPF-CSISHLHLHVLAPASQLGFLSRMIYRVNSYWFITADELIDQLQ 151          
BLAST of HIT domain-containing protein vs. Ensembl Mouse
Match: Hint3 (histidine triad nucleotide binding protein 3 [Source:MGI Symbol;Acc:MGI:1914097])

HSP 1 Score: 87.0409 bits (214), Expect = 2.575e-21
Identity = 53/141 (37.59%), Postives = 77/141 (54.61%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSI-RFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK---YSPDSYWFKTIDWALDYLEK 521
            S+C+FC V  G+  +  +   +NE++V F+DI+PA+ YHYL +P  H  + K LN+  I +++ M+  G   LE+N   D  D R+GFH  PF        HL   +    K F F     Y  DSYWF T+D+ L+ L K
Sbjct:   29 SNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVESMVAAGKTMLERNNFTDFTDVRMGFHVPPF----CSISHLHLHVIAPVKEFGFLSKLVYRQDSYWFVTVDYLLEKLRK 165          
BLAST of HIT domain-containing protein vs. Ensembl Mouse
Match: Hint3 (histidine triad nucleotide binding protein 3 [Source:MGI Symbol;Acc:MGI:1914097])

HSP 1 Score: 78.9518 bits (193), Expect = 3.591e-18
Identity = 52/145 (35.86%), Postives = 76/145 (52.41%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSI-RFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDC------RIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK---YSPDSYWFKTIDWALDYL 515
            S+C+FC V  G+  +  +   +NE++V F+DI+PA+ YHYL +P  H  + K LN+  I +++ M+  G   LE+N   D  D       R+GFH  PF        HL   +    K F F     Y  DSYWF T+D+ L+ L
Sbjct:   24 SNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVESMVAAGKTMLERNNFTDFTDVSKLLCFRMGFHVPPF----CSISHLHLHVIAPVKEFGFLSKLVYRQDSYWFVTVDYLLEKL 164          
BLAST of HIT domain-containing protein vs. Ensembl Mouse
Match: Hint3 (histidine triad nucleotide binding protein 3 [Source:MGI Symbol;Acc:MGI:1914097])

HSP 1 Score: 51.9878 bits (123), Expect = 7.231e-9
Identity = 24/59 (40.68%), Postives = 38/59 (64.41%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSI-RFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDI 287
            S+C+FC V  G+  +  +   +NE++V F+DI+PA+ YHYL +P  H  + K LN+  I
Sbjct:   23 SNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHI 81          
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CPS6|HINT3_MOUSE (Histidine triad nucleotide-binding protein 3 OS=Mus musculus OX=10090 GN=Hint3 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.801e-20
Identity = 53/141 (37.59%), Postives = 77/141 (54.61%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSI-RFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK---YSPDSYWFKTIDWALDYLEK 521
            S+C+FC V  G+  +  +   +NE++V F+DI+PA+ YHYL +P  H  + K LN+  I +++ M+  G   LE+N   D  D R+GFH  PF        HL   +    K F F     Y  DSYWF T+D+ L+ L K
Sbjct:   29 SNCVFCRVAAGQEPKTELFHCENEDLVCFKDIKPAALYHYLVVPKKHIGSCKDLNKDHIEMVESMVAAGKTMLERNNFTDFTDVRMGFHVPPF----CSISHLHLHVIAPVKEFGFLSKLVYRQDSYWFVTVDYLLEKLRK 165          
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q28BZ2|HINT3_XENTR (Histidine triad nucleotide-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=hint3 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 8.331e-19
Identity = 44/135 (32.59%), Postives = 69/135 (51.11%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLE 518
            SCIFC + N +     +   ++++V F+DIRPA  +HYL +P  H    K L +  + +IK M++ G + L+KN   D+ D R+GFH+ PF          +    +         Y  +SYWF T D  +D L+
Sbjct:   18 SCIFCRIANKQESGAELLHSDDDLVCFKDIRPAVTHHYLVVPKKHVGTCKTLTKDHVQLIKTMMEVGKSTLQKNNVTDLEDIRLGFHYPPF-CSISHLHLHVLAPASQLGFLSRMIYRVNSYWFITADELIDQLQ 151          
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8K3P7|HINT3_RAT (Histidine triad nucleotide-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Hint3 PE=2 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 2.855e-18
Identity = 51/141 (36.17%), Postives = 76/141 (53.90%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSIRF-QNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK---YSPDSYWFKTIDWALDYLEK 521
            S+C+FC V  G+     + + +N+++V F+DI+PA+ +HYL +P  H  + K LN+  I +++ M+  G   LE+N   D  D R+GFH  PF        HL   +    K F F     Y  DSYWF T D+ L+ L K
Sbjct:   39 SNCVFCRVAAGQEPETELLYCENKDLVCFKDIKPAALHHYLVVPKKHIGSCKDLNKDHIEMVESMVTVGKTILERNNFTDFTDVRMGFHVPPF----CSVSHLHLHVIAPAKEFGFLSRVVYRRDSYWFITGDYLLEKLRK 175          
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2YDJ4|HINT3_BOVIN (Histidine triad nucleotide-binding protein 3 OS=Bos taurus OX=9913 GN=HINT3 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 7.507e-16
Identity = 52/138 (37.68%), Postives = 78/138 (56.52%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQRDSIRF---QNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYL 515
            S C+FC +    HQ         +NE++V F+DI+PA+ +HYL +P  H  N K+L +  I +I+ M+  G   LE+N   D  + R+GFH SPF SI H+HLH+++P            Y  +SYWF T D+ ++ L
Sbjct:   46 SKCVFCRI--AAHQDPGTELLHCENEDLVCFKDIKPAAPHHYLVVPKKHFENCKYLKKDQIELIENMVTVGKAILERNNFTDFENTRMGFHVSPFCSIAHLHLHVLAPADQL-SFMSRLVYRVNSYWFITADYLIEKL 180          
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NQE9|HINT3_HUMAN (Histidine triad nucleotide-binding protein 3 OS=Homo sapiens OX=9606 GN=HINT3 PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 2.068e-13
Identity = 40/138 (28.99%), Postives = 71/138 (51.45%), Query Frame = 3
Query:  114 SSCIFCDVVNGKHQ-RDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK--YSPDSYWFKTIDWALDYL 515
            S+C+FC +   +    + +  +NE+++ F+DI+PA+ +HYL +P  H  N + L +  + +++ M+  G   LE+N   D  + R+GFH  PF     I    +  +    +     K  Y  +SYWF T D  ++ L
Sbjct:   46 STCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVPKKHIGNCRTLRKDQVELVENMVTVGKTILERNNFTDFTNVRMGFHMPPF---CSISHLHLHVLAPVDQLGFLSKLVYRVNSYWFITADHLIEKL 180          
BLAST of HIT domain-containing protein vs. TrEMBL
Match: A0A1Z5LEZ3 (Histidine triad nucleotide binding protein (Fragment) OS=Ornithodoros moubata OX=6938 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 4.591e-26
Identity = 61/138 (44.20%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  108 GKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK 521
            G  SCIFC +  G+  + ++ FQ+E+ VVF DI PA+ +HYL +P  H  N K L RSDIP++K++++ G   L++ G  +   R GFHW PF+SI H+HLH+ISP+        F  Y P S WF T +  + YLEK
Sbjct:   10 GPDSCIFCKIARGEEPKTAVLFQDEDHVVFRDIHPATKHHYLVVPKKHIKNPKCLTRSDIPLVKQLVEVGKQALQQQGGAVESLRTGFHWPPFNSITHLHLHVISPVEELSFIGRF-VYMPGSLWFCTAEDTVAYLEK 146          
BLAST of HIT domain-containing protein vs. TrEMBL
Match: A0A131XAW9 (HIT domain-containing protein OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.228e-25
Identity = 48/135 (35.56%), Postives = 75/135 (55.56%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK 521
            +CIFC +  GK  + ++ +Q+E+ VVF DI PAS  HYL +P  H  ++K L RSDIP++  +++ G + LE+ G   +  R+GFHW PF +        +              + P + WF  ++ A+DYLEK
Sbjct:   18 TCIFCKIATGKDPKSTLLYQDEDYVVFSDIHPASTQHYLVVPKKHMKSVKSLTRSDIPLVNRLIEIGKHVLEQRGGSTDSLRMGFHWPPF-TSISHLHLHVIAPVAEMSMLARVIFMPGTPWFCLVEDAMDYLEK 151          
BLAST of HIT domain-containing protein vs. TrEMBL
Match: G3MS16 (HIT domain-containing protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.908e-25
Identity = 60/141 (42.55%), Postives = 88/141 (62.41%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK-RP*SP 536
            SCIFC +V GK  + ++ +Q+E  VVF+DI PAS +HYL +P  H  ++K L  +DIPI+  +++ G   LE+ G  ++  R GFHW PF SI+H+HLH+I+P         F  + P S WF  +D  + YLE+ RP +P
Sbjct:   20 SCIFCKIVAGKDPKTTLLYQDEEYVVFQDIHPASTHHYLIVPKKHLKDVKSLTYNDIPIVNRLVEIGRQVLEQRGGSLDTSRFGFHWPPFTSISHLHLHVIAPAADMSAIGRF-IFMPGSPWFSLVDDTIAYLERSRPVTP 159          
BLAST of HIT domain-containing protein vs. TrEMBL
Match: A0A023GFA9 (HIT domain-containing protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.242e-25
Identity = 60/141 (42.55%), Postives = 88/141 (62.41%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK-RP*SP 536
            SCIFC +V GK  + ++ +Q+E  VVF+DI PAS +HYL +P  H  ++K L  +DIPI+  +++ G   LE+ G  ++  R GFHW PF SI+H+HLH+I+P         F  + P S WF  +D  + YLE+ RP +P
Sbjct:   20 SCIFCKIVAGKDPKTTLLYQDEEYVVFQDIHPASTHHYLIVPKKHLKDVKSLTYNDIPIVNRLVEIGKQVLEQRGGSLDTSRFGFHWPPFTSISHLHLHVIAPAADMSTIGRF-IFMPGSPWFSLVDDTIAYLERSRPVAP 159          
BLAST of HIT domain-containing protein vs. TrEMBL
Match: A0A131Z375 (Protein kinase c inhibitor like protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.687e-25
Identity = 55/138 (39.86%), Postives = 86/138 (62.32%), Query Frame = 3
Query:  108 GKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK 521
            G+ +CIFC +  GK  + ++ +Q+E+ VVF DI PAS +HYL +P  H  + K L RSDIP++  +++ G   LE+ G  ++ CR+GFHW PF SI+H+HLH+I+P            + P + WF  ++  + YLE+
Sbjct:   11 GEETCIFCKIAAGKEPKTTLLYQDEDYVVFSDIHPASTHHYLIVPKKHVKDTKSLTRSDIPLVNRLVEIGKQVLEQRGGSMDSCRMGFHWPPFTSISHLHLHVIAPTEDM-SMLARLIFRPRTPWFCLVEDTMSYLEQ 147          
BLAST of HIT domain-containing protein vs. Ensembl Cavefish
Match: hint3 (histidine triad nucleotide binding protein 3 [Source:NCBI gene;Acc:103030469])

HSP 1 Score: 88.9669 bits (219), Expect = 4.354e-22
Identity = 46/133 (34.59%), Postives = 68/133 (51.13%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYL 515
            CIFC +VN +     +   +E +  F DI+P + +HYL +P  H  N K LN+  IP+++++++ G   L+KN   D+ND R GFHW PF          +    +         + PDSYWF T D  L  L
Sbjct:   26 CIFCKIVN-REMDTELLHSDEEISCFRDIKPGAPHHYLVVPTKHVGNCKSLNKEHIPLVEKLMETGKTILQKNNVTDLNDVRFGFHWPPF-HSVVHLHLHVLAPASQMGFMARLIFRPDSYWFITADQLLQRL 156          
BLAST of HIT domain-containing protein vs. Ensembl Nematostella
Match: EDO37394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV5])

HSP 1 Score: 100.523 bits (249), Expect = 5.119e-27
Identity = 55/134 (41.04%), Postives = 83/134 (61.94%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEK 521
            C+FC + + K Q   I +++E  + F+D+RPA+D+HYL IP  H  N K L   D+P++++++  G   L +  A+  D  IGFHW PF+SI H+HLH+IS     R       Y P S+WF T+DW L++L+K
Sbjct:   11 CVFCKI-SSKEQETRIIYEDEETLTFKDLRPATDHHYLVIPKQHYGNPKSLTGDDLPLVEKLMDVGKKVLVQQNANTEDTVIGFHWPPFNSIQHLHLHVISDASQMRFA-SRHIYRPGSWWFATVDWMLEHLKK 142          
BLAST of HIT domain-containing protein vs. Ensembl Medaka
Match: hint3 (histidine triad nucleotide binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-100922-168])

HSP 1 Score: 76.6406 bits (187), Expect = 1.909e-17
Identity = 33/90 (36.67%), Postives = 53/90 (58.89%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGA-DINDCRIGFHWSPF 386
            CIFC +VN +     + + +E +  F DI+P + +HYL +P  H  N K L++  +P++  ++  G   L+KN   D++D R GFHW PF
Sbjct:   21 CIFCRIVN-REMGTELLYSDEEISCFRDIKPGAPHHYLVVPTQHVGNCKSLSKEHVPLVNRLVDVGKEILQKNNVMDLSDVRFGFHWPPF 109          
BLAST of HIT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036728.1 (histidine triad nucleotide-binding protein 3 [Source:NCBI gene;Acc:101174317])

HSP 1 Score: 70.0922 bits (170), Expect = 8.666e-15
Identity = 42/128 (32.81%), Postives = 76/128 (59.38%), Query Frame = 3
Query:  117 SCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTID 497
            +CIFC +   + +   +  Q++ +V F DI PA+ +HYL IP  H ++ + L+   I ++  M   G + L + G  ++ D R+GFH  PF S+ H+HLH+++P+     CF + K++P++ +F T+ 
Sbjct:   11 TCIFCLIAKNQDEETEVIKQDKKLVCFRDIWPAAPHHYLVIPRAHIHSCRSLSGEHIHLVDRMTSMGKDVLREQGITNMEDVRLGFHQPPFISVGHLHLHVLAPVRQISTCFEY-KFTPETDFFVTVS 137          
BLAST of HIT domain-containing protein vs. Planmine SMEST
Match: SMESG000013683.1 (SMESG000013683.1)

HSP 1 Score: 261.922 bits (668), Expect = 1.868e-90
Identity = 142/142 (100.00%), Postives = 142/142 (100.00%), Query Frame = 3
Query:  102 MIGKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDKYSPDSYWFKTIDWALDYLEKRP 527
            MIGKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFHSINHIHLHLISPIPTTRKCFCFDKYSPDSYWFKTIDWALDYLEKRP
Sbjct:    1 MIGKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFHSINHIHLHLISPIPTTRKCFCFDKYSPDSYWFKTIDWALDYLEKRP 142          
BLAST of HIT domain-containing protein vs. Planmine SMEST
Match: SMESG000025046.1 (SMESG000025046.1)

HSP 1 Score: 67.3958 bits (163), Expect = 2.915e-14
Identity = 44/138 (31.88%), Postives = 72/138 (52.17%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHR-NNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK--YSPDSYWFKTIDWALDYLEKR 524
            CIFC + N K +  SI +++++ ++FEDI+PA+  HYL IP  H  ++ K L +S   +I  M++      +K   +I   R GFHW PF     +    +  I    +    ++  Y P+S+WF T    LD L+ +
Sbjct:    8 CIFCSIANKKAE-SSILYEDDDFLLFEDIKPAAKIHYLCIPKKHLVSSAKELTKSHENLISSMIEVS----KKFIGEIPSVRFGFHWPPF---TLVKHLHMHIISPVEELSLLNRIIYRPNSWWFVTDTALLDLLKNK 137          
BLAST of HIT domain-containing protein vs. Planmine SMEST
Match: SMESG000025046.1 (SMESG000025046.1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.299e-13
Identity = 43/138 (31.16%), Postives = 67/138 (48.55%), Query Frame = 3
Query:  120 CIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVHRNNIKFLNRSDIPIIKEMLKQGLNCLEKNG-ADINDCRIGFHWSPFXXXXXXXXXXXXXXXTTRKCFCFDK--YSPDSYWFKTIDWALDYLEKR 524
            CIFC + N K +  SI +++++ ++FEDI+PA+  HYL IP  H           +   KE+ K   N + K    +I   R GFHW PF     +    +  I    +    ++  Y P+S+WF T    LD L+ +
Sbjct:    8 CIFCSIANKKAE-SSILYEDDDFLLFEDIKPAAKIHYLCIPKKHL----------VSSAKELTKSHENLISKKFIGEIPSVRFGFHWPPF---TLVKHLHMHIISPVEELSLLNRIIYRPNSWWFVTDTALLDLLKNK 131          
The following BLAST results are available for this feature:
BLAST of HIT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
HINT34.305e-1428.99histidine triad nucleotide binding protein 3 [Sour... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hint-33.384e-934.02HIstidiNe Triad nucleotide-binding protein [Sourc... [more]
hint-33.384e-934.02HIstidiNe Triad nucleotide-binding protein [Sourc... [more]
hint-31.045e-834.02HIstidiNe Triad nucleotide-binding protein [Sourc... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG340151.557e-1834.29gene:FBgn0054015 transcript:FBtr0100070[more]
CG153628.372e-1232.22gene:FBgn0031378 transcript:FBtr0077814[more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hint32.424e-2033.83histidine triad nucleotide binding protein 3 [Sour... [more]
si:dkey-25e12.32.831e-1335.16si:dkey-25e12.3 [Source:NCBI gene;Acc:678527][more]
si:dkey-25e12.32.890e-1335.16si:dkey-25e12.3 [Source:NCBI gene;Acc:678527][more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cks21.573e-1932.59CDC28 protein kinase regulatory subunit 2 [Source:... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hint32.575e-2137.59histidine triad nucleotide binding protein 3 [Sour... [more]
Hint33.591e-1835.86histidine triad nucleotide binding protein 3 [Sour... [more]
Hint37.231e-940.68histidine triad nucleotide binding protein 3 [Sour... [more]
back to top
BLAST of HIT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CPS6|HINT3_MOUSE1.801e-2037.59Histidine triad nucleotide-binding protein 3 OS=Mu... [more]
sp|Q28BZ2|HINT3_XENTR8.331e-1932.59Histidine triad nucleotide-binding protein 3 OS=Xe... [more]
sp|Q8K3P7|HINT3_RAT2.855e-1836.17Histidine triad nucleotide-binding protein 3 OS=Ra... [more]
sp|Q2YDJ4|HINT3_BOVIN7.507e-1637.68Histidine triad nucleotide-binding protein 3 OS=Bo... [more]
sp|Q9NQE9|HINT3_HUMAN2.068e-1328.99Histidine triad nucleotide-binding protein 3 OS=Ho... [more]
back to top
BLAST of HIT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z5LEZ34.591e-2644.20Histidine triad nucleotide binding protein (Fragme... [more]
A0A131XAW91.228e-2535.56HIT domain-containing protein OS=Hyalomma excavatu... [more]
G3MS161.908e-2542.55HIT domain-containing protein OS=Amblyomma maculat... [more]
A0A023GFA92.242e-2542.55HIT domain-containing protein OS=Amblyomma triste ... [more]
A0A131Z3753.687e-2539.86Protein kinase c inhibitor like protein OS=Rhipice... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hint34.354e-2234.59histidine triad nucleotide binding protein 3 [Sour... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HIT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HIT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO373945.119e-2741.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HIT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hint31.909e-1736.67histidine triad nucleotide binding protein 3 [Sour... [more]
ENSORLT00000036728.18.666e-1532.81histidine triad nucleotide-binding protein 3 [Sour... [more]
back to top
BLAST of HIT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000013683.11.868e-90100.00SMESG000013683.1[more]
SMESG000025046.12.915e-1431.88SMESG000025046.1[more]
SMESG000025046.12.299e-1331.16SMESG000025046.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010928 ID=SMED30010928|Name=HIT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=626bp
TAAATTATGTACACAATACAATTATTGTTATTTTAACAGTTCTAGTTAAA
TTAAATTTATTCAAATAATTTGATAAATAGTAAAATTGAAAATTGAGCAA
AATGATTGGCAAAAGTTCATGCATTTTTTGTGATGTTGTGAATGGTAAGC
ATCAAAGAGATTCAATTAGATTTCAAAATGAAAATGTAGTGGTTTTTGAA
GATATAAGGCCAGCATCAGATTATCACTATTTAGCAATTCCGGCTGTTCA
TAGGAATAATATCAAATTTTTGAACAGATCTGACATTCCAATAATTAAAG
AAATGCTCAAACAAGGTTTGAATTGTCTAGAAAAAAATGGCGCTGATATA
AATGATTGCAGAATCGGCTTCCATTGGTCACCGTTTCACAGTATTAACCA
TATTCATCTTCATTTAATATCTCCGATACCAACCACGAGAAAATGTTTTT
GTTTTGATAAATATTCCCCAGATTCATATTGGTTTAAAACGATTGATTGG
GCACTAGATTACCTAGAAAAACGACCATAATCACCGGAAGAAAAGTCGAT
TTATATATTTCATATAAAAATTGTGAGCCATATTTTTTAATACTATTTTC
AATAAAACTCTAAAAGGCGAGATCGG
back to top

protein sequence of SMED30010928-orf-1

>SMED30010928-orf-1 ID=SMED30010928-orf-1|Name=SMED30010928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=143bp
MIGKSSCIFCDVVNGKHQRDSIRFQNENVVVFEDIRPASDYHYLAIPAVH
RNNIKFLNRSDIPIIKEMLKQGLNCLEKNGADINDCRIGFHWSPFHSINH
IHLHLISPIPTTRKCFCFDKYSPDSYWFKTIDWALDYLEKRP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036265HIT-like_sf
IPR011146HIT-like
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036265HIT-like superfamilyGENE3DG3DSA:3.30.428.10coord: 3..111
e-value: 2.8E-22
score: 81.2
IPR036265HIT-like superfamilySUPERFAMILYSSF54197HIT-likecoord: 5..135
NoneNo IPR availablePFAMPF11969DcpS_Ccoord: 6..108
e-value: 7.5E-25
score: 87.6
NoneNo IPR availablePANTHERPTHR12486APRATAXIN-RELATEDcoord: 4..140
NoneNo IPR availablePANTHERPTHR12486:SF5HISTIDINE TRIAD NUCLEOTIDE-BINDING PROTEIN 3coord: 4..140
IPR011146HIT-like domainPROSITEPS51084HIT_2coord: 8..116
score: 10.447