Superkiller viralicidic activity 2-like 2

Overview
NameSuperkiller viralicidic activity 2-like 2
Smed IDSMED30010927
Length (bp)3136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Superkiller viralicidic activity 2-like 2 (SMED30010927) t-SNE clustered cells

Violin plots show distribution of expression levels for Superkiller viralicidic activity 2-like 2 (SMED30010927) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Superkiller viralicidic activity 2-like 2 (SMED30010927) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Superkiller viralicidic activity 2-like 2 (SMED30010927) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010927

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010927SMESG000063270.1 SmedASXL_017288SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010927SMESG000063270.1 SmedASXL_017288SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30010927SMESG000063270.1 dd_Smed_v4_10108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010927SMESG000063270.1 dd_Smed_v4_10108_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Match: MTREX (Mtr4 exosome RNA helicase [Source:HGNC Symbol;Acc:HGNC:18734])

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 468/951 (49.21%), Postives = 657/951 (69.09%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            + C HEV  P    Y PLK R    AKE+ F LD+FQ +AIQC++NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGLIK LFATETF+MG+NMPA+TV+FT+A KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ +++  E+Q  +I + N+E + I  +Y++ + L  + +E+   I K     PFL PGRLV +K    DFGW ++V+       K  SG+   L +V+ ++  + ESL     + A  P K + + +  +  + +  +  +SSV +     L     +  + R+  L     +  R+ + I L+D   D+  +   + +  QK++  + ++ +HP+ N D +LE +  L  K+ +        + E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++L+ +Q  A LSCFVF+E  +E+ +    L   L +M+E A+ I++VS E +LE+    DE+ Y+ +FK  L+++V  WA G+TF  +C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:  108 EGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESVVI--YYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESL-KNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDL-----RPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHN-DPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEI----DEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1042          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Match: SKIV2L (Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGNC:10898])

HSP 1 Score: 523.087 bits (1346), Expect = 4.836e-166
Identity = 335/967 (34.64%), Postives = 519/967 (53.67%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQF----------QTYAELPNLITRLREKE--KQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD--FGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKH---------ETRPDGNLFEIELKHIFELSSVVIGCT-DQLLHSLKKNDEARKEFLNKRNSIIARYNTIF--LIDLKKDLKCKPDQIDEYDQKIQELQTK----IENHPMFNHDKSLEMIN----LYHKRLEYEGIADKLRVEINKKVSLIKM----------DELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            PA +++F  D FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+F+  F DVGLLTGDV +   AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +FA WI  L ++   VI T  RP PL+HY++   + +    ++ +++ +G F  + +  A+     R +  +          +GG         +L+  +    + PV+VF+FS+  C+  A  L+ LD TT  EK +I L        L   DR LPQ+  M  L+ RG+G+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+  R +  GEY+QM+GRAGRRGLD  G VIL+   R  +  D  +++ G+   L S F LTY MILNL+RV+ +  E +M+ SF +F          Q  AEL   +  L E +   QL ++P    EY S G    L ++ + I+  +  S+    +    L  GR+V +K  EH    G  + VS   + +  + LV C  P++ +       +  +P P           E   D  + +++   +  +++ V+    +++L    K    R++   K++  +A   T    L+ L +     P  +D     + +LQ K    +E        K  E+I     ++  R   + +  + R++I K++  ++            E   R  +LR   +  +   +   GR+AC +S+  E++LTEL+ D   S L  +++ A LS  V +   +   +  N L + +E+++ +A+ I  V   C L     T E+ +V     GL+E+V  WA+G  F +L   +   EG ++RCI+RL E+   L  ++R++G   L  K   A+ L++R I+F++SLY
Sbjct:  303 PAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVDLP----EYYSWGEE--LTETQHMIQRRIMESVNGLKS----LSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSK----RQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLD----PVNDLQLKDMSVVEGG--LRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSS-HELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLN---QTVEE-FVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLY 1244          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Match: SKIV2L (Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGNC:10898])

HSP 1 Score: 523.087 bits (1346), Expect = 4.836e-166
Identity = 335/967 (34.64%), Postives = 519/967 (53.67%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQF----------QTYAELPNLITRLREKE--KQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD--FGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKH---------ETRPDGNLFEIELKHIFELSSVVIGCT-DQLLHSLKKNDEARKEFLNKRNSIIARYNTIF--LIDLKKDLKCKPDQIDEYDQKIQELQTK----IENHPMFNHDKSLEMIN----LYHKRLEYEGIADKLRVEINKKVSLIKM----------DELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            PA +++F  D FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+F+  F DVGLLTGDV +   AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +FA WI  L ++   VI T  RP PL+HY++   + +    ++ +++ +G F  + +  A+     R +  +          +GG         +L+  +    + PV+VF+FS+  C+  A  L+ LD TT  EK +I L        L   DR LPQ+  M  L+ RG+G+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+  R +  GEY+QM+GRAGRRGLD  G VIL+   R  +  D  +++ G+   L S F LTY MILNL+RV+ +  E +M+ SF +F          Q  AEL   +  L E +   QL ++P    EY S G    L ++ + I+  +  S+    +    L  GR+V +K  EH    G  + VS   + +  + LV C  P++ +       +  +P P           E   D  + +++   +  +++ V+    +++L    K    R++   K++  +A   T    L+ L +     P  +D     + +LQ K    +E        K  E+I     ++  R   + +  + R++I K++  ++            E   R  +LR   +  +   +   GR+AC +S+  E++LTEL+ D   S L  +++ A LS  V +   +   +  N L + +E+++ +A+ I  V   C L     T E+ +V     GL+E+V  WA+G  F +L   +   EG ++RCI+RL E+   L  ++R++G   L  K   A+ L++R I+F++SLY
Sbjct:  303 PAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVDLP----EYYSWGEE--LTETQHMIQRRIMESVNGLKS----LSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSK----RQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLD----PVNDLQLKDMSVVEGG--LRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSS-HELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLN---QTVEE-FVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLY 1244          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Match: SKIV2L (Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGNC:10898])

HSP 1 Score: 523.087 bits (1346), Expect = 4.836e-166
Identity = 335/967 (34.64%), Postives = 519/967 (53.67%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQF----------QTYAELPNLITRLREKE--KQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD--FGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKH---------ETRPDGNLFEIELKHIFELSSVVIGCT-DQLLHSLKKNDEARKEFLNKRNSIIARYNTIF--LIDLKKDLKCKPDQIDEYDQKIQELQTK----IENHPMFNHDKSLEMIN----LYHKRLEYEGIADKLRVEINKKVSLIKM----------DELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            PA +++F  D FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+F+  F DVGLLTGDV +   AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +FA WI  L ++   VI T  RP PL+HY++   + +    ++ +++ +G F  + +  A+     R +  +          +GG         +L+  +    + PV+VF+FS+  C+  A  L+ LD TT  EK +I L        L   DR LPQ+  M  L+ RG+G+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+  R +  GEY+QM+GRAGRRGLD  G VIL+   R  +  D  +++ G+   L S F LTY MILNL+RV+ +  E +M+ SF +F          Q  AEL   +  L E +   QL ++P    EY S G    L ++ + I+  +  S+    +    L  GR+V +K  EH    G  + VS   + +  + LV C  P++ +       +  +P P           E   D  + +++   +  +++ V+    +++L    K    R++   K++  +A   T    L+ L +     P  +D     + +LQ K    +E        K  E+I     ++  R   + +  + R++I K++  ++            E   R  +LR   +  +   +   GR+AC +S+  E++LTEL+ D   S L  +++ A LS  V +   +   +  N L + +E+++ +A+ I  V   C L     T E+ +V     GL+E+V  WA+G  F +L   +   EG ++RCI+RL E+   L  ++R++G   L  K   A+ L++R I+F++SLY
Sbjct:  303 PAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVDLP----EYYSWGEE--LTETQHMIQRRIMESVNGLKS----LSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSK----RQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLD----PVNDLQLKDMSVVEGG--LRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSS-HELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLN---QTVEE-FVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLY 1244          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Match: SKIV2L (Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGNC:10898])

HSP 1 Score: 523.087 bits (1346), Expect = 4.836e-166
Identity = 335/967 (34.64%), Postives = 519/967 (53.67%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQF----------QTYAELPNLITRLREKE--KQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD--FGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKH---------ETRPDGNLFEIELKHIFELSSVVIGCT-DQLLHSLKKNDEARKEFLNKRNSIIARYNTIF--LIDLKKDLKCKPDQIDEYDQKIQELQTK----IENHPMFNHDKSLEMIN----LYHKRLEYEGIADKLRVEINKKVSLIKM----------DELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            PA +++F  D FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+F+  F DVGLLTGDV +   AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +FA WI  L ++   VI T  RP PL+HY++   + +    ++ +++ +G F  + +  A+     R +  +          +GG         +L+  +    + PV+VF+FS+  C+  A  L+ LD TT  EK +I L        L   DR LPQ+  M  L+ RG+G+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+  R +  GEY+QM+GRAGRRGLD  G VIL+   R  +  D  +++ G+   L S F LTY MILNL+RV+ +  E +M+ SF +F          Q  AEL   +  L E +   QL ++P    EY S G    L ++ + I+  +  S+    +    L  GR+V +K  EH    G  + VS   + +  + LV C  P++ +       +  +P P           E   D  + +++   +  +++ V+    +++L    K    R++   K++  +A   T    L+ L +     P  +D     + +LQ K    +E        K  E+I     ++  R   + +  + R++I K++  ++            E   R  +LR   +  +   +   GR+AC +S+  E++LTEL+ D   S L  +++ A LS  V +   +   +  N L + +E+++ +A+ I  V   C L     T E+ +V     GL+E+V  WA+G  F +L   +   EG ++RCI+RL E+   L  ++R++G   L  K   A+ L++R I+F++SLY
Sbjct:  303 PAFQWAFEPDVFQKQAILHLERHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDVERGVVWEEVLIMLPDHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVTRPVPLEHYLFTGNSSKTQGELFLLLDSRGAFHTKGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLNRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALAELTKRLGALEEPDMTGQLVDLP----EYYSWGEE--LTETQHMIQRRIMESVNGLKS----LSAGRVVVVKNQEHHNALGVILQVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSK----RQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLD----PVNDLQLKDMSVVEGG--LRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSS-HELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLN---QTVEE-FVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLY 1244          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Match: mtr-4 (mRNA transport homolog 4 [Source:UniProtKB/Swiss-Prot;Acc:Q23223])

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 446/1027 (43.43%), Postives = 645/1027 (62.80%), Query Frame = 3
Query:   90 EVAEVPVEIKDNASKKRKLDDFLVEYVDKASDV-----EEKKTKIDVSDFKNP-----INDILLKTIPT--QNCIHEVVYPKNIVYKPLKKRNSI-PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEE--IPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKS-----------LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            E  E P+E  D+A K++  +D      +  +DV     +E  +K    + +       + +I++ TI T  +NC HEV  P N  +  L++ +   PAK + F LD+FQ QAI CI+NNQ+VLVSAHTSAGKTV A+Y IA C++EK+RVIYT+PIKALSNQKYRE +EEF+DVGL+TGDVT++ +AS L+MTTEILR MLYR S I+KEVGWV++DEIHYMRDK RGVVWEE+IIL+   ++  FLSATIPNARQFAQW+A + +QP NV+YTDYRPTPLQH+IYP G + +Y+VVN KGEF ++ F +AM+ L  AGDS+ +   N  + GG    +S+   +I+ V        IVFSFS+K CE YA  L  +D+    EK  ++ ++ +A   L   D+ LPQI  +L L+RRGIG+HH GLMP+LKE +EILFGEGL+K LFATETFSMGLNMPA+TV+FTSA KFDG++ R ITSGEYIQM+GRAGRRG D  G VILM+D  +  +DAKQ+IKG T+PLNS F LTYNM+LNLMRVE ++  +++ NSF QFQ+YA++P +  +  + E+++     P  N+    + +   L+  L A R+ +    R+      FL  GRL  +K  + DF W IL       +FK             L D +I +  E  F       + P     +       + +  I  +S+V +    ++   + K D  +        +   R+ N I L+D  +D++ K  ++ E   + + L+ ++E H M   D   ++   + ++ +     + L+ E     S + ++EL +RKR+LRR  +  + D +  KG +ACE+S  DE++LTE+LL G F+ L   Q  A LSCFVF++          +L   L ++ E AR++++VS EC++EV     E  YV +F  GL+++V  W  G+TF ++ + T+++EGSIIR +RRL+E+L ++  +++ + N +LE+KF +A + +KR I+F++SLYL
Sbjct:   22 EAPENPMEKLDSAKKRQAREDMTNLLANMHNDVGVGNFDEATSKRARVEEEEEVEEARMENIIVHTIRTDNENCTHEVAIPPNAEFAELRENSGTEPAKYYPFQLDAFQKQAILCIDNNQSVLVSAHTSAGKTVVATYAIAKCLREKQRVIYTSPIKALSNQKYRELEEEFKDVGLMTGDVTLNPDASCLVMTTEILRSMLYRGSEIMKEVGWVVYDEIHYMRDKERGVVWEETIILMSKNIKQAFLSATIPNARQFAQWVASIKQQPVNVVYTDYRPTPLQHWIYPVGGEGMYEVVNVKGEFREDKFRDAMSGLATAGDSAGS--FNKRRTGGGTQGDSNVLKIIRSVASNDGLNCIVFSFSRKECESYAISLKDMDFNKDHEKGMVKSVYESAIAQLSPEDQKLPQILNILPLLRRGIGVHHSGLMPILKETIEILFGEGLVKVLFATETFSMGLNMPARTVVFTSARKFDGSDNRYITSGEYIQMAGRAGRRGKDDRGTVILMVDSAMSADDAKQIIKGATDPLNSQFRLTYNMVLNLMRVEGMAVSWIINNSFHQFQSYAKIPEIDKKCVQVERKIASFNFPWENE----MRTLVDLQDQLEATRQRIIQIQREPKYIVGFLHAGRLFKVKSGDRDFKWGIL------NQFKKEQNPDDRNDQIYLCDMMIAINTEGRFDPTNPATLVPGFDLPKRRWIRVPMTIDRITAISAVRL----KVPADIDKPD-GQMRLDGMMAAATKRFGNQIPLLDPIQDMEIKTVEMKELIAREKSLEGRLETHSMTKRDNMKDLKKQFEQKQDAVKELNALKAERKSVQSTLHLEELNNRKRVLRRLGYLGNDDALVLKGSVACELSASDELILTEMLLKGIFNTLDVAQTAALLSCFVFQDKCAAPKLA-TELQTCLSELHEQARNVAKVSNECKMEVM----EDKYVSSFNPGLMDVVYQWVNGATFSEIVKTTDVFEGSIIRTLRRLEEVLREMINAAKALANKELEQKFEDARKNLKRDIVFAASLYL 1026          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Match: skih-2 (SKI (Yeast SuperKIller) Helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q19103])

HSP 1 Score: 419.853 bits (1078), Expect = 9.105e-128
Identity = 224/589 (38.03%), Postives = 340/589 (57.72%), Query Frame = 3
Query:  342 AKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGAD-----RIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCE----------------TLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDA-KQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAI----REEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDF-GWCILVSKLRSGKFKSLLV 2024
            A+++ F+LD FQ  ++ C+E  +++ V+AHTSAGKTV A Y IA C   K R +YT+PIKALSNQK+R+FK+ F DVGL+TGD+ +   A+ LIMTTEILR MLY  S +I+++ WV+FDE+HY+ ++ RG VWEE +I+LP  +++V LSAT+PN  +FA W+  +  +  NVI TD RP PL+H++Y  G D      ++++++  G+F+ + +N+A     K  +  K                                     LI  +    + P++VF FS+K C+  A+ML+ ++ TT+ EK+ + L F      L   D+ LPQ+  M +L  RG  +HH G++P+LKE+VE+LF +G +K LFATETF+MG+NMPA+ V+F S +K DG   RM+  GEY QM+GRAGRRGLD  G VI++  D T+   D  K +I G+   L S F +TY+MILNL+RVE +  E +++ S+ +  +  E       L + +  ++ +        S  S  R      A+     E +W  +  E+     L  GR + +   +      C+L+ K  + K   +LV
Sbjct:  286 ARKYPFSLDPFQQSSVLCMERGESLFVAAHTSAGKTVVAEYAIALCQAHKTRAVYTSPIKALSNQKFRDFKQIFGDVGLVTGDIQLHPEAACLIMTTEILRSMLYNGSEVIRDLEWVVFDEVHYINNEERGHVWEEVLIMLPAHVKIVMLSATVPNCVEFADWVGRIKNRKINVISTDRRPVPLEHFLY-TGQDGKTQKDLFKIIDRSGQFILKGYNDAKDSKAKIYEKEKAGGAGGRGTQRGGGRGGGGNGGGRNWPGKNDKNIYLNLINYMKCSDQLPMVVFVFSRKRCDENAQMLASMNLTTEVEKQHVRLFFSQCVQRLKGSDKELPQVLTMRDLCLRGFAVHHSGILPILKEVVELLFQKGYVKILFATETFAMGVNMPARCVVFDSIMKHDGTERRMLNPGEYTQMAGRAGRRGLDLTGTVIIICKDSTVPQPDVLKNLISGQALRLESKFRVTYSMILNLLRVEQLKIEDMLQRSYVESDSLRESKEKRKSLVDTKNAIQTMSTIECSTCSPNSQLRDYHDALAVFLRKSEHIWPKLNDENVINKLLCSGRFLIVNSAQQQLQNECVLLIKELNNKTLQILV 873          

HSP 2 Score: 92.4337 bits (228), Expect = 1.077e-18
Identity = 64/231 (27.71%), Postives = 119/231 (51.52%), Query Frame = 3
Query: 2400 EMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQND--LDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            E  ++   R+  E   + L  E++    L+  +E  +R ++L    F  +  +++ KGRI CEI    E+++TEL+LD +F   +  +L A LS    +      ++   D    +  E +K +   +  V+ + + ++     E       +  L+E+V  WA G+ F ++ E T+  EG I++CI+RLDE+   +  + R++G+  L +K  E S  I+R I+F++SLY
Sbjct: 1042 EHFSVLRDRIRIERKIESLEYELSSDALLLS-EEYHNRLKVLEALNF-VEQKMVSLKGRIGCEIH-HQELLITELILDYKFHQRSPAELAALLSTLTCQYNSGREMQFGGDTVFGEISESVKSVLTRLESVASKHKSQISDLGCE------IRFDLMEVVYEWANGTPFYQIMEMTDCQEGLIVKCIQRLDEVCKDVRNAGRIVGDPALVEKMEEVSASIRRDIVFAASLY 1263          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Match: helq-1 (HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q65XX0])

HSP 1 Score: 112.464 bits (280), Expect = 5.796e-25
Identity = 113/428 (26.40%), Postives = 188/428 (43.93%), Query Frame = 3
Query:  363 LDSFQNQAIQCIEN-----NQTVLVSAHTSAGKTVCAS-YTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDV-GLLTGDVTIDSN----------ASVLIMTTEILRLMLYRNSSI----IKEVGWVIFDEIHYMRDKSRGVVWEESI--ILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSK-LDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAML-NLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML 1571
            LD F +   +C+ +      +  ++S  T AGKT+ A    +   I  KR  I   P  A+  +K       FED  G+   +   +             SV + T E   +++  NS I    +  VG V+ DE+H + D  RG + E+ +   L     ++V +SAT+PN       +         V  T++RP  L  ++      +I Q +++  E  D         L  AGD   N++ +    G        C+ L K +    K+  ++F  +KK+CE  A +++K L    +  K      FL +  +    D    ++DA+L   +  G+  HH GL    ++ VE  F EGLI  + AT T + G+N+P + VI  + +         +   +Y+QM+GRAGR G DT G+ I ++
Sbjct:  165 LDKFYDWQQECLSDKRLLDGENCILSLPTGAGKTLIAEVLMLREAIVRKRNAILVLPYVAIVQEKISALAP-FEDAFGINIEEYASNKGRFPPIKRRKRVSVYVATIEKANMLI--NSLITQGQLDRVGMVVVDELHMIGDGGRGAILEQLLAKFLYKGTGQIVGMSATLPNIDDLKFALRAF------VYSTNFRPVELTEFV------KIGQTMHQVSENGD---------LNPAGDLPTNNLKSTDPDG-------ICQLLAKLI---PKNSAVIFCPNKKNCENVAVLIAKTLPAHIRQAKRAESDAFLQSYLS----DNDDERMDAVLKQCILSGVAYHHSGLTQDERKCVEAAFMEGLIYVVCATSTLAAGVNLPVRRVIIKAPM----VGRERLGKAQYLQMAGRAGRAGFDTKGDCITII 550          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14754622:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 113.235 bits (282), Expect = 6.172e-25
Identity = 122/483 (25.26%), Postives = 207/483 (42.86%), Query Frame = 3
Query:  276 IHEVVYPKNI-VYKPLKKRNSIPAK-------EFSFTLDSF---QNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEK--RRVIYTTPIKALSNQKYREFKEEFED-----VGLLTGDVTID----SNASVLIMTTE----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLP----------PAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNL-VRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMIT--SGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQ 1604
            +H  + PK+   +  L     +P K       E  +  D F   Q Q   C+ + +++ L+ A T +GKT+CA   +   +++    +V+Y  P+K+L  ++  ++K++FED     V  ++GDVT D    + +S+LI T E    I R    R    ++ VG ++ DE+H +    RG V E  +  L             +R++ LS  + NA   A+W+  +  + C       RP P+  +I              +G F  +++   M ++ K                  KAI ++            + PV++F  S++   + A     L       K+ + +  L   + +  I       D  L L +  GIG+HH GL    + IVE LF E  I+ L AT T + G+N PA  VI      FDG   + +     + +QM GRAGR   D +   ++ +      +DAK+
Sbjct: 1140 LHNCILPKSFKSHTDLLDLEPLPIKTLKNSKFEAIYNFDYFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVTPDPEELAASSILITTPEKWDGISRSWATR--EYVRRVGLIVLDEVHLL-GVDRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLG-IPDEACYNFRPSVRPVPISVHI--------------QG-FPGQHYCPRMGLMNKP---------------AYKAILTYS----------PRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIK------DENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYV------QDAKK 1566          

HSP 2 Score: 102.064 bits (253), Expect = 1.622e-21
Identity = 113/431 (26.22%), Postives = 185/431 (42.92%), Query Frame = 3
Query:  390 QCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKR-----------RVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTIDSN----ASVLIMTTEILRLMLYRNS---SIIKEVGWVIFDEIHYMRDKSRGVVWE-------ESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIY---TDYRPTPL-QHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLDTNGNVILMLDR 1577
            Q  +  + +L+ A T AGKT  A  TI + I E +           ++IY  P+KAL+ +    F +    +GL    LTGD  +  N      +L++T E   ++  +++   S+I  V  +I DE+H + D+ RG V E         + +    +R+V LSAT+PN    A++   L   P   ++     +RP PL Q +I    A          G F D         L    +   +++ +  KRG    +  H      K+ +         +F  +     A +L ++D      K++    ++ A   +  I R   QI     L +RG+GIHH GL    + ++E  F EG +  LF T T + G+N+PA  V+      FD         G  +  Q+ GRAGR   +  G+ I++  R
Sbjct:  322 QAYKTKENLLICAPTGAGKTNIAMLTILNTIHEHQNSRGDIMKDDFKIIYIAPMKALATEMTESFGKRLAPLGLKVKELTGDTQLSRNEVADTQMLVLTPEKWDVITRKSTSDNSLINVVRLLIIDEVHLLHDE-RGPVIETLVARTLRQVEMSQSGIRIVGLSATLPNFIDVARF---LRVNPYKGLFFFDGRFRPVPLTQKFIGTRKA----------GNFRDN--------LTLMDNVCYDEVVDFVKRGHQVLVFVHTRNGTAKLGE---------AFCAR-----ASVLGQMDLFLP--KDRASSKYIQADKAI-NICRNRAQISP---LFQRGMGIHHAGLCRQDRILMERCFAEGHVSVLFCTATLAWGVNLPAHAVVIKGTDVFDAEKGVFTDLGVLDVQQIFGRAGRPQFENEGHGIIITTR 710          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Match: Y54E2A.4 (pep chromosome:WBcel235:II:14768462:14778149:1 gene:WBGene00013189.1 transcript:Y54E2A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54E2A.4)

HSP 1 Score: 112.464 bits (280), Expect = 8.697e-25
Identity = 122/483 (25.26%), Postives = 207/483 (42.86%), Query Frame = 3
Query:  276 IHEVVYPKNI-VYKPLKKRNSIPAK-------EFSFTLDSF---QNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEK--RRVIYTTPIKALSNQKYREFKEEFED-----VGLLTGDVTID----SNASVLIMTTE----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLP----------PAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNL-VRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMIT--SGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQ 1604
            +H  + PK+   +  L     +P K       E  +  D F   Q Q   C+ + +++ L+ A T +GKT+CA   +   +++    +V+Y  P+K+L  ++  ++K++FED     V  ++GDVT D    + +S+LI T E    I R    R    ++ VG ++ DE+H +    RG V E  +  L             +R++ LS  + NA   A+W+  +  + C       RP P+  +I              +G F  +++   M ++ K                  KAI ++            + PV++F  S++   + A     L       K+ + +  L   + +  I       D  L L +  GIG+HH GL    + IVE LF E  I+ L AT T + G+N PA  VI      FDG   + +     + +QM GRAGR   D +   ++ +      +DAK+
Sbjct:  422 LHNCILPKSFKSHTDLLDLEPLPIKTLKNSKFEAIYNFDYFNPIQAQVFFCLYKTDKSALIGAPTGSGKTLCAELAMFRLLQDHPGMKVVYIAPLKSLVRERVDDWKKKFEDGMGYRVVEVSGDVTPDPEELAASSILITTPEKWDGISRSWATR--EYVRRVGLIVLDEVHLL-GVDRGAVLEAIVSRLKMITRRSHVTEEPVRLLGLSTALANAGDVAEWLG-IPDEACYNFRPSVRPVPISVHI--------------QG-FPGQHYCPRMGLMNKP---------------AYKAILTYS----------PRKPVLIFVSSRRQTRLTALAFVNLLIADHNPKQWLNMDMLELEDLMAAIK------DENLKLTLPFGIGMHHAGLSAHERAIVEQLFIEKKIQVLIATATLAWGINCPAHLVIVKGTEYFDGKKGKYVDFPVTDVLQMMGRAGRPQFDDSAVAVIYV------QDAKK 848          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Match: Mtr4 (gene:FBgn0001986 transcript:FBtr0080760)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 459/958 (47.91%), Postives = 645/958 (67.33%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVK---AIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-----KLRSGKFK---SLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHS------LKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            ++C HEV    +  Y PLK  + +PAKE+ F LD FQ QAI CI+N+Q+VLVSAHTSAGKTV A Y IA  +  K+RVIYTTPIKALSNQK+REF +EF+DVGL+TGDVTI+ +AS LIMTTEILR MLYR S I++EVGWV+FDEIHYMRDK RGVVWEE++ILLP  +R VFLSATIPNARQFA+W+ HLHKQPC+V+YTDYRPTPLQHYI+P G D I+ +V+EKG+F ++ F  AMAVL  AG++ K D    G+ GG+K   A +++   ++K + +    PVI+FSFSKK CE+YA  ++KLD+ T  EK+ ++ +F NA + L E DR LPQ++ +L L+RRGIGIHHGGL+P+LKE +EILFGEGLIK LFATETF+MGLNMPA+TV+FT+  KFDG   R I+SGEYIQM+GRAGRRGLD  G VILM+D  +     + +++G+ +P+NS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ  A LP L  ++ +K  +L ++ + ++   +I S++ +   L+   ++    I K     PFL PGRLV +     ++ W I+++     + R    K   S+ +D ++ V+     A   +    P K   R    +  +    I ++SS+ +   + L  +      LK   EA+K F      +    N I       D+  K  +  +    I + + ++E HP+    +   +   Y  ++  +     L+ E+    SL++MDELK RKR+LRR  +C   DVI  KGR+ACE+S+ DE+++TE++ +G F++LT  Q VA LSCFV +E  +E ++   +L   L  M++LAR I++VS EC+L++    D   YV+ FK  L+++V AW KGS+F+ +C+ T+I+EGSIIRC+RRL+ELL Q+ ++S+ IGN  LE KF E  +L+KR I+F++SLYL
Sbjct:  120 KSCTHEVAAHPDQEYIPLKPFSGVPAKEYPFVLDPFQRQAILCIDNSQSVLVSAHTSAGKTVVAEYAIAKSLAAKQRVIYTTPIKALSNQKFREFTDEFKDVGLVTGDVTINPSASCLIMTTEILRNMLYRGSEIMREVGWVVFDEIHYMRDKERGVVWEETLILLPDNVRYVFLSATIPNARQFAEWVCHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGIHLIVDEKGQFKEDNFTTAMAVLANAGEAGKGDQK--GRHGGIKGTNAGQTNIFKIVKMIMERNFAPVIIFSFSKKDCEIYAMQMAKLDFNTPDEKKLVDEVFNNAMDVLTEEDRRLPQVENVLPLLRRGIGIHHGGLLPILKETIEILFGEGLIKALFATETFAMGLNMPARTVLFTAPRKFDGKKFRWISSGEYIQMAGRAGRRGLDDKGIVILMIDEKVSPAVGRDIVQGKADPINSAFHLTYNMVLNLLRVEEINPEYMLERSFYQFQNQAALPGLHDQVEQKTLELNKLTIKDEH--NIASYHHIRSQLDQHGKQFRQWITKPQYLLPFLQPGRLVKVAAGSQEYDWGIVLNFKKQDQSRKNPLKAEPSVTIDVLLHVSE----AAAKTGDTEPCKPNERGCMEVVPVAHTLITQISSIRVYFPNDLRSADNRRAVLKTIQEAKKRFPLGPPVL----NPI------DDMNIKDREFRDIVNTISQFEKRLEEHPLHKSPELERIHRRYQDKVTLQKQLQDLKAELKAARSLLQMDELKHRKRVLRRMGYCKPGDVIEFKGRVACELSSADELLMTEMIFNGVFNDLTAPQAVALLSCFVCDEKSSESVKSATELSGPLRSMQDLARRIAKVSTECKLDL----DADTYVDKFKPFLMDVVLAWCKGSSFLAVCKMTDIFEGSIIRCMRRLEELLRQMCQASKTIGNTDLENKFSEGIRLLKRDIVFAASLYL 1055          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Match: tst (gene:FBgn0039117 transcript:FBtr0334895)

HSP 1 Score: 484.182 bits (1245), Expect = 3.570e-152
Identity = 334/978 (34.15%), Postives = 522/978 (53.37%), Query Frame = 3
Query:  318 LKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGA----DRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKD---PVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTI-KNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLV----------PGRLVHIKYNEHDFGWCILV-SKLRSGK---FKSLLVDCVI------PVAHESLFAKELSMAIPPPKHET-RPDG----NLFEIELKHIFELSSVVIGC-TDQLLHSLKKND--------------EARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQ-------IDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
             K++   PA +F F LD FQ QAI  +E  Q V V+AHTSAGKTV A Y IA   ++  R IYT+PIKALSNQKYR+F++ F+DVGL+TGD+ I+  AS LIMTTEILR MLY  S + +++ WVIFDE+HY+ +  RG VWEE IILLP  + ++ LSAT+PN  + A W+    K+   VI T  RP PL H++Y        D I+ +V+ +G++L   + +  AV RK     K      G R  + A +    T I  +  L++    PV+ F+ S+  C+     L  +D  T+ EK  ++  FL     L   DRT+PQ+  + + + RGIG+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  KFDG  +R +  GEYIQM+GRAGRRG D  G  I+M   ++  + + + +I G  E L S F L Y +IL  +R+E+I  E +M+ SF +F    +LP    +LR  E +   +P       ++G H +   +      E W   +++H    F+V           GR++ I   +H     IL+ +K   GK   +K L++D          +    L+ K LS+    P++ T +P G     + +I+   I  ++   +    D ++ + ++                +A  E      S I   + I  ++L K++    D        +D   +K+ E      N   F      E   +Y +R+  E   ++LR + N   +L    +  ++ ++LR  K+  + D +T KG++ACE+   +E+++TEL+L   F++L   ++ A LS  VF+  + +       L + +   +++   I  +++E R +    TD +        GL+E+V  WA+   F ++ + T + EG I+RCI++L+E L  +  ++  IGN  L+ K  EAS  IKR I+F++SLY
Sbjct:  248 FKEQIPCPAMDFPFELDVFQKQAILKLEQRQYVFVAAHTSAGKTVVAEYAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLITGDLQIEPTASCLIMTTEILRSMLYCGSDVTRDLEWVIFDEVHYINNPERGHVWEEVIILLPEHVNIIMLSATVPNTLELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFLLVDAQGKYLQGNYEK--AVERKKEMQGKAKGGGGGPRNHLNAKQEQY-TWIGLIDFLRRSNMMPVVAFTLSRNRCDSNLAALQSVDLNTEKEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALERGIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQMAGRAGRRGHDETGTAIIMCKGSVPPSMELRPMILGLPEKLQSQFILRYAVILTCLRIESIKVEDIMKFSFKEFNLKLQLPTQQKQLRLAEDKFAMLP-------TLGEHLQPLVNFYDKAVEYW---KEKHRIMKFVVTQPKIQKELKAGRVIVITQGKHYNKLAILLNTKSVPGKDTIYKVLVLDHQFKAKDSNSLQQGELYYKILSLT---PRNMTFQPVGIGGHTVLDIKAIDIISITKSTLKVDADAIIRNWEQRQLERFKDSPPSGSVVKAVTELNQLNESYIDNPDNIKYVNLSKEIIVNADSEVAMLNYVDHLLRKVGEFLPHT-NIAGFEQ----EFAKVYERRM-LEIHIEELRFK-NSARNLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEMGQ-NELLITELILCNMFNDLEPAEIAALLSGLVFQAKMQDKPVIPEALKECVAAFEQINDTI--LAEEQRFQAAIETDNR-----LNFGLLEVVYEWARNKPFAEIMKLTTVQEGIIVRCIQQLNETLRDVKTAAIRIGNPGLQSKMEEASAAIKRDIVFTASLY 1194          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Match: tst (gene:FBgn0039117 transcript:FBtr0084462)

HSP 1 Score: 484.182 bits (1245), Expect = 3.570e-152
Identity = 334/978 (34.15%), Postives = 522/978 (53.37%), Query Frame = 3
Query:  318 LKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGA----DRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKD---PVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTI-KNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLV----------PGRLVHIKYNEHDFGWCILV-SKLRSGK---FKSLLVDCVI------PVAHESLFAKELSMAIPPPKHET-RPDG----NLFEIELKHIFELSSVVIGC-TDQLLHSLKKND--------------EARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQ-------IDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
             K++   PA +F F LD FQ QAI  +E  Q V V+AHTSAGKTV A Y IA   ++  R IYT+PIKALSNQKYR+F++ F+DVGL+TGD+ I+  AS LIMTTEILR MLY  S + +++ WVIFDE+HY+ +  RG VWEE IILLP  + ++ LSAT+PN  + A W+    K+   VI T  RP PL H++Y        D I+ +V+ +G++L   + +  AV RK     K      G R  + A +    T I  +  L++    PV+ F+ S+  C+     L  +D  T+ EK  ++  FL     L   DRT+PQ+  + + + RGIG+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  KFDG  +R +  GEYIQM+GRAGRRG D  G  I+M   ++  + + + +I G  E L S F L Y +IL  +R+E+I  E +M+ SF +F    +LP    +LR  E +   +P       ++G H +   +      E W   +++H    F+V           GR++ I   +H     IL+ +K   GK   +K L++D          +    L+ K LS+    P++ T +P G     + +I+   I  ++   +    D ++ + ++                +A  E      S I   + I  ++L K++    D        +D   +K+ E      N   F      E   +Y +R+  E   ++LR + N   +L    +  ++ ++LR  K+  + D +T KG++ACE+   +E+++TEL+L   F++L   ++ A LS  VF+  + +       L + +   +++   I  +++E R +    TD +        GL+E+V  WA+   F ++ + T + EG I+RCI++L+E L  +  ++  IGN  L+ K  EAS  IKR I+F++SLY
Sbjct:  248 FKEQIPCPAMDFPFELDVFQKQAILKLEQRQYVFVAAHTSAGKTVVAEYAIALSKRDLTRTIYTSPIKALSNQKYRDFRKTFKDVGLITGDLQIEPTASCLIMTTEILRSMLYCGSDVTRDLEWVIFDEVHYINNPERGHVWEEVIILLPEHVNIIMLSATVPNTLELADWVGSTKKRKVYVISTLKRPVPLTHFLYTGAGGKSRDDIFLLVDAQGKYLQGNYEK--AVERKKEMQGKAKGGGGGPRNHLNAKQEQY-TWIGLIDFLRRSNMMPVVAFTLSRNRCDSNLAALQSVDLNTEKEKGAVQKFFLQCLAKLKPPDRTIPQVLVLKDALERGIGVHHSGILPILKEIVEMLFQNGLVKLLFATETFAMGVNMPARTVVFDSCKKFDGLEMRNLKPGEYIQMAGRAGRRGHDETGTAIIMCKGSVPPSMELRPMILGLPEKLQSQFILRYAVILTCLRIESIKVEDIMKFSFKEFNLKLQLPTQQKQLRLAEDKFAMLP-------TLGEHLQPLVNFYDKAVEYW---KEKHRIMKFVVTQPKIQKELKAGRVIVITQGKHYNKLAILLNTKSVPGKDTIYKVLVLDHQFKAKDSNSLQQGELYYKILSLT---PRNMTFQPVGIGGHTVLDIKAIDIISITKSTLKVDADAIIRNWEQRQLERFKDSPPSGSVVKAVTELNQLNESYIDNPDNIKYVNLSKEIIVNADSEVAMLNYVDHLLRKVGEFLPHT-NIAGFEQ----EFAKVYERRM-LEIHIEELRFK-NSARNLTLYPDYCNKLKVLRALKYIDELDEVTLKGKVACEMGQ-NELLITELILCNMFNDLEPAEIAALLSGLVFQAKMQDKPVIPEALKECVAAFEQINDTI--LAEEQRFQAAIETDNR-----LNFGLLEVVYEWARNKPFAEIMKLTTVQEGIIVRCIQQLNETLRDVKTAAIRIGNPGLQSKMEEASAAIKRDIVFTASLY 1194          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Match: obe (gene:FBgn0038344 transcript:FBtr0083147)

HSP 1 Score: 119.398 bits (298), Expect = 1.074e-26
Identity = 143/544 (26.29%), Postives = 239/544 (43.93%), Query Frame = 3
Query:  231 PINDIL-LKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFT-LDSFQNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKE--KRRVIYTTPIKALSNQKYREFKEEFEDVGL------LTGDVTIDSNA---SVLIMTTE-----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL---------LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESH--CETLIKKVFDLKKDPVIVFSFSKKSCEVYA-KMLSKLDYTTKPEK------EKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITS--GEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSF------HLTYNMILNLMRVETISPEYLMENSFFQ 1727
            P+ ++L L+ +P  +C+      KN+VY+ L          + FT  +  Q Q   C+   +  VL+ A T +GKT+ A   I   + +  K +V+Y  P+KAL  ++  ++++ F+   L      LTGDVT D  A   S LI+TT      I R   ++    ++ V  ++ DEIH +  + RG V E  +I+            A+R+V LS  + NA+  A W+  ++K          RP PLQ +I  NG             F  +++   MA +                R   +AI ++  CE            P IVF  S++   + A  +++ +   + P++      ++IELI  N R      ++ L    A       GIG+HH GL    ++ VE LF    I+ L AT T + G+N+PA  V+      FDG   + +     + +QM GRAGR   D  G  ++++    KN   K +   +  P+ SS       H+   ++   ++ +  + +YL    FF+
Sbjct: 1308 PLTELLPLRPLPV-SCL------KNVVYESL----------YKFTHFNPIQTQIFHCLYHTDNNVLLGAPTGSGKTIVAEIAIFRALNQNPKCKVVYIAPLKALVKERIADWEQRFQRSSLGLKVVELTGDVTPDIQAIRESQLIVTTPEKWDGISR--SWQTREYVQHVSLIVIDEIHLL-GEDRGPVIE--VIVSRTNFISSHTGRAIRIVGLSTALANAQDLANWLG-INKMGLYNFKPSVRPVPLQVHI--NG-------------FPGKHYCPRMATM---------------NRPTFQAIRTYSPCE------------PTIVFVSSRRQTRLTALDLITFVAGESNPKQFLHIPEDEIELILQNIR------EQNLKFCLAF------GIGLHHAGLQEQDRKCVEELFLNRKIQILVATATLAWGVNLPAHLVVIKGTEYFDGKVKKYVDMPITDVLQMMGRAGRPQFDNEGVAVVLVHDEKKNFYKKFLY--DPFPVESSLLGVLPEHINAEIVAGTVQSKQAALDYLTWTYFFR 1772          

HSP 2 Score: 85.8853 bits (211), Expect = 1.925e-16
Identity = 95/421 (22.57%), Postives = 182/421 (43.23%), Query Frame = 3
Query:  402 NNQTVLVSAHTSAGKTVCASYTIASCIK----------EKRRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTID----SNASVLIMTTEILRLMLYRNS---SIIKEVGWVIFDEIHYMRDKSRGVVWE----ESIILLPPA---MRMVFLSATIPNARQFAQWIAHLHKQPCNVIY---TDYRPTPLQ-HYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFL---NARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLDTNG 1553
            +N+ +LV A T AGKT  A  +I   I+          ++ +++Y  P+KAL+ +    F +  + + +    LTGD+ +     +   +L+ T E   ++  + S   ++I  V  +I DE+H +  + RG V E     ++ L+  +   +R+V LSAT+PN    A +   L   P   ++   + +RP PL  +++      ++ Q+                            DMD    +  V+ ++   +             ++VF  ++ +    A ++ +L      ++     +FL   +A + L        +   ++ L   G+ +HH G++   +++VE  F EG I  L  T T + G+N+PA  VI      +D  +   +  G  + +Q+ GRAGR   D +G
Sbjct:  501 SNENMLVCAPTGAGKTNVAMLSIVHTIRCHLEQGVINRDEFKIVYIAPMKALAAEMVDNFSKRLKSLQIAVRELTGDIQLTKAEMAATQILVTTPEKWDVVTRKGSGDVALISLVELLIIDEVHLLHGE-RGPVVEALVARTLRLVESSQSMIRIVGLSATLPNYIDVAHF---LRVNPMKGLFYFDSRFRPVPLDTNFVGIKSVKQLQQIA---------------------------DMDQCCYQKCVEMVQEGHQ-------------IMVFVHARNATVRTANVIREL-----AQQNNTSALFLPKDSAAHGLATRSIQRSRNKQLVELFSCGLAMHHAGMLRADRQMVEKYFVEGHISVLVCTATLAWGVNLPAHAVIIRGTDIYDAKHGSFVDLGILDVLQIFGRAGRPQFDKSG 872          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Match: DNApol-theta (gene:FBgn0002905 transcript:FBtr0082662)

HSP 1 Score: 96.2857 bits (238), Expect = 1.210e-19
Identity = 123/466 (26.39%), Postives = 195/466 (41.85%), Query Frame = 3
Query:  414 VLVSAHTSAGKTVCASYTIASCIKEK-RRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTIDS---NASVLIMTTEILRLMLYR--NSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRM----------VFLSATIPNARQFAQWI-AHLHKQPCNVIYTDYRPTPLQHYI------YPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIF-------LNARNTLPEIDRTLPQIDAMLNLVRR-----GIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETIS 1694
            ++ SA TSAGKT+ +   +   + E+ ++V+   P  ++  +K    ++     G       G  T      +  V I T E    ++ +      ++ +G V+ DE+H + DK RG + E   +LL   + M          + +SAT+ N +    W+ A L+        T+YRP  L+  I      Y +    +  V  +K             VL K  +   ND D++     +  IE+  E             VIVF  SK  CE  A  L+   +     + K E +        LN R  + E+ + L  I   L+ V           HH GL    ++I+E  F  G +K L AT T S G+N+PA+ V+  S L F G  +  +T   Y QM GRAGR G DT G  IL+ +  I     + ++  E +P+ S   +  +  L    +E IS
Sbjct:  252 LVYSAPTSAGKTLVSEILMLKTVLERGKKVLLILPFISVVREKMFYMQDLLTPAGYRVEGFYGGYTPPGGFESLHVAICTIEKANSIVNKLMEQGKLETIGMVVVDEVHLISDKGRGYILE---LLLAKILYMSRRNGLQIQVITMSATLENVQLLQSWLDAELY-------ITNYRPVALKEMIKVGTVIYDHRLKLVRDVAKQK-------------VLLKGLE---NDSDDVA----LLCIETLLEGC----------SVIVFCPSKDWCENLAVQLATAIHV----QIKSETVLGQRLRTNLNPR-AIAEVKQQLRDIPTGLDGVMSKAITYACAFHHAGLTTEERDIIEASFKAGALKVLVATSTLSSGVNLPARRVLIRSPL-FGGKQMSSLT---YRQMIGRAGRMGKDTLGESILICNE-INARMGRDLVVSELQPITSCLDMDGSTHLKRALLEVIS 667          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Match: mtrex (Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GENE-040426-2854])

HSP 1 Score: 911.753 bits (2355), Expect = 0.000e+0
Identity = 468/953 (49.11%), Postives = 651/953 (68.31%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKN---DMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKS-------LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            + C HEVV P N  Y PLK R    AKE+ F LD FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTDYRPTPLQHYI+P G D ++ VV+E GEF ++ FN AM VLR AGD+  N     D  G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VI M+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ R+++ E++   I +  +E  S+ ++Y++ + L  + +E+   I K     PFL PGRLV +K  + DFGW ++V+  +    K+        +V+ ++  + +S+       A P    E + +  +  + L  I  +SSV +     L     +  + R+  L     +  R+ + I L+D   D+  K   + +  QK++  + ++  HP+ + D +LE +  L  K+    G     + E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  NE+ +    L   L +M+E A+ I++VS E +LEV    DE +Y+  F+  L+++V  WA GS+F ++C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF      IKR I+F++SLYL
Sbjct:   96 EGCTHEVVLPANEEYTPLKPRVGKAAKEYPFILDPFQREAILCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHHVFLSATIPNARQFAEWICHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGLHLVVDENGEFREDNFNTAMQVLRDAGDTGGNTGAKWDPKGRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVSKLDFNTDEEKKLVEEVFNNATDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAVPGVVDRMKKLEEEYNAIRIPKEE--SVVTYYKIRQQLAKLGKEIEEFIHKPRYCLPFLQPGRLVKVKKEDLDFGWGVVVNFQKKSNVKAGGDLDPLFVVEVLVHCSKDSVKNAATESARPAGPAE-KGEMQVVPVILHLITSISSVRLYIPKDL-----RPYDNRQSMLKSIQEVQKRFPDGIPLLDPIDDMGIKDPALKKVIQKVEAFEHRMYTHPL-HSDPNLEAVYKLCEKKALIAGDIKAAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLTAEQATALLSCFVFQENANEMPKLTEQLGGPLRQMQECAKRIAKVSAEAKLEV----DEDSYLNQFRPHLMDVVYTWANGSSFSQICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFATGITKIKRDIVFAASLYL 1034          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Match: skiv2l (SKI2 homolog, superkiller viralicidic activity 2-like [Source:ZFIN;Acc:ZDB-GENE-010430-5])

HSP 1 Score: 521.931 bits (1343), Expect = 8.201e-166
Identity = 325/962 (33.78%), Postives = 518/962 (53.85%), Query Frame = 3
Query:  324 KRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESH----------CETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEI-PLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH--DFGWCILVSKLRSGKFKSLLVDC----------------VIPVAHESLFAKELSMAIPPPKHETR--PDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSII----ARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            KR   PA ++ F LD FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F DVGLLTGDV ++   S LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+   VI T  RP PL+HY+Y   + +    ++ +++  G FL + +  A+       ++ K       +  G K +  H           +TL+  +   ++ PV+ F+FS+  C+  A+ L+ LD TT  EK +I      +   L   DR LPQI  M +L++RGIG+HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    + +  +   ++ G+   L+S F LTY MILNL+RVE +    +M+ SF   + + +      R+ E    L  + PL  +  LS + S+Y     L+   + +  ++ +       L  GR+V +  ++H    G  + VS     +  + L+ C                 +P+  ++LF  E      P  H  +     ++  I  K +  +   +I   ++ L    + D   +        ++    A    + ++D   DL  K   + E   + + LQ  +++    +     E      +R+  +   DKL   ++ + SL  + E   R ++L   ++   +  +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC VF +         N L + + ++  +A+ I  + ++C +    A   + +V  FK GL E+V  WA+G  F ++ + T++ EG+I+RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct:  306 KRIPDPAFKYPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKNTFGDVGLLTGDVQLNPEGSCLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPEHVSIILLSATVPNAVEFSEWIGRIKKRHIYVISTIKRPVPLEHYLYTGNSTKTQKELFMLLDATGNFLTKGYYAAV-------EAKKERTSKHAQSFGTKNVSQHNTTASQDRAVWQTLLNYLSQRQQTPVVAFTFSRTRCDENARSLTSLDLTTSIEKSEIHSFLQKSLTRLRGGDRQLPQILLMRDLLKRGIGVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAGVHDMGELHSMMLGKPTVLHSQFRLTYTMILNLLRVEALRVTDMMKRSF--SENHRDTQAHEKRISELRNTLSSLPPLDTEGQLSDLLSYYHTITELHITTQSLQQAVLESVNGLKALSVGRVVIVNNSQHHNSLGVILQVSSDAVNRTFTALIICEKGNEEAASDEQSNKVALPIYSKTLFIPE-----GPCSHTVQKLKLQDISAITTKALKVIPERIIDNYNKRLQPRFRLDPPGQAISTATQELLRLAEANMGGMTVLDPVNDLHLKGVDVVEGVMRQRVLQDSLKDFHCIHSPTFSEQFTRVQERMSVQEELDKLLFLVSDQ-SLTLLPEYHQRIKVLEALQYVDSSGAVQLKGRVACQISSHELLLTELLFEN-TLSPLAPEESAALLSCLVFTQNTQIEPHITNTLQEGINQVLAVAQRIGDLQRDCGI----AQTAEDFVAQFKFGLTEVVYCWARGMPFAEIAQLTDVQEGTIVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1247          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Match: skiv2l (SKI2 homolog, superkiller viralicidic activity 2-like [Source:ZFIN;Acc:ZDB-GENE-010430-5])

HSP 1 Score: 508.064 bits (1307), Expect = 3.333e-160
Identity = 325/990 (32.83%), Postives = 518/990 (52.32%), Query Frame = 3
Query:  324 KRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDK----------------------------SRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESH----------CETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEI-PLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH--DFGWCILVSKLRSGKFKSLLVDC----------------VIPVAHESLFAKELSMAIPPPKHETR--PDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSII----ARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            KR   PA ++ F LD FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F DVGLLTGDV ++   S LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D                              RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+   VI T  RP PL+HY+Y   + +    ++ +++  G FL + +  A+       ++ K       +  G K +  H           +TL+  +   ++ PV+ F+FS+  C+  A+ L+ LD TT  EK +I      +   L   DR LPQI  M +L++RGIG+HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    + +  +   ++ G+   L+S F LTY MILNL+RVE +    +M+ SF   + + +      R+ E    L  + PL  +  LS + S+Y     L+   + +  ++ +       L  GR+V +  ++H    G  + VS     +  + L+ C                 +P+  ++LF  E      P  H  +     ++  I  K +  +   +I   ++ L    + D   +        ++    A    + ++D   DL  K   + E   + + LQ  +++    +     E      +R+  +   DKL   ++ + SL  + E   R ++L   ++   +  +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC VF +         N L + + ++  +A+ I  + ++C +    A   + +V  FK GL E+V  WA+G  F ++ + T++ EG+I+RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct:  306 KRIPDPAFKYPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKNTFGDVGLLTGDVQLNPEGSCLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAEVNHPLINIVQFYFSLYRIQMSHNVVVFQRGVVWEEVLIMLPEHVSIILLSATVPNAVEFSEWIGRIKKRHIYVISTIKRPVPLEHYLYTGNSTKTQKELFMLLDATGNFLTKGYYAAV-------EAKKERTSKHAQSFGTKNVSQHNTTASQDRAVWQTLLNYLSQRQQTPVVAFTFSRTRCDENARSLTSLDLTTSIEKSEIHSFLQKSLTRLRGGDRQLPQILLMRDLLKRGIGVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAGVHDMGELHSMMLGKPTVLHSQFRLTYTMILNLLRVEALRVTDMMKRSF--SENHRDTQAHEKRISELRNTLSSLPPLDTEGQLSDLLSYYHTITELHITTQSLQQAVLESVNGLKALSVGRVVIVNNSQHHNSLGVILQVSSDAVNRTFTALIICEKGNEEAASDEQSNKVALPIYSKTLFIPE-----GPCSHTVQKLKLQDISAITTKALKVIPERIIDNYNKRLQPRFRLDPPGQAISTATQELLRLAEANMGGMTVLDPVNDLHLKGVDVVEGVMRQRVLQDSLKDFHCIHSPTFSEQFTRVQERMSVQEELDKLLFLVSDQ-SLTLLPEYHQRIKVLEALQYVDSSGAVQLKGRVACQISSHELLLTELLFEN-TLSPLAPEESAALLSCLVFTQNTQIEPHITNTLQEGINQVLAVAQRIGDLQRDCGI----AQTAEDFVAQFKFGLTEVVYCWARGMPFAEIAQLTDVQEGTIVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1275          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 129.413 bits (324), Expect = 7.169e-30
Identity = 119/461 (25.81%), Postives = 205/461 (44.47%), Query Frame = 3
Query:  318 LKKRNSIPAK------EFSFTLDSFQNQAIQ-CIENNQTVLVSAHTSAGKTVCASYTIASCIKEKR------RVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTID-----SNASVLIMTTEILRLML--YRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL--------------PPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTD--YRPTPLQHYI--YPNGADRIYQVVNEKGEF-LDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAML-NLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILM 1568
            L+  + IPAK      +F +  +  Q+QA+   + +N+  +  A T +GKTV     I   + E        R +Y  PIKAL +Q+Y  +K++F  +GL    LTGD  ID      +A ++  T E    M   ++++ ++  +   + DE+H ++DK+RG   E  +  +                ++R V +SATIPN +  ++W++     P   +  D  +RP  L+  +  +P G++        + EF  D   N  +A                               +I+   D K  P +VF  ++K  +  A +L+         K+   ++ ++ +  L +   +L  +DA L +L   GIG HH G+    ++I E  F  G +  LF T T +MG+NMPA  V+  S + + G      +  + +QM GRAGR   DT    ++M
Sbjct:  224 LRSVSEIPAKFRSVFKDFPY-FNYVQSQALDDVLYSNKNFVACAPTGSGKTVLFELAIVRLLIEASEPWHNVRAVYMAPIKALCSQQYDNWKQKFGPLGLKCKELTGDTEIDDFFEIQDAHLIFTTAEKWDSMTRRWKDNCLLTSIRLFLVDEVHVVKDKTRGATLEVVVSRMKTMHFYRQAINPESKASVRFVAVSATIPNIQDVSEWLSD-ESGPATCLEMDESHRPVKLRKVVLGFPCGSN--------QNEFKFDLSLNYKLA------------------------------NIIQTYSDQK--PTLVFCSTRKGVQQSASVLA---------KDARFIMSIDHKQRLVKYANSL--LDAKLRDLFVYGIGYHHAGMDVSDRKITENAFTVGDLPVLFTTSTLAMGVNMPAHLVVIKSTMHYVGGACEEYSEADLLQMIGRAGRPQFDTTATAVIM 631          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Match: polq (polymerase (DNA directed), theta [Source:ZFIN;Acc:ZDB-GENE-040724-232])

HSP 1 Score: 119.783 bits (299), Expect = 1.115e-26
Identity = 114/445 (25.62%), Postives = 203/445 (45.62%), Query Frame = 3
Query:  405 NQTVLVSAHTSAGKTVCASYTIASCIKEKR-RVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNAS-------VLIMTTEILRLMLYRNSSIIKE-----VGWVIFDEIHYMRDKSRGVVWEESIILL-------------PPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKD--PVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNAR---NTLPEIDRTLPQIDAMLN-LVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSF 1643
             Q ++ SA TSAGKT+ +   I   + E R + ++  P  +++ +K    +  F++ G+        ++A+       V + T E    ++ R   +I+E     +G V+ DE+H + D  RG + E  +  +                ++++ +SAT+PN    A+W++        +  T+YRP PL  ++      +I   + +    L   F  A+ +        K D D+I                +   F+  +D    ++F  SK  CE  A  + +  Y       K + IFLN     + L ++ RT   +D +L   V  G+  HH GL    ++I+E  F +G I+ L AT T S G+N+PA+ VI  + + F+G  + ++T   Y QM GRAGR+G+DT G  +L+  +  +      +I+G  +P++S  
Sbjct:  116 GQNLVYSAPTSAGKTLVSELLILKRVLETRQKAMFILPFVSVAREKMFYLQNVFQEAGIRVEGYMGSTSAAGGFSALDVAVCTIEKANGLVNR---LIEEDKLDLLGTVVVDELHMVGDSGRGYLLELLLTKIRYIAQKTATRYSTSTGVQIIGMSATLPNLDLLARWLS------AELYSTNYRPVPLMEWV------KIGTNIYDGSLNLVRQFTPALPI--------KGDDDHI----------------VSLCFETVQDGHSALLFCPSKNWCEKLADSIGREFYNLH---HKGQSIFLNQEGLLDVLAQLKRTPAGLDHVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGYIRVLAATSTLSSGVNLPARRVIIRTPV-FNGHLLDILT---YKQMVGRAGRKGVDTIGESVLVC-KEAERAKGMSLIQGSLKPISSCL 513          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Match: MTREX (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100496866])

HSP 1 Score: 917.916 bits (2371), Expect = 0.000e+0
Identity = 472/954 (49.48%), Postives = 662/954 (69.39%), Query Frame = 3
Query:  264 TQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRV---EINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
             + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y+IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P+G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P +  ++++ E+Q   I + N+E  ++ ++Y++ + L  + +E+   I K     PF+ PGRLV +K  + DFGW  +V+       K  SG+   L +V+ +I  + ES+     + A  P + + R +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK +  + ++ +HP+ N+D +LE  +LY    +   IA  +R    E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  +E+ +    L   L +M+E AR I++VS E +LEV    DE+ Y+ +F+  L++++  WA G+TF ++C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:  100 VEGCTHEVALPADEEYVPLKPRVGKAAKEYPFVLDAFQREAILCIDNNQSVLVSAHTSAGKTVCAEYSIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPSGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMSKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVILMVDEKMSPTVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVAEKVKKLEEQYNSIQIPNEE--NVVTYYKIRQQLAKLGKEIEDYIHKPKYCLPFMQPGRLVKVKSEDDDFGWGAVVNFSKKSNVKPNSGELDPLYVVEVLINCSKESV-KNAATEAAKPARPDERGEMQVVPVMLHTLCAISSVRLYIPKDL-----RTTDNRQSVLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVVQKTEAFEHRMYSHPL-NNDPNLE--SLYKLCEKKAQIAVDIRAAKRELKKARTVLQMDELKCRKRVLRRLGFATASDVIEMKGRVACEISSADELLLTEMMFNGLFNDLTAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQETARRIAKVSAEAKLEV----DEETYLGSFRSNLMDVLYTWANGATFAQICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1035          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Match: MTREX (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100496866])

HSP 1 Score: 903.664 bits (2334), Expect = 0.000e+0
Identity = 464/940 (49.36%), Postives = 651/940 (69.26%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRV---EINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQL 3050
            + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y+IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P+G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P +  ++++ E+Q   I + N+E  ++ ++Y++ + L  + +E+   I K     PF+ PGRLV +K  + DFGW  +V+       K  SG+   L +V+ +I  + ES+     + A  P + + R +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK +  + ++ +HP+ N+D +LE  +LY    +   IA  +R    E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  +E+ +    L   L +M+E AR I++VS E +LEV    DE+ Y+ +F+  L++++  WA G+TF ++C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E   L
Sbjct:   97 EGCTHEVALPADEEYVPLKPRVGKAAKEYPFVLDAFQREAILCIDNNQSVLVSAHTSAGKTVCAEYSIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPSGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMSKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVILMVDEKMSPTVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVAEKVKKLEEQYNSIQIPNEE--NVVTYYKIRQQLAKLGKEIEDYIHKPKYCLPFMQPGRLVKVKSEDDDFGWGAVVNFSKKSNVKPNSGELDPLYVVEVLINCSKESV-KNAATEAAKPARPDERGEMQVVPVMLHTLCAISSVRLYIPKDL-----RTTDNRQSVLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVVQKTEAFEHRMYSHPL-NNDPNLE--SLYKLCEKKAQIAVDIRAAKRELKKARTVLQMDELKCRKRVLRRLGFATASDVIEMKGRVACEISSADELLLTEMMFNGLFNDLTAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQETARRIAKVSAEAKLEV----DEETYLGSFRSNLMDVLYTWANGATFAQICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGKCL 1018          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Match: MTREX (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100496866])

HSP 1 Score: 859.366 bits (2219), Expect = 0.000e+0
Identity = 443/902 (49.11%), Postives = 622/902 (68.96%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRV---EINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEG 2936
            + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y+IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P+G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P +  ++++ E+Q   I + N+E  ++ ++Y++ + L  + +E+   I K     PF+ PGRLV +K  + DFGW  +V+       K  SG+   L +V+ +I  + ES+     + A  P + + R +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK +  + ++ +HP+ N+D +LE  +LY    +   IA  +R    E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  +E+ +    L   L +M+E AR I++VS E +LEV    DE+ Y+ +F+  L++++  WA G+TF ++C+ T+++EG
Sbjct:   97 EGCTHEVALPADEEYVPLKPRVGKAAKEYPFVLDAFQREAILCIDNNQSVLVSAHTSAGKTVCAEYSIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPSGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMSKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVILMVDEKMSPTVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVAEKVKKLEEQYNSIQIPNEE--NVVTYYKIRQQLAKLGKEIEDYIHKPKYCLPFMQPGRLVKVKSEDDDFGWGAVVNFSKKSNVKPNSGELDPLYVVEVLINCSKESV-KNAATEAAKPARPDERGEMQVVPVMLHTLCAISSVRLYIPKDL-----RTTDNRQSVLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVVQKTEAFEHRMYSHPL-NNDPNLE--SLYKLCEKKAQIAVDIRAAKRELKKARTVLQMDELKCRKRVLRRLGFATASDVIEMKGRVACEISSADELLLTEMMFNGLFNDLTAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQETARRIAKVSAEAKLEV----DEETYLGSFRSNLMDVLYTWANGATFAQICKMTDVFEG 980          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Match: MTREX (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100496866])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 420/902 (46.56%), Postives = 593/902 (65.74%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRV---EINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEG 2936
            + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y+IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQ                                 G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P +  ++++ E+Q   I + N+E  ++ ++Y++ + L  + +E+   I K     PF+ PGRLV +K  + DFGW  +V+       K  SG+   L +V+ +I  + ES+     + A  P + + R +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK +  + ++ +HP+ N+D +LE  +LY    +   IA  +R    E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  +E+ +    L   L +M+E AR I++VS E +LEV    DE+ Y+ +F+  L++++  WA G+TF ++C+ T+++EG
Sbjct:   97 EGCTHEVALPADEEYVPLKPRVGKAAKEYPFVLDAFQREAILCIDNNQSVLVSAHTSAGKTVCAEYSIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQ---------------------------------GDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMSKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVILMVDEKMSPTVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVAEKVKKLEEQYNSIQIPNEE--NVVTYYKIRQQLAKLGKEIEDYIHKPKYCLPFMQPGRLVKVKSEDDDFGWGAVVNFSKKSNVKPNSGELDPLYVVEVLINCSKESV-KNAATEAAKPARPDERGEMQVVPVMLHTLCAISSVRLYIPKDL-----RTTDNRQSVLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVVQKTEAFEHRMYSHPL-NNDPNLE--SLYKLCEKKAQIAVDIRAAKRELKKARTVLQMDELKCRKRVLRRLGFATASDVIEMKGRVACEISSADELLLTEMMFNGLFNDLTAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQETARRIAKVSAEAKLEV----DEETYLGSFRSNLMDVLYTWANGATFAQICKMTDVFEG 947          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Match: SKIV2L (Ski2 like RNA helicase [Source:NCBI gene;Acc:100038207])

HSP 1 Score: 548.895 bits (1413), Expect = 6.300e-177
Identity = 349/952 (36.66%), Postives = 529/952 (55.57%), Query Frame = 3
Query:  342 AKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGA----DRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLK-KD--PVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIP--LSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDF--GWCILVSKLRSGKFKSLLV----DCVIPVAHESLFAKELSMAIPPPKHET-----RPDGNLFEIELKHIFELSSVVIGCT-----DQLLHSLKKNDEAR------KEFLNKRNSIIARYNTIFLIDLKK-----DLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            A +  F LD FQ +AIQC+E   +V ++AHTSAGKTV A Y IA  +K   R IYT+PIKALSNQK+R+FK  F DVGL+TGDV + + AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PN  +FA WI  + K+   VI T  RP PL+HY+Y   +    ++ + +++  G F  + +  A+    K   SSK       K            T +  V  LK +D  PV+VF+FS+  CE  A  LS +D  +  EK +++  +    + L   DR LPQ+  ML+L++RGIGIHH G++P+LKE+VE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+N R +T GEYIQM+GRAGRRGLD  G VI++    +    D  +++ G+   L S F LTY+MILNL+RVE +  E +M+ SF + +T  +      R++   +QL ++     + +   +  ++   + L   RE +   + +       L  GR++ I    H +  G  + VS   + +  + LV       I V H+    KE+  A P P+        RP+G      LK      ++V G T     D++L  + K+   R         L+     +AR   +    L       DL+ K  ++ E   + + L+  +++   +N  +      L  +R +     ++LR  +    SL  + E + R  +LR  ++  D   +  KGR+ACE+S+  E+++TEL+LDG  S L  +++ A LSC VF+          + L + ++K++ELA  ++ + +EC L        + +V  +K GL E+V  WA+G  F ++   T+I EG I+RC++RLDE    +  ++R++G+  L  K   ASQLIKR IIF++SLY
Sbjct:  205 AFKHPFELDPFQKKAIQCLEAGSSVFIAAHTSAGKTVVAEYAIALSLKHMTRAIYTSPIKALSNQKFRDFKITFGDVGLITGDVQLYTGASCLIMTTEILRSMLYNGSDVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPDHVNIILLSATVPNTVEFADWIGRIKKKKIYVISTTRRPVPLEHYLYTGNSQKTQNQFFLLLDALGGFQTKGYYAAVEA--KKERSSKYSQTFGAKHPHGVGPGHDKGTWLSLVQSLKIRDALPVVVFTFSRTRCEQNATALSTVDLCSTAEKSEVQTYYTKCLSRLRGADRQLPQVLHMLDLLKRGIGIHHSGILPILKEVVEMLFSRGLVKILFATETFAMGVNMPARTVVFDSIRKHDGSNFRDLTPGEYIQMAGRAGRRGLDNTGMVIILCKADVPEMSDLHKMMLGKPTQLQSQFRLTYSMILNLLRVEALRVEDMMKRSFAESRTQRDSKAHEQRIKLLTQQLADVGDIECSGDLADLHDYFVTVQELIYTRETVQKRVVESINGMKCLSVGRIIIINTEYHSWVPGVILQVSSDAANRIYTTLVLYEKRREIGVLHQETREKEVKKA-PVPEDLLMGKVFRPEGPCDYRLLKLRSSDINIVTGKTLRIHADKILDDIAKSQMPRYRNDPPGPALSSVTQELARLADLPSGSLSSLCPVNDLQLKELELVEAVSRGKRLEEALQSFSCYNSPRFNTQYILLEQRSQVLNELERLRF-LTSDQSLSLLPEYQQRVNVLRTLQYIDDGGAVQLKGRVACEVSS-HELLVTELVLDGALSPLAPEEIAALLSCLVFQHKTQCEPRLTDTLKQGVKKVRELAERLALIQRECGLR----ESVEDFVAQYKFGLTEVVYEWARGMPFSEIMTLTDIQEGLIVRCVQRLDEACRDVRSAARLVGDATLCAKMDAASQLIKRDIIFAASLY 1147          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Match: Mtrex (Mtr4 exosome RNA helicase [Source:MGI Symbol;Acc:MGI:1919448])

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 464/952 (48.74%), Postives = 658/952 (69.12%), Query Frame = 3
Query:  264 TQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
             + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AIQC++NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGLIK LFATETF+MG+NMPA+TV+FT+A K+DG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ +++  E+Q  +I + N+E + I  +Y++ + L  + +E+   I K     PFL PGRLV +K    DFGW ++V+       K  SG+   L +V+ ++  + ESL     + A  P K + + +  +  + +  +  +S+V +     L     +  + R+  L     +  R+ + + L+D   D+  +   + +  QK++  + ++ +HP+ N D +LE +  L  ++ +        + E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++L+ +Q  A LSCFVF+E  +E+ +    L   L +M+E A+ I++VS E +LE+    DE+ Y+ +FK  L+++V  WA G+TF  +C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:  105 VEGCTHEVALPADEDYIPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVI--YYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESL-KNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDL-----RPVDNRQSVLKSIQEVQRRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHN-DPNLETVYTLCERKAQIALDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEI----DEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1040          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Match: Skiv2l (superkiller viralicidic activity 2-like (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1099835])

HSP 1 Score: 524.628 bits (1350), Expect = 9.103e-167
Identity = 337/969 (34.78%), Postives = 519/969 (53.56%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIY----PNGADRIYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILML-DRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQF----------QTYAELPNLITRLREKE--KQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD--FGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETR--------PDG----NLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIF--LIDLKKDLKCKPDQIDEYDQKIQELQTK----IENHPMFNHDKSLEMIN----LYHKRLEYEGIADKLRVEINKKVSLIKM----------DELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            PA +++F  D FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+F+  F DVGLLTGDV +   AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +FA WI  L ++   VI T  RP PL+HY++    P     ++ +++ +G F  + +  A+     R +  +          +GG         +L+  +    + PV+VF+FS+  C+  A  L+ LD TT  EK +I L        L   DR LPQ+  M  L+RRG+G+HH G++P+LKEIVE+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG+  R +  GEY+QM+GRAGRRGLD  G VIL+   R  +  D  +++ G+   L S F LTY MILNL+RV+ +  E +M+ SF +F          Q  A+L   +  L E +   QL ++P    EY S      L ++ N I+  +  S+    +    L  GR+V +K  EH    G  + VS   + +  + LV C  PV  ++   ++   A P   H           P+G     + +++   +  +S+ V+    +    + ++   R++   +++  +A   T    L+ L +     P  +D     I +LQ K    +E        K  E+I     ++  R   + +  + R++I K++  ++            E   R  +LR   +  +   +   GR+AC +S+  E++LTEL+ D   S L  +++ A LS  V +   +   +  + L + +E++K +A+ I  V   C L     T E+ +V     GL+E+V  WA+G  F +L   +   EG ++RCI+RL E+   L  ++R++G   L  K   A+ L++R I+F++SLY
Sbjct:  300 PAFQWAFEPDVFQKQAILHLEQHDSVFVAAHTSAGKTVVAEYAIALAQKHMTRTIYTSPIKALSNQKFRDFRNTFGDVGLLTGDVQLHPEASCLIMTTEILRSMLYSGSDVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPEHVSIILLSATVPNALEFADWIGRLKRRQIYVISTVARPVPLEHYLFTGNSPKTQGELFLLLDSRGAFHTQGYYAAVEAKKERMSKHAQTFGAKQPTHQGGPAQDRGVYLSLLASLRTRAQLPVVVFTFSRGRCDEQASGLTSLDLTTSSEKSEIHLFLQRCLARLRGSDRQLPQVLHMSELLRRGLGVHHSGILPILKEIVEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSMRKHDGSTFRDLLPGEYVQMAGRAGRRGLDPTGTVILLCKGRVPEMADLHRMMMGKPSQLQSQFRLTYTMILNLLRVDALRVEDMMKRSFSEFPSRKDSKAHEQALADLTKRLGALEEPDVTGQLADLP----EYYSWAEE--LTETQNMIQRRIMESVNGLKS----LSVGRVVVVKNEEHHNALGVILQVSSNSTSRVFTTLVLCDKPVVSDN--PRDKGPATPDVPHPDDLIGFKLFLPEGPCEHTVAKLQPGDVAAISTKVLRVNGE---KISEDFSKRQQPKFRKDPPLAAVTTAVQELLRLAQSYPAGPPTLD----PINDLQLKDVAVVEGG--LRARKLEELIRGAQCVHSPRFPAQYVKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEAGTVKLAGRVACAMSS-HELLLTELMFDNALSALRPEEIAALLSGLVCQSPGDPGDQLPSTLKQGVERVKAVAKRIGEVQVACGLN---QTVEE-FVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLY 1242          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 137.117 bits (344), Expect = 4.341e-32
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = 3
Query:  318 LKKRNSIPAK------EFSFTLDSFQNQAIQ-CIENNQTVLVSAHTSAGKTVCASYTIASCIKE------KRRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTID-----SNASVLIMTTEILRLML--YRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL--------------PPAMRMVFLSATIPNARQFAQWIAHLHKQP-CNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEF-LDEYFN-EAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFH 1646
            LK    IPAK      EF +  +  Q++A    +  ++  ++ A T +GKTV     I   + E        +++Y  PIKAL +Q++ ++KE+F  VGL    LTGD  +D      +A+++I T E    +   +R++S I+ V   + DE+H ++D++RG   E  +  +              P  +R V +SATIPNA   A+W++   +   C  +   +RP  LQ  +        +   + + EF  D   N +  +V+R   D  K  +     R GV+   S           L KD   + S  +K        L K  Y+ +  K K  L++                          G+G HH G+    +++VE LF  G +  LF T T +MG+NMPA  V+  S + + G      +  + +QM GRAGR   DT    ++M   + + +  + +   +T  + SS H
Sbjct:  260 LKAVTEIPAKFRNIFKEFPY-FNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLLMEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSRMKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLG------FPCSSSQTEFKFDLALNYKVYSVIRTYSD-QKPTLVFCSTRKGVQQAASV----------LVKDAKFIISVEQK------LRLQKSAYSIRDSKLKDTLVY--------------------------GVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDT--VESSLH 691          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Match: Hfm1 (HFM1, ATP-dependent DNA helicase homolog [Source:MGI Symbol;Acc:MGI:3036246])

HSP 1 Score: 137.117 bits (344), Expect = 4.341e-32
Identity = 128/484 (26.45%), Postives = 212/484 (43.80%), Query Frame = 3
Query:  318 LKKRNSIPAK------EFSFTLDSFQNQAIQ-CIENNQTVLVSAHTSAGKTVCASYTIASCIKE------KRRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTID-----SNASVLIMTTEILRLML--YRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL--------------PPAMRMVFLSATIPNARQFAQWIAHLHKQP-CNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEF-LDEYFN-EAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFH 1646
            LK    IPAK      EF +  +  Q++A    +  ++  ++ A T +GKTV     I   + E        +++Y  PIKAL +Q++ ++KE+F  VGL    LTGD  +D      +A+++I T E    +   +R++S I+ V   + DE+H ++D++RG   E  +  +              P  +R V +SATIPNA   A+W++   +   C  +   +RP  LQ  +        +   + + EF  D   N +  +V+R   D  K  +     R GV+   S           L KD   + S  +K        L K  Y+ +  K K  L++                          G+G HH G+    +++VE LF  G +  LF T T +MG+NMPA  V+  S + + G      +  + +QM GRAGR   DT    ++M   + + +  + +   +T  + SS H
Sbjct:  260 LKAVTEIPAKFRNIFKEFPY-FNYIQSKAFDDLLYTDRNFVICAPTGSGKTVVFELAITRLLMEVPLPWLNMKIVYMAPIKALCSQRFDDWKEKFGPVGLNCKELTGDTVMDDLFEIQHANIIITTPEKWDSVTRKWRDNSFIQLVRLFLIDEVHVIKDENRGPTLEVVVSRMKTVQSLSRDLESASPVPVRFVAVSATIPNAEDIAEWLSDGERPAVCLKMDESHRPVKLQKVVLG------FPCSSSQTEFKFDLALNYKVYSVIRTYSD-QKPTLVFCSTRKGVQQAASV----------LVKDAKFIISVEQK------LRLQKSAYSIRDSKLKDTLVY--------------------------GVGYHHAGMELSDRKLVEGLFTSGDLPVLFTTSTLAMGMNMPAHLVVIKSTMHYSGGVFEEYSETDILQMIGRAGRPQFDTTATAVIMTRLSTREKYVQMLACNDT--VESSLH 691          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Match: Polq (polymerase (DNA directed), theta [Source:MGI Symbol;Acc:MGI:2155399])

HSP 1 Score: 135.191 bits (339), Expect = 2.178e-31
Identity = 135/520 (25.96%), Postives = 239/520 (45.96%), Query Frame = 3
Query:  405 NQTVLVSAHTSAGKTVCASYTIASCIKEKRR-VIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEV---------GWVIFDEIHYMRDKSRGVVWE------------------ESIILLPPAMRMVFLSATIPNARQFAQWI-AHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTT--KPE----KEKIELIFLNARNTLPEID---RTLPQIDAML-NLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFH----LTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGS 1835
             + ++ SA TSAGKT+ A   I   + E R+  ++  P  +++ +K    +  F++VGL        ++ +    + +I    + R + ++  +         G V+ DE+H + D  RG + E                  ES   L  A+++V +SAT+PN +  A W+ A L+       +TD+RP PL   I      +I   + +    L   F   + V        K D D+         I S C   I+         V++F  SKK CE  A ++++  Y    +PE      +   + L+ ++ L  +D   R+   +D++L N V  G+  HH GL    ++I+E  F +G I+ L AT T S G+N+PA+ VI  + + F G  + ++T   Y QM GRAGR+G+DT G  IL+   + K++    +++G  EP++S       +T +MI  ++ +        + ++    QTYA    L   ++E ++ ++     NQ+   +G+
Sbjct:  107 GKNLVYSAPTSAGKTLVAELLILKRVLETRKKALFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTSPTGQFSSLDIAVCTIERANGLVNRLIEENKMDLLGMVVVDELHMLGDSHRGYLLELLLTKICYVTRKSASHQAESASTLSNAVQIVGMSATLPNLQLVASWLNAELY-------HTDFRPVPLLESI------KIGNSIYDSSMKLVREFQPLLQV--------KGDEDH---------IVSLCYETIQ-----DNHSVLIFCPSKKWCEKVADIIAREFYNLHHQPEGLVKSSEFPPVILDQKSLLEVMDQLKRSPSGLDSVLKNTVPWGVAFHHAGLTFEERDIIEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPI-FSGQPLDILT---YKQMVGRAGRKGVDTMGESILVCKNSEKSKGIA-LLQGSLEPVHSCLQRQGEVTASMIRAILEIIVGG----VASTSQDMQTYAACTFLAAAIQEGKQGMQR----NQDDAQLGA 578          
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Match: sp|P42285|MTREX_HUMAN (Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3)

HSP 1 Score: 916.761 bits (2368), Expect = 0.000e+0
Identity = 468/951 (49.21%), Postives = 657/951 (69.09%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            + C HEV  P    Y PLK R    AKE+ F LD+FQ +AIQC++NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGLIK LFATETF+MG+NMPA+TV+FT+A KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ +++  E+Q  +I + N+E + I  +Y++ + L  + +E+   I K     PFL PGRLV +K    DFGW ++V+       K  SG+   L +V+ ++  + ESL     + A  P K + + +  +  + +  +  +SSV +     L     +  + R+  L     +  R+ + I L+D   D+  +   + +  QK++  + ++ +HP+ N D +LE +  L  K+ +        + E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++L+ +Q  A LSCFVF+E  +E+ +    L   L +M+E A+ I++VS E +LE+    DE+ Y+ +FK  L+++V  WA G+TF  +C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:  108 EGCTHEVALPAEEDYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEESVVI--YYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESL-KNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISSVRLYIPKDL-----RPVDNRQSVLKSIQEVQKRFPDGIPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHN-DPNLETVYTLCEKKAQIAIDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEI----DEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1042          
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Match: sp|Q9CZU3|MTREX_MOUSE (Exosome RNA helicase MTR4 OS=Mus musculus OX=10090 GN=Mtrex PE=1 SV=1)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 464/952 (48.74%), Postives = 658/952 (69.12%), Query Frame = 3
Query:  264 TQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
             + C HEV  P +  Y PLK R    AKE+ F LD+FQ +AIQC++NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+VIYTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR AGD +K D    G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGLIK LFATETF+MG+NMPA+TV+FT+A K+DG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ +++  E+Q  +I + N+E + I  +Y++ + L  + +E+   I K     PFL PGRLV +K    DFGW ++V+       K  SG+   L +V+ ++  + ESL     + A  P K + + +  +  + +  +  +S+V +     L     +  + R+  L     +  R+ + + L+D   D+  +   + +  QK++  + ++ +HP+ N D +LE +  L  ++ +        + E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++L+ +Q  A LSCFVF+E  +E+ +    L   L +M+E A+ I++VS E +LE+    DE+ Y+ +FK  L+++V  WA G+TF  +C+ T+++EGSIIRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:  105 VEGCTHEVALPADEDYIPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGDQK--GRKGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALFATETFAMGINMPARTVLFTNARKYDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVDEKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPGVVEKVKNSEEQYNKIVIPNEENVVI--YYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLVKVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESL-KNSATEAAKPAKPDEKGEMQVVPVLVHLLSAISTVRLYIPKDL-----RPVDNRQSVLKSIQEVQRRFPDGVPLLDPIDDMGIQDQGLKKVIQKVEAFEHRMYSHPLHN-DPNLETVYTLCERKAQIALDIKSAKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDLSSEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEI----DEETYLSSFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1040          
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Match: sp|Q23223|MTR4_CAEEL (mRNA transport homolog 4 OS=Caenorhabditis elegans OX=6239 GN=mtr-4 PE=3 SV=1)

HSP 1 Score: 807.749 bits (2085), Expect = 0.000e+0
Identity = 446/1027 (43.43%), Postives = 645/1027 (62.80%), Query Frame = 3
Query:   90 EVAEVPVEIKDNASKKRKLDDFLVEYVDKASDV-----EEKKTKIDVSDFKNP-----INDILLKTIPT--QNCIHEVVYPKNIVYKPLKKRNSI-PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEE--IPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKS-----------LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            E  E P+E  D+A K++  +D      +  +DV     +E  +K    + +       + +I++ TI T  +NC HEV  P N  +  L++ +   PAK + F LD+FQ QAI CI+NNQ+VLVSAHTSAGKTV A+Y IA C++EK+RVIYT+PIKALSNQKYRE +EEF+DVGL+TGDVT++ +AS L+MTTEILR MLYR S I+KEVGWV++DEIHYMRDK RGVVWEE+IIL+   ++  FLSATIPNARQFAQW+A + +QP NV+YTDYRPTPLQH+IYP G + +Y+VVN KGEF ++ F +AM+ L  AGDS+ +   N  + GG    +S+   +I+ V        IVFSFS+K CE YA  L  +D+    EK  ++ ++ +A   L   D+ LPQI  +L L+RRGIG+HH GLMP+LKE +EILFGEGL+K LFATETFSMGLNMPA+TV+FTSA KFDG++ R ITSGEYIQM+GRAGRRG D  G VILM+D  +  +DAKQ+IKG T+PLNS F LTYNM+LNLMRVE ++  +++ NSF QFQ+YA++P +  +  + E+++     P  N+    + +   L+  L A R+ +    R+      FL  GRL  +K  + DF W IL       +FK             L D +I +  E  F       + P     +       + +  I  +S+V +    ++   + K D  +        +   R+ N I L+D  +D++ K  ++ E   + + L+ ++E H M   D   ++   + ++ +     + L+ E     S + ++EL +RKR+LRR  +  + D +  KG +ACE+S  DE++LTE+LL G F+ L   Q  A LSCFVF++          +L   L ++ E AR++++VS EC++EV     E  YV +F  GL+++V  W  G+TF ++ + T+++EGSIIR +RRL+E+L ++  +++ + N +LE+KF +A + +KR I+F++SLYL
Sbjct:   22 EAPENPMEKLDSAKKRQAREDMTNLLANMHNDVGVGNFDEATSKRARVEEEEEVEEARMENIIVHTIRTDNENCTHEVAIPPNAEFAELRENSGTEPAKYYPFQLDAFQKQAILCIDNNQSVLVSAHTSAGKTVVATYAIAKCLREKQRVIYTSPIKALSNQKYRELEEEFKDVGLMTGDVTLNPDASCLVMTTEILRSMLYRGSEIMKEVGWVVYDEIHYMRDKERGVVWEETIILMSKNIKQAFLSATIPNARQFAQWVASIKQQPVNVVYTDYRPTPLQHWIYPVGGEGMYEVVNVKGEFREDKFRDAMSGLATAGDSAGS--FNKRRTGGGTQGDSNVLKIIRSVASNDGLNCIVFSFSRKECESYAISLKDMDFNKDHEKGMVKSVYESAIAQLSPEDQKLPQILNILPLLRRGIGVHHSGLMPILKETIEILFGEGLVKVLFATETFSMGLNMPARTVVFTSARKFDGSDNRYITSGEYIQMAGRAGRRGKDDRGTVILMVDSAMSADDAKQIIKGATDPLNSQFRLTYNMVLNLMRVEGMAVSWIINNSFHQFQSYAKIPEIDKKCVQVERKIASFNFPWENE----MRTLVDLQDQLEATRQRIIQIQREPKYIVGFLHAGRLFKVKSGDRDFKWGIL------NQFKKEQNPDDRNDQIYLCDMMIAINTEGRFDPTNPATLVPGFDLPKRRWIRVPMTIDRITAISAVRL----KVPADIDKPD-GQMRLDGMMAAATKRFGNQIPLLDPIQDMEIKTVEMKELIAREKSLEGRLETHSMTKRDNMKDLKKQFEQKQDAVKELNALKAERKSVQSTLHLEELNNRKRVLRRLGYLGNDDALVLKGSVACELSASDELILTEMLLKGIFNTLDVAQTAALLSCFVFQDKCAAPKLA-TELQTCLSELHEQARNVAKVSNECKMEVM----EDKYVSSFNPGLMDVVYQWVNGATFSEIVKTTDVFEGSIIRTLRRLEEVLREMINAAKALANKELEQKFEDARKNLKRDIVFAASLYL 1026          
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Match: sp|O14232|MTR4_SCHPO (ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mtr4 PE=1 SV=1)

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 440/963 (45.69%), Postives = 624/963 (64.80%), Query Frame = 3
Query:  279 HEVVYPKNIVYKPLKKRNSI--PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAM-AVLRKAGD-----SSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKF---KSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLH--SLKKND---EARKEFLNKRNSIIARY--NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXX-XXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            H+V  P N  Y P+ K  S   PA+ + FTLD FQ  +I CIE  ++VLVSAHTSAGKTV A Y +A  +++K+RVIYT+PIKALSNQKYRE   EF DVGL+TGDVTI+ +A+ L+MTTEILR MLYR S +++EV WVIFDEIHYMRDK RGVVWEE+IILLP     VFLSATIPNA QFA+WI  +H+QPC+V+YTD+RPTPLQHY++P+G+D I+ VV+EK  F +E F  AM A++ K GD     ++K +        G     S    ++K +     +PVIVFSFSK+ CE  A  +SKLD   + E++ +  IF NA N L E DR LPQI+ +L L+RRGIGIHH GL+P+LKE++EILF EGL+K LFATETFS+GLNMPAKTV+FT+  KFDG   R I+ GEYIQMSGRAGRRGLD  G VILM+D  +    AK ++KGE + L+S+FHL+YNMILNL+RVE ISPE+++E  FFQFQ   E+P L  +L E ++  +   + ++  L    ++ L+  L   R ++ + +   +    FL  GRLV +K    DF W ++V+       K +S ++   +S +V  ++ VA ++   +  S  +P    E  P       E K  FE+   ++   D + H      ND   + +K  + K  S + R     I L+D  +++  K     +  +K+  L++++ ++P+ N  +  E    Y ++L        L+ +++K  S++++DEL SRKR+LRR  F T  DVI  KGR+ACEIS+GD ++LTEL+ +G F++LT +Q  A LSC V  E+   E    + +L   L+ ++E+AR I++VSKE + E+    +E+ YV +FK  L+E+V AWA G++F ++C+ T++YEGS+IR  RRL+EL+ Q+ ++++VIGN  L++K  +    I R I+FS+SLYL
Sbjct:  169 HQVSIPPNYDYVPISKHKSPIPPARTYPFTLDPFQAVSIACIERQESVLVSAHTSAGKTVVAEYAVAQSLRDKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDVTINPDATCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDKERGVVWEETIILLPDKSHFVFLSATIPNAMQFAEWITKIHRQPCHVVYTDFRPTPLQHYLFPSGSDGIHLVVDEKSNFREENFQRAMSALMEKQGDDPAAMATKGNAKKGKTGKGGVKGPSDIYKIVKMIMVKNYNPVIVFSFSKRECEALALQMSKLDMNDQTERDLVTTIFNNAVNQLSEKDRELPQIEHILPLLRRGIGIHHSGLLPILKEVIEILFQEGLLKVLFATETFSIGLNMPAKTVVFTNVRKFDGKTFRWISGGEYIQMSGRAGRRGLDDRGIVILMIDEKMDPPVAKSMLKGEADRLDSAFHLSYNMILNLLRVEGISPEFMLERCFFQFQNSLEVPKLEAKLEESQQHYDSFTILDERPLE--EYHTLKTQLERYRTDVRTVVNHPNFCLSFLQGGRLVRVKVGNEDFDWGVVVNVSKRPLPKGQSNEYLPQESYIVHTLVMVASDTGPLRIRSGHLP----EVHPPA----AEDKGKFEVVPFLLSSLDGIAHIRVFLPNDLKSQGQKLTVGKALSEVKRRFPEGITLLDPVENMNIKEPTFIKLMKKVNILESRLLSNPLHNFSELEEKYAEYLRKLALLEEVKDLKKKLSKARSIMQLDELNSRKRVLRRLGFTTSDDVIEVKGRVACEISSGDGLLLTELIFNGMFNDLTPEQCAALLSCLVFQEKSEVENQRMKEELAGPLKILQEMARRIAKVSKESKQEL----NEEEYVNSFKPSLMEVVYAWAHGASFAQICKMTDVYEGSLIRMFRRLEELIRQMVDAAKVIGNTSLQQKMEDTIACIHRDIVFSASLYL 1117          
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Match: sp|P47047|MTR4_YEAST (ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTR4 PE=1 SV=1)

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 430/965 (44.56%), Postives = 620/965 (64.25%), Query Frame = 3
Query:  279 HEVVYPKNIVYKPLKKRNSI-PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRG----GVKA---IESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD-FGWCILVSKLRS----------GKFKSLLVDCVI-------PVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY--NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            H+V  P N  Y P+ +   +  A+ + FTLD FQ+ AI CI+  ++VLVSAHTSAGKTV A Y IA  +K K+RVIYT+PIKALSNQKYRE   EF DVGL+TGD+TI+ +A  L+MTTEILR MLYR S +++EV WVIFDE+HYMRDK RGVVWEE+IILLP  +R VFLSATIPNA +FA+WI  +H QPC+++YT++RPTPLQHY++P   D IY VV+EK  F +E F +AMA +        N  D+ GK+G    G  A    +     ++K ++  K +PVIVFSFSK+ CE  A  +SKLD+ +  EKE +  IF NA   LPE DR LPQI  +L L+RRGIGIHH GL+P+LKE++EILF EG +K LFATETFS+GLNMPAKTV+FTS  K+DG   R ++ GEYIQMSGRAGRRGLD  G VI+M+D  ++ + AK ++KG+ + L+S+FHL YNMILNLMRVE ISPE+++E+SFFQFQ    +P +  +L E +K  + I + ++E  ++  ++ +E+++   RE++   +        FL PGRLV I  N  D +GW  +V   +              +S +V+ V+       PV     F   L   I P +   +    +  I L  I  + ++ +     +  S       +KE + K    + R   + I ++D  K++K + +   +  +KI  L TK+ ++P+ N  +  E+   Y ++ +      +L+ +I++  ++I++D+L+ RKR+LRR  FCT  D+I  KGR+ACEIS+GDE++LTEL+ +G F+ L  +Q  A LSCF F+E   E    + +L + L+ M+E+A  I+++ K+ ++EV     EK YVE+F+  L+E+V  W +G+TF ++C+ T++YEGS+IR  +RL+EL+ +L + +  IGN  L++K     +LI R I+ + SLYL
Sbjct:  121 HQVALPPNYDYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEE--NVKEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKRINKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRPAEEGEKSICAVIPITLDSIKSIGNLRLYMPKDIRAS------GQKETVGKSLREVNRRFPDGIPVLDPVKNMKIEDEDFLKLMKKIDVLNTKLSSNPLTNSMRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREIAAKIAKIMKDSKIEVV----EKDYVESFRHELMEVVYEWCRGATFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL 1073          
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Match: A0A1I8GWU1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 967.222 bits (2499), Expect = 0.000e+0
Identity = 484/961 (50.36%), Postives = 673/961 (70.03%), Query Frame = 3
Query:  243 ILLKTIPTQ--NCIHEVVYPKNIVYKPLKK--RNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLL-------VDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNT-IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++  I TQ  +C HEVV P  I Y P K+   +  PAK + F LDSFQ +AI CIE  Q+VLVSAHTSAGKTV A Y IA  ++E++RVIYTTPIKALSNQKYREF +EF DVGL+TGDVTI+ NAS LIMTTEILR MLYR S +++EVGWV+FDEIHYMRD  RGVVWEE+IILLP A+  VFLSATIPNARQFA+W+  LH+QPC+V+YTDYRPTPLQHY++P G D ++ VV+++G F +E F + MA L KAG +S++DM N G+RGG K+ E+HC T++K + +   +PVIVFSFSKK CE+YA  ++KLD+ T  EK  +E +F NA   L E DR LPQ++++L L+R+GIGIHHGGL+P+LKE +EILF EGLIKCLFATETF+MGLNMPA+TV+FTSA KFDG N R I+SGEYIQMSGRAGRRGLD  G VILM+D T+ +  AK +IKG  +PLNS+FHLTYNMILNL+RVE I+PEY++E SF QFQ YA +P L+ R+RE    + E  + ++E   + S+ ++ + L ++ E+MW+ IR+      FL  GRLV ++ ++HDFGW ++V   +      +L       VD ++ VA  S   K +S+  P P+ E   D  +  I+L+ ++ +S+V +     L   L+ N   R+  L    ++   + T    +D  KD+K + ++  +   K      ++ENH + + D+  +++     +   +    + + E+ ++ +L++++ELK RKR+LRR  F T +D+I  KGR+ACEI + DE++LTELL  G  ++LT QQ+ A LSCF+FEE  +E+ +   +L   L  +++ AR ++RVS EC++ +    DE+AY E+FK  +++IV AW+ G++F K+C  T+I+EGSIIRC+RRL+ELL Q+  +++ IGN +LE KF EA   IKR I+F++SLYL
Sbjct:  104 VVVHKIQTQSVDCTHEVVVPPGIEYDPAKRPAESKTPAKTYKFKLDSFQREAITCIELGQSVLVSAHTSAGKTVVAEYAIALSLRERQRVIYTTPIKALSNQKYREFFDEFHDVGLMTGDVTINPNASCLIMTTEILRSMLYRGSEVMREVGWVVFDEIHYMRDSERGVVWEETIILLPDAVHHVFLSATIPNARQFAEWVCALHRQPCHVVYTDYRPTPLQHYMFPCGGDGLHLVVDQEGNFREENFGQVMASLAKAGGNSQSDMANRGRRGGFKSAETHCMTIVKVIMERSLEPVIVFSFSKKECEIYALQMAKLDFNTAQEKALVEEVFNNATGGLSEEDRKLPQVESVLPLLRKGIGIHHGGLLPLLKETIEILFHEGLIKCLFATETFAMGLNMPARTVLFTSARKFDGKNYRWISSGEYIQMSGRAGRRGLDDQGTVILMVDETMGHATAKNIIKGSPDPLNSAFHLTYNMILNLLRVEDINPEYMLERSFHQFQNYASIPQLLQRIRELRSGIAECRVEDEE--GVASYQQIRQHLKSLNEQMWAVIRQPKYILAFLQEGRLVQVRTDQHDFGWGVVVGVSKKQHDNRVLNPEPYYVVDALLRVAPNSAREKHVSLIRPAPEGEP-CDFEVVPIKLELLYGISAVRLHVPTDL--RLEVN---RRAVLQSVGAVFQHFKTGPPPLDPLKDMKIREEKFADLVAKRDAFNERLENHWLADSDRLPKLLEQLEAKSALQAQLTEAQSELAQRRALLQLEELKCRKRVLRRLGFATQSDIIELKGRVACEIDSADELVLTELLFSGALNDLTAQQVAALLSCFIFEEKASELPDLSEELAVPLRALQDTARRVARVSTECKVPL----DEEAYCESFKPHMMDIVAAWSSGASFAKICSKTDIFEGSIIRCMRRLEELLRQMCNAAKAIGNAELENKFAEAIVSIKRDIVFAASLYL 1052          
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Match: A0A1I8GFM1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 484/961 (50.36%), Postives = 672/961 (69.93%), Query Frame = 3
Query:  243 ILLKTIPTQ--NCIHEVVYPKNIVYKPLKK--RNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLL-------VDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNT-IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++  I TQ  +C HEVV P  I Y P K+   +  PAK + F LDSFQ +AI CIE  Q+VLVSAHTSAGKTV A Y IA  ++E++RVIYTTPIKALSNQKYREF +EF DVGL+TGDVTI+ NAS LIMTTEILR MLYR S +++EVGWV+FDEIHYMRD  RGVVWEE+IILLP A+  VFLSATIPNARQFA+W+  LH+QPC+V+YTDYRPTPLQHY++P G D ++ VV+++G F +E F + MA L KAG +S++DM N G+RGG K+ E+HC T++K + +   +PVIVFSFSKK CE+YA  ++KLD+ T  EK  +E +F NA   L E DR LPQ++++L L+R+GIGIHHGGL+P+LKE +EILF EGLIKCLFATETF+MGLNMPA+TV+FTSA KFDG N R I+SGEYIQMSGRAGRRGLD  G VILM+D T+ +  AK +IKG  +PLNS+FHLTYNMILNL+RVE I+PEY++E SF QFQ YA +P L+ R+RE    + E  + ++E   + S+ ++ + L ++ E+MW+ IR+      FL  GRLV ++  +HDFGW ++V   +      +L       VD ++ VA  S   K +S+  P P+ E   D  +  I+L+ ++ +S+V +     L   L+ N   R+  L    ++   + T    +D  KD+K + ++  +   K      ++ENH + + D+  +++     +   +    + + E+ ++ +L++++ELK RKR+LRR  F T +D+I  KGR+ACEI + DE++LTELL  G  ++LT QQ+ A LSCF+FEE  +E+ +   +L   L  +++ AR ++RVS EC++ +    DE+AY E+FK  +++IV AW+ G++F K+C  T+I+EGSIIRC+RRL+ELL Q+  +++ IGN +LE KF EA   IKR I+F++SLYL
Sbjct:  104 VVVHKIQTQSVDCTHEVVVPPGIEYDPAKRPAESKTPAKTYKFKLDSFQREAITCIELGQSVLVSAHTSAGKTVVAEYAIALSLRERQRVIYTTPIKALSNQKYREFFDEFHDVGLMTGDVTINPNASCLIMTTEILRSMLYRGSEVMREVGWVVFDEIHYMRDSERGVVWEETIILLPDAVHHVFLSATIPNARQFAEWVCALHRQPCHVVYTDYRPTPLQHYMFPCGGDGLHLVVDQEGNFREENFGQVMASLAKAGGNSQSDMANRGRRGGFKSAETHCMTIVKVIMERSLEPVIVFSFSKKECEIYALQMAKLDFNTAQEKALVEEVFNNATGGLSEEDRKLPQVESVLPLLRKGIGIHHGGLLPLLKETIEILFHEGLIKCLFATETFAMGLNMPARTVLFTSARKFDGKNYRWISSGEYIQMSGRAGRRGLDDQGTVILMVDETMGHATAKNIIKGSPDPLNSAFHLTYNMILNLLRVEDINPEYMLERSFHQFQNYASIPQLLQRIRELRSGIAECRVEDEE--GVASYQQIRQHLKSLNEQMWAVIRQPKYILAFLQEGRLVQVRTEQHDFGWGVVVGVSKKQHDNRVLNPEPYYVVDALLRVAPNSAREKHVSLIRPAPEGEP-CDFEVVPIKLELLYGISAVRLHVPTDL--RLEVN---RRAVLQSVGAVFQHFKTGPPPLDPLKDMKIREEKFADLVAKRDAFNERLENHWLADSDRLPKLLEQLEAKSALQAQLTEAQSELAQRRALLQLEELKCRKRVLRRLGFATQSDIIELKGRVACEIDSADELVLTELLFSGALNDLTAQQVAALLSCFIFEEKASELPDLSEELAVPLRALQDTARRVARVSTECKVPL----DEEAYCESFKPHMMDIVAAWSSGASFAKICSKTDIFEGSIIRCMRRLEELLRQMCNAAKAIGNAELENKFAEAIVSIKRDIVFAASLYL 1052          
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Match: A0A267EQ23 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013684g1 PE=4 SV=1)

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 483/961 (50.26%), Postives = 672/961 (69.93%), Query Frame = 3
Query:  243 ILLKTIPTQ--NCIHEVVYPKNIVYKPLKK--RNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLL-------VDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNT-IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++  I TQ  +C HEVV P  I Y P K+   +  PAK + F LDSFQ +AI CIE  Q+VLVSAHTSAGKTV A Y IA  ++E++RVIYTTPIKALSNQKYREF +EF DVGL+TGDVTI+ NAS LIMTTEILR MLYR S +++EVGWV+FDEIHYMRD  RGVVWEE+IILLP A+  VFLSATIPNARQFA+W+  LH+QPC+V+YTDYRPTPLQHY++P   D ++ VV+++G F +E F + MA L KAG +S++DM N G+RGG K+ E+HC T++K + +   +PVIVFSFSKK CE+YA  ++KLD+ T  EK  +E +F NA   L E DR LPQ++++L L+R+GIGIHHGGL+P+LKE +EILF EGLIKCLFATETF+MGLNMPA+TV+FTSA KFDG N R I+SGEYIQMSGRAGRRGLD  G VILM+D T+ +  AK +IKG  +PLNS+FHLTYNMILNL+RVE I+PEY++E SF QFQ YA +P L+ R+RE    + E  + ++E   + S+ ++ + L ++ E+MW+ IR+      FL  GRLV ++ ++HDFGW ++V   +      +L       VD ++ VA  S   K +S+  P P+ E   D  +  I+L+ ++ +S+V +     L   L+ N   R+  L    ++   + T    +D  KD+K + ++  +   K      ++ENH + + D+  +++     +   +    + + E+ ++ +L++++ELK RKR+LRR  F T +D+I  KGR+ACEI + DE++LTELL  G  ++LT QQ+ A LSCF+FEE  +E+ +   +L   L  +++ AR ++RVS EC++ +    DE+AY E+FK  +++IV AW+ G++F K+C  T+I+EGSIIRC+RRL+ELL Q+  +++ IGN +LE KF EA   IKR I+F++SLYL
Sbjct:  103 VVVHKIQTQSVDCTHEVVVPPGIEYDPAKRPAESKTPAKTYKFKLDSFQREAITCIELGQSVLVSAHTSAGKTVVAEYAIALSLRERQRVIYTTPIKALSNQKYREFFDEFHDVGLMTGDVTINPNASCLIMTTEILRSMLYRGSEVMREVGWVVFDEIHYMRDSERGVVWEETIILLPDAVHHVFLSATIPNARQFAEWVCALHRQPCHVVYTDYRPTPLQHYMFPCCGDGLHLVVDQEGNFREENFGQVMASLAKAGGNSQSDMANRGRRGGFKSAETHCMTIVKVIMERSLEPVIVFSFSKKECEIYALQMAKLDFNTAQEKALVEEVFNNATGGLSEEDRKLPQVESVLPLLRKGIGIHHGGLLPLLKETIEILFHEGLIKCLFATETFAMGLNMPARTVLFTSARKFDGKNYRWISSGEYIQMSGRAGRRGLDDQGTVILMVDETMGHATAKNIIKGSPDPLNSAFHLTYNMILNLLRVEDINPEYMLERSFHQFQNYASIPQLLQRIRELRSGIAECRVEDEE--GVASYQQIRQHLKSLNEQMWAVIRQPKYILAFLQEGRLVQVRTDQHDFGWGVVVGVSKKQHDNRVLNPEPYYVVDALLRVAPNSAREKHVSLIRPAPEGEP-CDFEVVPIKLELLYGISAVRLHVPTDL--RLEVN---RRAVLQSVGAVFQHFKTGPPPLDPLKDMKIREEKFADLVAKRDAFNERLENHWLADSDRLPKLLEQLEAKSALQAQLTEAQSELAQRRALLQLEELKCRKRVLRRLGFATQSDIIELKGRVACEIDSADELVLTELLFSGALNDLTAQQVAALLSCFIFEEKASELPDLSEELAVPLRALQDTARRVARVSTECKVPL----DEEAYCESFKPHMMDIVAAWSSGASFAKICSKTDIFEGSIIRCMRRLEELLRQMCNAAKAIGNAELENKFAEAIVSIKRDIVFAASLYL 1051          
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Match: A0A1I8GJY1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 483/961 (50.26%), Postives = 672/961 (69.93%), Query Frame = 3
Query:  243 ILLKTIPTQ--NCIHEVVYPKNIVYKPLKK--RNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLL-------VDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNT-IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++  I TQ  +C HEVV P  I Y P K+   +  PAK + F LDSFQ +AI CIE  Q+VLVSAHTSAGKTV A Y IA  ++E++RVIYTTPIKALSNQKYREF +EF DVGL+TGDVTI+ NAS LIMTTEILR MLYR S +++EVGWV+FDEIHYMRD  RGVVWEE+IILLP A+  VFLSATIPNARQFA+W+  LH+QPC+V+YTDYRPTPLQHY++P   D ++ VV+++G F +E F + MA L KAG +S++DM N G+RGG K+ E+HC T++K + +   +PVIVFSFSKK CE+YA  ++KLD+ T  EK  +E +F NA   L E DR LPQ++++L L+R+GIGIHHGGL+P+LKE +EILF EGLIKCLFATETF+MGLNMPA+TV+FTSA KFDG N R I+SGEYIQMSGRAGRRGLD  G VILM+D T+ +  AK +IKG  +PLNS+FHLTYNMILNL+RVE I+PEY++E SF QFQ YA +P L+ R+RE    + E  + ++E   + S+ ++ + L ++ E+MW+ IR+      FL  GRLV ++ ++HDFGW ++V   +      +L       VD ++ VA  S   K +S+  P P+ E   D  +  I+L+ ++ +S+V +     L   L+ N   R+  L    ++   + T    +D  KD+K + ++  +   K      ++ENH + + D+  +++     +   +    + + E+ ++ +L++++ELK RKR+LRR  F T +D+I  KGR+ACEI + DE++LTELL  G  ++LT QQ+ A LSCF+FEE  +E+ +   +L   L  +++ AR ++RVS EC++ +    DE+AY E+FK  +++IV AW+ G++F K+C  T+I+EGSIIRC+RRL+ELL Q+  +++ IGN +LE KF EA   IKR I+F++SLYL
Sbjct:  104 VVVHKIQTQSVDCTHEVVVPPGIEYDPAKRPAESKTPAKTYKFKLDSFQREAITCIELGQSVLVSAHTSAGKTVVAEYAIALSLRERQRVIYTTPIKALSNQKYREFFDEFHDVGLMTGDVTINPNASCLIMTTEILRSMLYRGSEVMREVGWVVFDEIHYMRDSERGVVWEETIILLPDAVHHVFLSATIPNARQFAEWVCALHRQPCHVVYTDYRPTPLQHYMFPCCGDGLHLVVDQEGNFREENFGQVMASLAKAGGNSQSDMANRGRRGGFKSAETHCMTIVKVIMERSLEPVIVFSFSKKECEIYALQMAKLDFNTAQEKALVEEVFNNATGGLSEEDRKLPQVESVLPLLRKGIGIHHGGLLPLLKETIEILFHEGLIKCLFATETFAMGLNMPARTVLFTSARKFDGKNYRWISSGEYIQMSGRAGRRGLDDQGTVILMVDETMGHATAKNIIKGSPDPLNSAFHLTYNMILNLLRVEDINPEYMLERSFHQFQNYASIPQLLQRIRELRSGIAECRVEDEE--GVASYQQIRQHLKSLNEQMWAVIRQPKYILAFLQEGRLVQVRTDQHDFGWGVVVGVSKKQHDNRVLNPEPYYVVDALLRVAPNSAREKHVSLIRPAPEGEP-CDFEVVPIKLELLYGISAVRLHVPTDL--RLEVN---RRAVLQSVGAVFQHFKTGPPPLDPLKDMKIREEKFADLVAKRDAFNERLENHWLADSDRLPKLLEQLEAKSALQAQLTEAQSELAQRRALLQLEELKCRKRVLRRLGFATQSDIIELKGRVACEIDSADELVLTELLFSGALNDLTAQQVAALLSCFIFEEKASELPDLSEELAVPLRALQDTARRVARVSTECKVPL----DEEAYCESFKPHMMDIVAAWSSGASFAKICSKTDIFEGSIIRCMRRLEELLRQMCNAAKAIGNAELENKFAEAIVSIKRDIVFAASLYL 1052          
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Match: A0A4Y2HR77 (Exosome RNA helicase MTR4 OS=Araneus ventricosus OX=182803 GN=Mtrex PE=4 SV=1)

HSP 1 Score: 946.036 bits (2444), Expect = 0.000e+0
Identity = 487/1006 (48.41%), Postives = 693/1006 (68.89%), Query Frame = 3
Query:  138 RKLDDFLVE-------YVDKASDVEEKKTK-------IDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS----KLRSGKFKS---LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +K+ DFL E       Y ++    E KK K       I+  +F + I   +++T+  + C+HEV  P +  Y PL++  + P++++ F LD FQ +AI C+ENNQ+VLVSAHTSAGKTV A Y IA  +K+K+RVIYTTPIKALSNQKYREF EEF+DVGLLTGDVTI+ +AS LIMTTEILR MLYR S +++EVGWVIFDEIHYMRDK RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLH QPC+V+YTDYRP PLQ YI+P G D ++ VV+E G F +E FN AM+VL+ AG ++K D    G++GG K   S+C  ++K + +    PVIVFSFSKK CE YA  ++KLD+ T  EK  +E +F NA + L + D+ LPQ++ +L L++RGIGIHH GL+P+LKE +EILF EGLIK LFATETF+MGLNMPA+TV+FT+A KFDG + R +TSGEYIQMSGRAGRRGLD  G VILM+D  +     K+++KG  +P+NS+FHLTYNM+LNL+RV+ I+PEY++E SFFQFQ Y+ +P L  +++  ++  + I L  ++   + S+Y+++K L ++ EE    I +     PF  PGRLV +K  + DFGW ++V+     L+S   K     +VDC++ V+ ES   K  S   PP  +E +    +  I+L  I +LS+V       L     +  + R + L    +I+ R+ N + L+D  +D+K K + + +  ++I+   +++ +HP+ N     +++  Y K+L+ E    + + E+ K  SL++MDELK RKR+LRR  +CT +DVI  KGR+ACEIS+ DE++LTE++ +G F+NL   Q  A LSCFVF+E  NE+ +   +L   L  M++ AR I+++SKECRLE+    D + YV++FK  L+++V +W+ G++F  +C+ T+++EGS+IRC+RRL+EL+ Q+ ++++ IGN ++E KF E  +LIKR I+F++SLYL
Sbjct:   36 QKVSDFLKEITEGKRSYDNEDDSAESKKLKVSNILDDINPEEFSSRIQVHVVETV--EACLHEVAVPHDSEYIPLRQSQNPPSRKYPFILDPFQKEAILCLENNQSVLVSAHTSAGKTVVAEYAIAMSLKDKQRVIYTTPIKALSNQKYREFYEEFKDVGLLTGDVTINPSASCLIMTTEILRSMLYRGSEVMREVGWVIFDEIHYMRDKERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHHQPCHVVYTDYRPVPLQQYIFPAGGDGLHLVVDENGNFREENFNTAMSVLQVAGGAAKGDSAMKGRKGGFKD-GSNCYKIVKMIMERNFAPVIVFSFSKKECEAYAMQMAKLDFNTDEEKPLVEEVFKNAMDVLSDEDKKLPQVEHVLPLLKRGIGIHHSGLLPILKETIEILFSEGLIKALFATETFAMGLNMPARTVLFTNARKFDGKDFRWVTSGEYIQMSGRAGRRGLDERGIVILMIDEKMSPSVGKEIVKGLPDPINSAFHLTYNMVLNLLRVDEINPEYMLERSFFQFQNYSSIPQLYEKIKTLQENHDSIKLDRED--DVDSYYKIKKHLASLAEEYHYFITRPEYCVPFFQPGRLVKVKNGDDDFGWGMIVNYQKKTLQSANNKESVFYVVDCLLQVSKESAETKVTSNLKPPAPNE-KGVMQVVPIKLNLIQQLSTVRAHTPKDL-----RPVDNRMQVLRTIQAILERFPNGLPLLDPVEDMKIKEEGLKDVMKRIEAFTSRLNHHPLHNDPSIDDLLEQYKKKLQIESEIKEAKAELKKARSLLQMDELKCRKRVLRRMGYCTASDVIEIKGRVACEISSADELLLTEMIFNGAFNNLNVHQTTALLSCFVFQEKSNEMPKLTEELSGPLRLMQDTARRIAKISKECRLEL----DLEQYVDSFKPHLMDVVYSWSNGASFAHICKMTDVFEGSVIRCMRRLEELMRQMCQAAKAIGNTEMENKFSEGIKLIKRDIVFAASLYL 1026          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:103046062])

HSP 1 Score: 841.262 bits (2172), Expect = 0.000e+0
Identity = 437/903 (48.39%), Postives = 614/903 (68.00%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGD---SSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEG 2936
            + C HEV  P +  YK L +R    AKE+ F LD FQ +A+ CI+NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTDYRPTPLQHYI+P G D ++ VV+E GEF ++ FN AM VLR AGD   SS    D  G+RGG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VI M+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ ++++ E+    I + N+E  S+ ++Y++ + L  + +E+   I+K     PFL PGRLV +K  + +FGW ++V+       K  +G+   L +V+ ++  + +S+       A P    E + +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QKI+  + ++  HP+ + D +LE +  L  K+    G    ++ E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  NE+ +    L   L +M+E AR I++VS E +L V    DE+ Y+  F+  L+++V  WA G++F ++C+ T+++EG
Sbjct:   98 EGCTHEVALPADQEYKQLSQRVGKAAKEYPFILDPFQREALLCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGLHLVVDENGEFREDNFNTAMQVLRDAGDQGGSSGGKWDAKGRRGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVSKLDFNTDDEKKLVEEVFSNAIDCLSDDDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAVPGVLEKMKKLEEMYNGIEIPNEE--SVVTYYKIRQQLAKLGKEIEEFIQKPKYCLPFLQPGRLVKVKKEDMEFGWGVIVNFSRKSNVKANTGELDPLYVVEVLVHCSKDSVKNAATEAAKPAAAGE-KGEMQVIPVMLNLLTSISSVRLYIPKDL-----RPYDNRQSMLKSIQEVQKRFPDGLPLLDPIDDMGIKDPALKKVIQKIEAFEHRMYTHPL-HSDPNLETLYTLCEKKALVAGDIKSVKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELILTEMVFNGLFNDLTAEQATALLSCFVFQENANEMPKLTEQLAAPLRQMQECARRIAKVSAEAKLTV----DEETYLNQFRPHLMDVVYTWANGASFSQICKMTDVFEG 986          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:103046062])

HSP 1 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 436/903 (48.28%), Postives = 613/903 (67.88%), Query Frame = 3
Query:  264 TQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGD---SSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS-------KLRSGKFKSL-LVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYE 2933
             + C HEV  P +  YK L +R    AKE+ F LD FQ +A+ CI+NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTDYRPTPLQHYI+P G D ++ VV+E GEF ++ FN AM VLR AGD   SS    D  G+RGG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK+ +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VI M+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  +P ++ ++++ E+    I + N+E  S+ ++Y++ + L  + +E+   I+K     PFL PGRLV +K  + +FGW ++V+       K  +G+   L +V+ ++  + +S+       A P    E + +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QKI+  + ++  HP+ + D +LE +  L  K+    G    ++ E+ K  ++++MDELK RKR+LRR  F T +DVI  KGR+ACEIS+ DE++LTE++ +G F++LT +Q  A LSCFVF+E  NE+ +    L   L +M+E AR I++VS E +L V    DE+ Y+  F+  L+++V  WA G++F ++C+ T+++E
Sbjct:   82 VEGCTHEVALPADQEYKQLSQRVGKAAKEYPFILDPFQREALLCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGLHLVVDENGEFREDNFNTAMQVLRDAGDQGGSSGGKWDAKGRRGGTKG-PSNVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVSKLDFNTDDEKKLVEEVFSNAIDCLSDDDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKDFRWISSGEYIQMSGRAGRRGMDERGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAVPGVLEKMKKLEEMYNGIEIPNEE--SVVTYYKIRQQLAKLGKEIEEFIQKPKYCLPFLQPGRLVKVKKEDMEFGWGVIVNFSRKSNVKANTGELDPLYVVEVLVHCSKDSVKNAATEAAKPAAAGE-KGEMQVIPVMLNLLTSISSVRLYIPKDL-----RPYDNRQSMLKSIQEVQKRFPDGLPLLDPIDDMGIKDPALKKVIQKIEAFEHRMYTHPL-HSDPNLETLYTLCEKKALVAGDIKSVKRELKKARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELILTEMVFNGLFNDLTAEQATALLSCFVFQENANEMPKLTEQLAAPLRQMQECARRIAKVSAEAKLTV----DEETYLNQFRPHLMDVVYTWANGASFSQICKMTDVFE 970          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Match: skiv2l (Ski2 like RNA helicase [Source:NCBI gene;Acc:103028968])

HSP 1 Score: 433.721 bits (1114), Expect = 7.601e-133
Identity = 236/562 (41.99%), Postives = 338/562 (60.14%), Query Frame = 3
Query:  324 KRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQ----FQTY----AELPNLITRLREKEKQLEEIPLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH 1961
            KR   PA ++ F LD+FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F DVGLLTGDV ++  AS LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+P  VI T  RP PL+HY+Y   + +    ++ ++   G FL + +  A+     R +  +      N      +    +  +TL+  +   ++ PV+ F+FS+  C+  ++ L+ LD T+  EK +I   F  + + L   DR LPQI  M +L++RGIG+HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    + +  D   ++ G+   L S F LTY MILNL+RVE +    +M  SF +     QT+    +EL  L++ L          PL  +  LS +  +Y     L    E +  ++ +       L  GR+V +   +H
Sbjct:  307 KRIPDPAFKYPFELDTFQKQAILRLEVHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKNTFGDVGLLTGDVQLNPEASCLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPEHVSIILLSATVPNAVEFSEWIGRIKKKPIYVISTVKRPVPLEHYLYTGNSTKTQKELFLLLEATGSFLTKGYYAAVEAKKERTSKHAQSFGAKNAAHNTTLSQDRAIWQTLLNYLSQRQQTPVVAFTFSRTRCDDNSRSLNSLDLTSSVEKNEIHSFFHKSLSRLRGGDRQLPQILVMRDLLKRGIGVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKSGVHDMGDLHAMMLGKPTVLQSQFRLTYTMILNLLRVEALRVTDMMRRSFSENHRDTQTHEKRISELRTLLSSLP---------PLDTEGQLSDLLQYYHTVNELRLTTEALQQAVMESMNGLKALSVGRVVVVNNAQH 859          

HSP 2 Score: 119.783 bits (299), Expect = 6.017e-27
Identity = 72/238 (30.25%), Postives = 132/238 (55.46%), Query Frame = 3
Query: 2373 PMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            P FN     E      +R+  +   D+L   ++  +SL  + E   R ++L+  K+  ++D +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC VF +         N + + ++++  +A+ I  + +EC +    A   + YV  FK GL E+V  WA+G  F ++   T++ EG+++RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct: 1021 PTFN-----EQFARVQERMGLQEELDRLLFLVSD-MSLTLLPEYNQRIKVLKELKYIDESDAVQLKGRVACQISSHELLLTELLFEN-TLSPLAPEESAALLSCLVFTQNTQIEPHIPNTIQEGIDRVLCVAQRIGELQRECGI----AQTAEDYVSQFKFGLTEVVYCWARGMPFAEIAMLTDVQEGTVVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1247          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Match: hfm1 (helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-061207-43])

HSP 1 Score: 134.806 bits (338), Expect = 1.737e-31
Identity = 132/489 (26.99%), Postives = 220/489 (44.99%), Query Frame = 3
Query:  294 PKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEKR------RVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTID-----SNASVLIMTTEILRLML--YRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL-----------PPA---MRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTD--YRPTPLQHYI--YPNGADRIYQVVNEKGEF-LDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAML-NLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFH 1646
            PK I  +  K R     KEF +  +  Q++A+  I   ++  +  A T +GKTV     I   + E        + +Y  PIKAL +Q+Y  +K +F  +GL    LTGD  I+      +A +++ T E    M   ++N+ +++ V   + DE+H ++D +RG   E  +  +           P A   MR V +SATIPN    A W+++  + P   +  D  +RP  L+  +  +P G        N + EF  D   N  MA                              ++I+   D K  P +VF  ++K  +  A +L+K         +   ++ ++ R  L +   ++  +DA L +L+  G+G HH G+    +++VE  F  G +  LF T T +MG+N+PA  V+  S + + G +    +  + +QM GRAGR   DT+   ++M  R    E   Q I G +E + SS H
Sbjct:  222 PKPIHIQAAKFRGVF--KEFPY-FNYVQSKALDDILYTSKNFVACAPTGSGKTVLFELAIIRLLMETTEPWHNVKAVYMAPIKALCSQQYENWKLKFGPLGLNCKELTGDTEIEDVFEIQDAHLIMTTPEKWDSMTRKWKNNCLLQSVQLFLIDEVHVVKDSTRGPTLEVVVSRMKTIHSYTVAESPDASTRMRFVAVSATIPNICDIADWLSN-DQGPATCLEMDESHRPVKLRKVVLGFPFG--------NSQNEFKFDLSLNYKMA------------------------------SVIQTYSDQK--PTLVFCSTRKGVQQSATVLAK---------DARFIMSIDHRQRLMKYASSI--LDAKLRDLIMCGVGYHHAGVSLSDRKVVEDAFTAGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGSCEEYSEADMLQMIGRAGRPQFDTSATAVIMT-RIQTREKYLQFISG-SETIESSLH 653          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Match: polq (DNA polymerase theta [Source:NCBI gene;Acc:103039702])

HSP 1 Score: 118.242 bits (295), Expect = 2.580e-26
Identity = 116/451 (25.72%), Postives = 207/451 (45.90%), Query Frame = 3
Query:  405 NQTVLVSAHTSAGKTVCASYTIASCIKEKRR-VIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNAS-------VLIMTTEILRLMLYRNSSIIKE-----VGWVIFDEIHYMRDKSRGVVWEESIILLPP-------------------AMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSK----LDYTTKPEKEKIELIFLNA---RNTLPEIDRTLPQIDAMLN-LVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNS 1637
             + ++ SA TSAGKT+ +   I   + E RR  I+  P  +++ +K    +  F++ G+        ++A+       V + T E    ++ R   +I+E     +G V+ DE+H + D  RG + E   +LL                      +++V +SAT+PN    A+W++        + +TDYRP PL  ++      +I   + +    L   F  A+ V        K D D+I          S C   +           ++F  SK  CE  A  +++    L +  K  +  ++ + LN    ++ + ++ R+   +D +L   V  G+  HH GL    ++I+E  F +G I+ L AT T S G+N+PA+ VI  + + F+G  + ++T   Y QM GRAGR+G+DT G  +L+  +  +      +I+G  +P++S
Sbjct:  285 GKNLVYSAPTSAGKTLVSELLILKRVLETRRKAIFILPFVSVAREKMFYLQNVFQEAGVRVEGYMGSTSAAGGFSALDVAVCTIEKANGLINR---LIEEDRMDLLGIVVVDELHMLGDSGRGYLLE---LLLTKIQYIATKTKERCTDKAYTDGVQIVGMSATLPNLDLLARWLS------AELYHTDYRPVPLMEWV------KIGTQIYDGSMTLIRQFTPALPV--------KGDDDHI---------VSLCFETVHAGHS-----ALLFCPSKNWCEKLADSIAREFYNLYHKEKQSESGVQSVSLNLEGLQDVVAQLKRSPAGLDQVLQRTVPWGVAFHHAGLTFDERDILEGAFRQGFIRVLAATSTLSSGVNLPARRVIIRTPV-FNGHLLDILT---YKQMVGRAGRKGVDTIGESVLVC-KEAERMKGVSLIQGSLKPISS 690          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Match: mtrex (Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GENE-040426-2854])

HSP 1 Score: 773.852 bits (1997), Expect = 0.000e+0
Identity = 419/898 (46.66%), Postives = 593/898 (66.04%), Query Frame = 3
Query:  267 QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRD--KSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWS-SIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVS---KLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGS 2939
            + C HEV   +   Y+ LK R  +PAKE+ F LD FQ +AI CI+N+Q+VLV+AHTSAGKTVCA Y IA  ++ K+RVI+T+PIKALSNQKYRE  EEF DVGLLTGD+TI+ +AS L+MTTEILR MLYR S I++EV WVIFDEIHYMR+  K RGVVWEE+IILLP  +  VFLSATIPN  QFA+WI HLHKQPC+V+ TDYRPTPLQH+I+P G D +  VV+E  +F ++ F +AM++LR+ GD S+       ++GG K  ES+   +IK + +    PVI+FSFSK+ CE YA  LS+LD+ T+ EK  +E +F NA + L + D+ LPQ+  +L +++RGIGIHHGGL+PVLKE +EILF EGLIK LFATETF+MG+NMPA+TV+FTSA KFDG + R I+SGEYIQMSGRAGRRG+D  G VILM+D  +      Q+++G  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SFFQFQ Y  +P+L+ +L+  + +     LS  +  S  S+Y +E+ L  +  E  + ++R +H     L PGRLV + + +  FGW ++V+   K  S +  +L+V+ ++  + ES+     + A  PP+ + R +  +  + L+ +  +S+V +     L     +  EAR   L     + AR+ + + L+D   DL  K  +++    K +    +   HP+    +   + ++   + +       +R E+ +   +++MDELK RKR+LRR  FCT  DVI  KGR+ACEI+ G E++LTEL+ +G F+ L+ +Q  A LSCFVF+E  +E  +   DL + L KMKE AR I  VS E +L       E A +++ +  L+++V +WA G +F  +   T+ +EG+
Sbjct:   98 EGCTHEVAIAQESAYETLKPRVGLPAKEYPFLLDPFQREAILCIDNSQSVLVAAHTSAGKTVCAEYAIAQALRGKQRVIFTSPIKALSNQKYRELHEEFHDVGLLTGDITINPSASCLVMTTEILRSMLYRGSEIMREVAWVIFDEIHYMRNPGKERGVVWEETIILLPDNVHYVFLSATIPNGTQFAEWICHLHKQPCHVVSTDYRPTPLQHFIFPAGGDGLLLVVDEFLDFKEDNFLQAMSLLREGGDPSRK------RKGGNKG-ESNVFKIIKLIMERNLQPVIIFSFSKRECETYAVQLSQLDFNTEEEKCLVEEVFNNAMSCLSDEDQKLPQVQRVLPILKRGIGIHHGGLLPVLKETIEILFSEGLIKALFATETFAMGINMPARTVLFTSARKFDGRDHRWISSGEYIQMSGRAGRRGMDERGTVILMVDEKMSPTVGHQLLQGSPDPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFFQFQQYKAVPDLLAKLQALQGRYAA--LSVPDAASATSYYHIEQQLQRLHVEARAITLRPQHCLH-VLQPGRLVQVTHGKEHFGWGVVVNFQRKPTSQEEFTLVVEALLLCSEESV-RNAATEAPRPPQPKERGELQVVPVALELVEAISTVRLYMPPDL-----RTPEARHHVLKTLQEVKARFPDGVPLMDPVHDLGIKDPELEAVLHKTRAFAQRRLAHPLHTSPQRDAIRDICVSKAQVAEEVRAVRKEVRRAHMMLQMDELKRRKRVLRRLGFCTQADVIQVKGRVACEITAGHELLLTELVFEGLFNELSPEQAAALLSCFVFQEKASETPKLATDLAEPLRKMKECARRIGHVSVEAKL----LGREDALLDDIRPQLMDVVYSWALGESFFTITTMTDAFEGT 975          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 104.375 bits (259), Expect = 7.069e-23
Identity = 134/502 (26.69%), Postives = 213/502 (42.43%), Query Frame = 3
Query:  351 FSFT-LDSFQNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEK--RRVIYTTPIKALSNQKYREFKEEFE-DVGL-------LTGDVTIDSNA---SVLIMTTE-----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL---------LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPT----PLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQI-DAMLNL-VRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITS--GEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSF------HLTYNMILNLMRVETISPEYLMENSFFQ 1727
            + FT  +  Q Q    +   +  VL+ A T +GKTV A   I          + +Y  P+KAL  ++  ++K   E + G        LTGDVT D+ A   + LI+TT      + R   + + S +K+V  ++ DEIH + D  RG V E  +I+             +R+V LS  + NAR  A W+A   KQ   VI  ++RP+    PL+ +I+                F  +++   MA + K                  +AI +H              PV++F  S++        L+ LD       E     +L+   T  E++  +  + D+ L L +  GIG+HH GL    +  VE LF    I+ L AT T + G+N PA  VI      FDG   R +     + +QM GRAGR   D  G  ++ +   +K +  K+ +  E  P+ SS       HL   +    +  +  + +Y+    FF+
Sbjct:  690 YRFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERMEDWKVRLEPEAGCAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRS--WHSRSYVKQVALLVIDEIHLLGD-DRGPVLE--VIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLA--IKQ---VILFNFRPSVRPVPLEAHIH---------------GFPGQHYCPRMATMNKP---------------TFQAIRTHSPA----------KPVLIFVSSRRQTR-----LTALDLIAFLAGEDNPKQWLHTDET--EMEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFV-HDLKKDFYKKFLY-EPFPVESSLLEVLADHLNAEITSGTITSKQDAMDYITWTYFFR 1132          

HSP 2 Score: 62.3882 bits (150), Expect = 5.327e-10
Identity = 66/271 (24.35%), Postives = 114/271 (42.07%), Query Frame = 3
Query:  774 MRMVFLSATIPNARQFAQWIAHLHKQP-CNVIYTD--YRPTPL-QHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLDTNGNVILM 1568
            +R+V LSAT+PN    A++   LH  P   + + D  +RP PL Q +I     +++ Q+                           +DMD +     ++ +++  + +   VF   ++  +  + + +     AK   +  + T P+  +    F        E  R  P    M  L   G   HH G++   + +VE LF  GL++ L  T T + G+N+PA  VI      +D      +  G  + +Q+ GRAGR   DT G  I++
Sbjct:    8 IRIVGLSATLPNYLDVARF---LHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQM---------------------------HDMDEVCYDKVLEQVKAGHQVM---VFVHARNATVRTAMALREM---AKNNGEAGFFTPPQSAEYGTAFKQV-----ERSRNKP----MRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIII 233          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Match: ascc3 (activating signal cointegrator 1 complex subunit 3 [Source:NCBI gene;Acc:100332599])

HSP 1 Score: 103.99 bits (258), Expect = 9.213e-23
Identity = 123/446 (27.58%), Postives = 189/446 (42.38%), Query Frame = 3
Query:  351 FSFT-LDSFQNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEK--RRVIYTTPIKALSNQKYREFKEEFED----------VGLLTGDVTIDSNA---SVLIMTTE-----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL---------LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPT----PLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQI-DAMLNL-VRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITS--GEYIQMSGRAGRRGLDTNGNVILML 1571
            + FT  +  Q Q    +   +  VL+ A T +GKTV A   I          + +Y  P+KAL  ++  ++K   E           V  LTGDVT D+ A   + LI+TT      + R   + + S +K+V  ++ DEIH + D  RG V E  +I+             +R+V LS  + NAR  A W+A   KQ   VI  ++RP+    PL+ +I+                F  +++   MA + K                  +AI +H              PV++F  S++        L+ LD       E     +L+   T  E++  +  + D+ L L +  GIG+HH GL    +  VE LF    I+ L AT T + G+N PA  VI      FDG   R +     + +QM GRAGR   D  G  ++ +
Sbjct:  689 YRFTHFNPVQTQIFHTLYHGDGNVLLGAPTGSGKTVAAELAIFRIFNAHPGAKAVYIAPLKALVRERMEDWKVRLEPEAGKECAAARVVELTGDVTPDARAIASADLIVTTPEKWDGVSRS--WHSRSYVKQVALLVIDEIHLLGD-DRGPVLE--VIVSRTNFISSHTEKPVRVVGLSTALANARDLADWLAI--KQ---VILFNFRPSVRPVPLEAHIH---------------GFPGQHYCPRMATMNKPT---------------FQAIRTHSPA----------KPVLIFVSSRRQTR-----LTALDLIAFLAGEDNPKQWLHTDET--EMEHIISTVKDSNLKLCLAFGIGMHHAGLHERDRRTVEELFVNTRIQVLIATSTLAWGVNFPAHLVIIKGTEYFDGKTRRYVDFPITDVLQMMGRAGRPQFDDQGKAVIFV 1077          

HSP 2 Score: 67.3958 bits (163), Expect = 1.561e-11
Identity = 88/376 (23.40%), Postives = 154/376 (40.96%), Query Frame = 3
Query:  774 MRMVFLSATIPNARQFAQWIAHLHKQP-CNVIYTD--YRPTPL-QHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQV-IKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEM 1880
            +R+V LSAT+PN    A++   LH  P   + + D  +RP PL Q +I     +++ Q+                           +DMD +     ++ +++  + +   VF   ++  +  + + +     AK   +  + T P+  +    F        E  R  P    M  L   G   HH G++   + +VE LF  GL++ L  T T + G+N+PA  VI      +D      +  G  + +Q+ GRAGR   DT G  I++   T  ++  + + +  +  P+ S F  +    LN         E  +  + F+   +     L  R+R         PL+   Y    SHY+ + SL+  RE+M
Sbjct:    9 IRIVGLSATLPNYLDVARF---LHVNPYIGLFFFDSRFRPVPLSQTFIGVKTTNKMQQM---------------------------HDMDEVCYDKVLEQVKAGHQVM---VFVHARNATVRTAMALREM---AKNNGEAGFFTPPQSAEYGTAFKQV-----ERSRNKP----MRELFPDGFSTHHAGMLRPDRSLVEGLFSRGLVRVLVCTATLAWGVNLPAHAVIIKGTQIYDAKRGTFVDLGALDVMQIFGRAGRPQYDTFGLGIII---TSHDKLGRYLTLLTQQNPIESQFQASLQDNLN------AEDEAGLATAAFEAVRWLSYTYLYVRMRAN-------PLA---YGINHSHYQADPSLHKFREQM 320          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 93.2041 bits (230), Expect = 1.630e-19
Identity = 120/449 (26.73%), Postives = 199/449 (44.32%), Query Frame = 3
Query:  384 AIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRR-VIYTTPIKALSNQKYRE----------FKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSI----IKEVGWVIFDEIHYMRDK-SRGVVWEESIILL---PPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYT-DYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTT----KPEKEKIELIFLNARNTL-PEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTY 1655
            ++  +   + ++ S  TS GKT+ A   +   +  KRR  +   P  A+  +K R           F EE+                S+ I T E    ++  NS +    ++E+G ++ DE+H + +  SRG   E+++  +       +++ +SAT+ N       I  L K     +YT D+RP  L+ YI     D IY V N K    +E F+  + +L     S    MD             H   L+ +V  +     +VF  +KK+CE  A+M+ K    T    + E+++  L  L A   L P + RT+P           G+  HH GL    + ++E  +  G +  L  T T + G+N+PA+ VI  S   + G +   ++  +Y QM GRAGR G+D++G  I +++   K + A  ++ G  E   SS  LTY
Sbjct:   96 SLNSVRQGKNLIYSLPTSGGKTLVAEILMLRELLCKRRDALLILPYVAIVQEKVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLV--NSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKVQYTSKTTQIIGMSATLSN-------INDLQKFLNAELYTNDFRPVELREYI--KLGDSIYGV-NNKALCPEEQFD-FIRLLSYKYSSGMLKMD-----------PDHIVALVTEV--IPAHSCLVFCPTKKNCENVAEMICKYLAKTFLQHREEEKRALLAELQADGELCPVLRRTVPY----------GLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSP--YIGNS--FLSRSQYKQMVGRAGRAGIDSSGESITIVNSRDKAK-AVTLVGGPFEVCQSS--LTY 501          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Match: helq (helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-060503-421])

HSP 1 Score: 90.8929 bits (224), Expect = 6.664e-19
Identity = 120/451 (26.61%), Postives = 198/451 (43.90%), Query Frame = 3
Query:  384 AIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRR-VIYTTPIKALSNQKYRE----------FKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSI----IKEVGWVIFDEIHYMRDK-SRGVVWEESIILL---PPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYT-DYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTK------PEKEKIELIFLNARNTL-PEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTY 1655
            ++  +   + ++ S  TS GKT+ A   +   +  KRR  +   P  A+  +K R           F EE+                S+ I T E    ++  NS +    ++E+G ++ DE+H + +  SRG   E+++  +       +++ +SAT+ N       I  L K     +YT D+RP  L+ YI     D IY V N K    +E F+    +      S K D D             H   L+ +V  +     +VF  +KK+CE  A+M+ K    T+       E+++  L  L A   L P + RT+P           G+  HH GL    + ++E  +  G +  L  T T + G+N+PA+ VI  S   + G +   ++  +Y QM GRAGR G+D++G  I +++   K + A  ++ G  E   SS  LTY
Sbjct:   30 SLNSVRQGKNLIYSLPTSGGKTLVAEILMLRELLCKRRDALLILPYVAIVQEKVRSLSVFGVELEIFIEEYAGSKGRMPPRKKRKKNSLYIATIEKAHSLV--NSLLEEGRMQEIGLIVVDELHMLGEGGSRGATLEQTLAKVQYTSKTTQIIGMSATLSN-------INDLQKFLNAELYTNDFRPVELREYI--KLGDSIYGV-NNKALCPEEQFDFIRLL------SYKMDPD-------------HIVALVTEV--IPAHSCLVFCPTKKNCENVAEMICKYLAKTRHTLHHREEEKRALLAELQADGELCPVLRRTVPY----------GLAYHHSGLTGEERRLIEEAYSAGTLCLLTCTSTLAAGVNLPARRVILRSP--YIGNS--FLSRSQYKQMVGRAGRAGIDSSGESITIVNSRDKAK-AVTLVGGPFEVCQSS--LTY 430          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Match: MTR4 (ATP-dependent 3'-5' RNA helicase of the DExD/H family; involved in nuclear RNA processing and degradation both as a component of TRAMP complex and in TRAMP-independent processes; TRAMP unwinds RNA duplexes, with Mtr4p unwinding activity stimulated by Pap2p/Air2p but not dependent on ongoing polyadenylation; contains an arch domain, with two coiled-coil arms/stalks and a globular fist/KOW domain, which has RNA binding activity and is required for 5.8S rRNA processing [Source:SGD;Acc:S000003586])

HSP 1 Score: 785.793 bits (2028), Expect = 0.000e+0
Identity = 430/965 (44.56%), Postives = 620/965 (64.25%), Query Frame = 3
Query:  279 HEVVYPKNIVYKPLKKRNSI-PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRG----GVKA---IESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHD-FGWCILVSKLRS----------GKFKSLLVDCVI-------PVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY--NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            H+V  P N  Y P+ +   +  A+ + FTLD FQ+ AI CI+  ++VLVSAHTSAGKTV A Y IA  +K K+RVIYT+PIKALSNQKYRE   EF DVGL+TGD+TI+ +A  L+MTTEILR MLYR S +++EV WVIFDE+HYMRDK RGVVWEE+IILLP  +R VFLSATIPNA +FA+WI  +H QPC+++YT++RPTPLQHY++P   D IY VV+EK  F +E F +AMA +        N  D+ GK+G    G  A    +     ++K ++  K +PVIVFSFSK+ CE  A  +SKLD+ +  EKE +  IF NA   LPE DR LPQI  +L L+RRGIGIHH GL+P+LKE++EILF EG +K LFATETFS+GLNMPAKTV+FTS  K+DG   R ++ GEYIQMSGRAGRRGLD  G VI+M+D  ++ + AK ++KG+ + L+S+FHL YNMILNLMRVE ISPE+++E+SFFQFQ    +P +  +L E +K  + I + ++E  ++  ++ +E+++   RE++   +        FL PGRLV I  N  D +GW  +V   +              +S +V+ V+       PV     F   L   I P +   +    +  I L  I  + ++ +     +  S       +KE + K    + R   + I ++D  K++K + +   +  +KI  L TK+ ++P+ N  +  E+   Y ++ +      +L+ +I++  ++I++D+L+ RKR+LRR  FCT  D+I  KGR+ACEIS+GDE++LTEL+ +G F+ L  +Q  A LSCF F+E   E    + +L + L+ M+E+A  I+++ K+ ++EV     EK YVE+F+  L+E+V  W +G+TF ++C+ T++YEGS+IR  +RL+EL+ +L + +  IGN  L++K     +LI R I+ + SLYL
Sbjct:  121 HQVALPPNYDYTPIAEHKRVNEARTYPFTLDPFQDTAISCIDRGESVLVSAHTSAGKTVVAEYAIAQSLKNKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTFREENFQKAMASISNQIGDDPNSTDSRGKKGQTYKGGSAKGDAKGDIYKIVKMIWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKEALTKIFNNAIALLPETDRELPQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFHLGYNMILNLMRVEGISPEFMLEHSFFQFQNVISVPVMEKKLAELKKDFDGIEVEDEE--NVKEYHEIEQAIKGYREDVRQVVTHPANALSFLQPGRLVEISVNGKDNYGWGAVVDFAKRINKRNPSAVYTDHESYIVNVVVNTMYIDSPVNLLKPFNPTLPEGIRPAEEGEKSICAVIPITLDSIKSIGNLRLYMPKDIRAS------GQKETVGKSLREVNRRFPDGIPVLDPVKNMKIEDEDFLKLMKKIDVLNTKLSSNPLTNSMRLEELYGKYSRKHDLHEDMKQLKRKISESQAVIQLDDLRRRKRVLRRLGFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFNELKPEQAAALLSCFAFQERCKEAPRLKPELAEPLKAMREIAAKIAKIMKDSKIEVV----EKDYVESFRHELMEVVYEWCRGATFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNSSLKEKMEAVLKLIHRDIVSAGSLYL 1073          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Match: SKI2 (Ski complex component and putative RNA helicase; mediates 3'-5' RNA degradation by the cytoplasmic exosome; null mutants have superkiller phenotype of increased viral dsRNAs and are synthetic lethal with mutations in 5'-3' mRNA decay; mutations in the human ortholog, SKIV2L, causes Syndromic diarrhea/Trichohepatoenteric (SD/THE) syndrome [Source:SGD;Acc:S000004390])

HSP 1 Score: 411.379 bits (1056), Expect = 3.293e-125
Identity = 222/511 (43.44%), Postives = 304/511 (59.49%), Query Frame = 3
Query:  339 PAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDV--GLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLR--------------------KAGDSSKNDMDNIGKRG-------------GVKAIESHCETLIKKVFDLKKD--------------PVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILM-LDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSF 1721
            PA+ + F LD+FQ +A+  +E   +V V+AHTSAGKTV A Y IA   +   + IYT+PIKALSNQK+R+FKE F+DV  GL+TGDV I+ +A+ LIMTTEILR MLYR + +I++V +VIFDE+HY+ D+ RGVVWEE II+LP  ++ + LSAT+PN  +FA WI    ++   VI T  RP PL+  I+      +  V+N+  EFL+  F +   +L                     + G    N  D  G RG             G  AI S+      +    KK               P++VF FSKK CE YA  L  +++    EK +I +    +   L + DR LPQI    +L+ RGI +HHGGL+P++KE++EILF +G IK LFATETF+MGLN+P +TVIF+S  K DG  +R +T GE+ QM+GRAGRRGLD+ G VI+M  +  +     K+V  G    L S F LTYNMILNL+R+E +  E +++ SF
Sbjct:  322 PARSWPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLITGDVQINPDANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEVIIMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEINIW--AKKELIPVINQNSEFLEANFRKHKEILNGESAKGAPSKTDNGRGGSTARGGRGGSNTRDGRGGRGNSTRGGANRGGSRGAGAIGSNKRKFFTQDGPSKKTWPEIVNYLRKRELLPMVVFVFSKKRCEEYADWLEGINFCNNKEKSQIHMFIEKSITRLKKEDRDLPQILKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVMAYNSPLSIATFKEVTMGVPTRLQSQFRLTYNMILNLLRIEALRVEEMIKYSF 830          

HSP 2 Score: 100.138 bits (248), Expect = 9.774e-22
Identity = 63/201 (31.34%), Postives = 115/201 (57.21%), Query Frame = 3
Query: 2493 MDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXP--QNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            + + + R  +L+  +F      +  KGR+ACEI++G E++LTEL+LD    +   +++VA LS FV+E    E   P     L K  ++++E+ + +  V    ++ +    DE  +++  +  ++ +V  WA+G +F ++ E +   EG+++R I  LDE+  ++  +S +IGN  L  K   A +LIKR I+F++SLYL
Sbjct: 1089 LPDYEKRLAVLKDTEFIDQNHNVLLKGRVACEINSGYELVLTELILDNFLGSFEPEEIVALLSVFVYEGKTREEEPPIVTPRLAKGKQRIEEIYKKMLCVFNTHQIPL--TQDEAEFLDRKRFAMMNVVYEWARGLSFKEIMEMSPEAEGTVVRVITWLDEICREVKTASIIIGNSTLHMKMSRAQELIKRDIVFAASLYL 1287          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Match: HFM1 (Meiosis specific DNA helicase; involved in the conversion of double-stranded breaks to later recombination intermediates and in crossover control; catalyzes the unwinding of Holliday junctions; has ssDNA and dsDNA stimulated ATPase activity [Source:SGD;Acc:S000003220])

HSP 1 Score: 125.946 bits (315), Expect = 1.044e-29
Identity = 136/493 (27.59%), Postives = 218/493 (44.22%), Query Frame = 3
Query:  351 FSFT-LDSFQNQAIQCI-ENNQTVLVSAHTSAGKTVCASYTIASCIKEKR------RVIYTTPIKALSNQKYREFKEEFED--VGLLTGDVTI-----DSNASVLIMTTEILRLMLYR---NSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL-----LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTD--YRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDM--DNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLN-LVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLME-------NSFF 1724
            F FT  +  Q++A   I E+N+  ++S+ T +GKTV     I   IKE        ++IY  P K+L  + Y+ +   F +  VG+LT D +          +++I T E   L+  R    S + + V  V+ DEIH +++K RG   E  +IL     +   +R V LSAT+PN    A W+   ++ P N++  D  YR   L  ++Y                     FN             KND   D I     ++ IE H +            PV++F  ++ S    AK L      +K +K           N  P         D +LN  +++GI  HH G+    +  VE  F  G I  L +T T ++G+N+PA  VI      ++ + ++  +  + +QM GRAGR   +T+G  ++M D  +K +  + +I G T+ L SS HL  N+I +L    ++   Y +E       N+FF
Sbjct:  134 FKFTEFNKMQSEAFPSIYESNENCIISSPTGSGKTVLFELAILRLIKETNSDTNNTKIIYIAPTKSLCYEMYKNWFPSFVNLSVGMLTSDTSFLETEKAKKCNIIITTPEKWDLLTRRWSDYSRLFELVKLVLVDEIHTIKEK-RGASLE--VILTRMNTMCQNIRFVALSATVPNIEDLALWLKTNNELPANILSFDESYRQVQLTKFVYGYS------------------FN------------CKNDFQKDAIYNSKLIEIIEKHADN----------RPVLIFCPTRASTISTAKFLLNNHIFSKSKKRC---------NHNPS--------DKILNECMQQGIAFHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQEYSDLDVLQMIGRAGRPQFETHGCAVIMTDSKMK-QTYENLIHG-TDVLESSLHL--NLIEHLAAETSLETVYSIETAVNWLRNTFF 562          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Match: BRR2 (RNA-dependent ATPase RNA helicase (DEIH box); required for disruption of U4/U6 base-pairing in native snRNPs to activate the spliceosome for catalysis; homologous to human U5-200kD [Source:SGD;Acc:S000000974])

HSP 1 Score: 106.686 bits (265), Expect = 1.027e-23
Identity = 117/470 (24.89%), Postives = 199/470 (42.34%), Query Frame = 3
Query:  297 KNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQC-IENNQTVLVSAHTSAGKTVCASYTIASCI------KEKR------RVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNAS--------VLIMTTEILRLMLYRNS---SIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAM-------RMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDL--KKDPVIVFSFSKKSCEVYAKMLSK-------LDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIF--TSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRT 1580
            K I   P   + + P+ E + +L+  Q++      E +  +L+ A T +GKT  A  T+   +      K K+      +++Y  P+KAL  ++ REF+     +G+   ++T DS  S        VL+ T E   +   RNS   +I++ V  +I DEIH + D  RG V E  +     A        R++ LSAT+PN     +++  + K+      + +RP PL                    +F                         I +R  +K +++  +   +KV +   + + +IVF  S+K     A  L             TK +    +++   A N L           ++  L+  GIG HH GL    + + E LF +GL++ L  T T + G+N+PA TVI   T     +  +   ++  + +QM GRAGR   DT G  I++ D++
Sbjct:  478 KEITSLPDWCQEAFPSSETT-SLNPIQSKVFHAAFEGDSNMLICAPTGSGKTNIALLTVLKALSHHYNPKTKKLNLSAFKIVYIAPLKALVQEQVREFQRRLAFLGIKVAELTGDSRLSRKQIDETQVLVSTPEKWDITT-RNSNNLAIVELVRLLIIDEIHLLHD-DRGPVLESIVARTFWASKYGQEYPRIIGLSATLPNYEDVGRFL-RVPKEGLFYFDSSFRPCPLSQ------------------QFC-----------------------GIKERNSLKKLKAMNDACYEKVLESINEGNQIIVFVHSRKETSRTATWLKNKFAEENITHKLTKNDAGSKQILKTEAANVLDP---------SLRKLIESGIGTHHAGLTRSDRSLSEDLFADGLLQVLVCTATLAWGVNLPAHTVIIKGTDVYSPEKGSWEQLSPQDVLQMLGRAGRPRYDTFGEGIIITDQS 893          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Match: SLH1 (Putative RNA helicase related to Ski2p; involved in translation inhibition of non-poly(A) mRNAs; required for repressing propagation of dsRNA viruses [Source:SGD;Acc:S000003503])

HSP 1 Score: 97.8265 bits (242), Expect = 5.735e-21
Identity = 123/484 (25.41%), Postives = 198/484 (40.91%), Query Frame = 3
Query:  231 PINDIL------LKTIPT---QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKE--KRRVIYTTPIKALSNQKYREFKEEF-----EDVGLLTGDVTID----SNASVLIMTTEILRLML--YRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL-------PPAMRMVFLSATIPNARQFAQWIA----HLHKQPCNVIYTDYRPTPLQHYI--YPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQI-DAMLNL-VRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGA--NVRMITSGEYIQMSGRAGRRGLDTNGNVIL 1565
            P N+ L      L+ +PT   QN + E +YP        K  N +    F +TL             N+   V + T +GKT+ A   I    K    ++++Y  P+KAL  ++  +++++      + V  LTGD   D     +A+++I T E    +   ++    +++V  +I DEIH +    RG + E  +  +          +R++ +S  + NA   A W+      L+  P +V     RP PL+ YI  +P+                    N A   L K  +           +    AI+ H              P ++F  S++        L+ LD       E     FLN  +   E+   L Q+ D  L L ++ GIG+HH GL+   + I   LF +  I+ L AT T + G+N+PA  VI      FD      R +   + +QM GRAGR   DT G  I+
Sbjct: 1106 PFNETLQTKLLKLRPLPTSALQNPLIESIYP-------FKYFNPMQTMTF-YTL----------YNTNENAFVGSPTGSGKTIVAELAIWHAFKTFPGKKIVYIAPMKALVRERVDDWRKKITPVTGDKVVELTGDSLPDPKDVHDATIVITTPEKFDGISRNWQTRKFVQDVSLIIMDEIHLLA-SDRGPILEMIVSRMNYISSQTKQPVRLLGMSTAVSNAYDMAGWLGVKDHGLYNFPSSV-----RPVPLKMYIDGFPD--------------------NLAFCPLMKTMN-----------KPVFMAIKQHS----------PDKPALIFVASRRQTR-----LTALDLIHLCGMEDNPRRFLNIDDE-EELQYYLSQVTDDTLKLSLQFGIGLHHAGLVQKDRSISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDILQMMGRAGRPAYDTTGTAIV 1518          

HSP 2 Score: 81.2629 bits (199), Expect = 6.501e-16
Identity = 103/411 (25.06%), Postives = 177/411 (43.07%), Query Frame = 3
Query:  399 ENNQTVLVSAHTSAGKTVCASYTIASCIKE---------------KRRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTIDSN---ASVLIMTT----EILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILL-------PPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTD--YRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLD--------YTTKP-EKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG 1499
            + N+ +L+ A T AGKT  A  TI + IK+                 +VIY  P+KAL+ +   +F ++     +    LTGD+ +      A+ +I+TT    +++      ++ ++ +V  +I DE+H + +  RG V E  +             +R++ LSAT+PN    A ++  +++Q   + Y D  +RP PL+            Q++  +G               KAG  S+   +NI K    K  E     +I++ +      V+VF  S+K     A+   KL         +   P EK+K       +R+ +   D+ + +I       + G GIHH G+    + + E +F +G IK L  T T + G+N+PA  VI      +D      I  G
Sbjct:  301 KTNENMLICAPTGAGKTDIALLTIINTIKQFSVVNGENEIDIQYDDFKVIYVAPLKALAAEIVDKFSKKLAPFNIQVRELTGDMQLTKAEILATQVIVTTPEKWDVVTRKANGDNDLVSKVKLLIIDEVHLLHE-DRGSVIETLVARTLRQVESSQSMIRIIGLSATLPNFMDVADFLG-VNRQ-IGMFYFDQSFRPKPLEQ-----------QLLGCRG---------------KAG--SRQSKENIDKVAYDKLSE-----MIQRGYQ-----VMVFVHSRKETVKSARNFIKLAESNHEVDLFAPDPIEKDKY------SRSLVKNRDKDMKEI------FQFGFGIHHAGMARSDRNLTEKMFKDGAIKVLCCTATLAWGVNLPADCVIIKGTQVYDSKKGGFIDLG 658          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Match: EDO43976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX65])

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 457/967 (47.26%), Postives = 659/967 (68.15%), Query Frame = 3
Query:  246 LLKTIPT---------QNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILV------SKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPD--GNLFEIE-LKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            LL+++P          + C HEV +PK   Y PL +  + PAKE+ F LD FQ +A++C+ENN++VL+SAHTSAGKTV A Y IA  +++K+RVIYTTPIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S +++EV WV+FDEIHYMRDK RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTD+RPTPLQHYIYP G D ++ VV+EKG+F +E F +AM V+R  G          G++GG K   S+   ++K + +    PVI+FSFSKK CE YA  +SKLD+ T  EK  +E +F NA + L + D+ LPQ++ +L L++RGIGIHH GL+P+LKE +EILF EGLIK LFATETF++GLNMPA+TV+F++A KFDG + R ITSGEYIQMSGRAGRRGLD  G VIL++D  +  +  K ++KG  +PLNS+FHLTYNM+LNL+RVE I+PE ++E SF+QFQ YA +P +I ++++ E + +++ + N+E  SI ++Y++ + L  + ++M + I +     PF+ PGRLV ++ N+ DFGW  ++      ++  SG     L    + +       K     IP P     PD  G +  +  L H+ +  S V     + L SL    ++R+        +  R+ + + L+D  +D+  K D + +  +KI+ L+ ++  HP+    +  ++ +L  K+          R E+ +  +++++DELK RKR+LRR  + T +DVI  KGR+ACE+S+GDE++LTE++ +G F+ LT +Q VA LSCF+ EE  +E+ + + +L   L +M+E AR I++VS+E ++E+    D + YVE F+  ++++V AWA GS+F ++C+ T+I+EGS+IRC+RRL+ELL Q+ ++++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:   82 LLESVPQVDVVTLDILEACTHEVAFPKGFEYTPLVQSAAKPAKEYPFILDPFQKEALRCLENNKSVLISAHTSAGKTVVAEYAIAMSLQKKQRVIYTTPIKALSNQKYRELYEEFQDVGLMTGDVTINPTASALVMTTEILRSMLYRGSEVMREVAWVVFDEIHYMRDKERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWIVHLHKQPCHVVYTDFRPTPLQHYIYPAGGDGLFLVVDEKGDFREENFQKAMGVIRVGGGDPGAQR---GRKGGTKG-PSNTFKIVKMIMERNFQPVIIFSFSKKECEAYALQMSKLDFNTAQEKTLVEEVFNNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHSGLLPILKETIEILFSEGLIKALFATETFALGLNMPARTVVFSNARKFDGKDFRFITSGEYIQMSGRAGRRGLDERGIVILIIDEKMGPDVGKGLLKGHADPLNSAFHLTYNMVLNLLRVEEINPEIMLEKSFYQFQNYAAIPAMIEKMKDLESKRDQVEIPNEE--SITAYYKIRQQLKKLADDMLAFIHQPKYCLPFMQPGRLVRVQNNDEDFGWGAVLNFQKKANQKASGAVGDTLYVLEVLLKCSPKAIKSADGDIPKP---CGPDEKGEMQVVPVLMHLVKRISSVRLYIPKDLRSL----DSRQSVGKSIQEVKKRFPDGLPLLDPIEDMGIKDDGLKKIVRKIEMLEHRMYTHPLHKDPELDKLYSLCEKKAMVSNEIRAARKELKRARTILQLDELKCRKRVLRRLGYATASDVIEVKGRVACELSSGDELLLTEMIFNGVFNELTTEQSVALLSCFICEERSDEMPKLREELAGPLRQMQESARRIAKVSQEAKMEL----DVEEYVEKFRPHIMDVVFAWANGSSFSQICKMTDIFEGSVIRCMRRLEELLRQMCQAAKAIGNTELENKFAEGIVKIKRDIVFAASLYL 1031          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Match: EDO38196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDN7])

HSP 1 Score: 429.869 bits (1104), Expect = 1.606e-134
Identity = 236/570 (41.40%), Postives = 346/570 (60.70%), Query Frame = 3
Query:  342 AKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFE------DVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGV--KAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTI-KNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEE--IPLSNQEYLSIG----SHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKL 1994
            A ++ F  D+FQ QAI  +E + +V V+AHTSAGKT  A Y IA   + + R IYT+PIKALSNQK+R+FK+         D+GLLTGDV I   AS LIMTTEILR MLY  S +I++V WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PN  +FA WI    ++   VI T  RP PL+H++Y   +++    ++ +V++  +FL   +  A+   ++     K+     G R     KA  S   +LI  +    K PV+ F+FS++ CE  A  LS L+ TT  E+ +I +        L   D+TLPQ+  M  L++RGIG+HH G++P+LKE++EILF EGL+K L+ATETF+MG+NMPA+TV+F S  K DG++ R +  GEY+QM+GRAGRRG DT G VI++    + +  D  +++ G+   L S F LTY+MILNL+RVE +  E +M+ SF +F     L    T  R+K +QLE+    + + E +  G    S+Y+    L+ +   + ++       +  L+PGR+V +   EH     +++  L
Sbjct:   19 AHKWDFEPDTFQKQAILRLEAHDSVFVAAHTSAGKTAVAEYAIALAHQHRTRTIYTSPIKALSNQKFRDFKKTLSVDHPGLDIGLLTGDVQIKPEASCLIMTTEILRSMLYNGSDVIRDVEWVIFDEVHYINDAERGVVWEEVLIMLPDHVSIILLSATVPNTLEFADWIGRTKRKKIYVISTAKRPVPLEHFLYTGNSNKTSNELFLLVDQHSKFLTRGYQAAIDAKKERASKGKDAYGAKGARTNYNPKADRSVWLSLITMLEKKDKLPVVAFTFSRRKCEENADQLSNLNLTTSVERSRIHVEMQKYLARLKGSDKTLPQVTRMQELLQRGIGVHHSGILPILKEMIEILFQEGLVKLLYATETFAMGVNMPARTVVFDSTRKNDGSSFRDLLPGEYVQMAGRAGRRGKDTTGTVIILCKGDVPEASDLHKMMLGKPTTLVSQFRLTYSMILNLLRVEQLRVEDMMKRSFSEFH----LQRDATERRQKAEQLEKELADVRDVECVLCGEDLKSYYQACSELSDLTHRVKAAALSSPHGQKALLPGRIVVLDTVEHKNALAVILQVL 584          

HSP 2 Score: 110.153 bits (274), Expect = 1.760e-24
Identity = 70/196 (35.71%), Postives = 110/196 (56.12%), Query Frame = 3
Query: 2499 ELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            E   R  +LR+ ++   T+ +  KGR+ACE+S   E+M+TEL+    F+ L   ++VA LSCFVF++      +  + L++  E++  +A  I+    EC L   PA D K     F  GL+E V  WA+G  F ++   T++ EG I+RCI+RL         S  +IG+  L +K  +AS  +KR I+F++SLY
Sbjct:  766 EYHQRIEVLRKLRYIDRTNRVELKGRVACEMS-NHELMITELVFHSAFTGLQHTEIVALLSCFVFQQRNCSEPKLTSVLEEGKERILSIAEAIANCQLECGLNT-PADDYKG---QFYFGLVEAVYEWARGMPFAEITTLTDVQEGVIVRCIQRL--------YSPLIIGDPTLYQKMEKASTAVKRDIVFATSLY 948          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Match: EDO46714 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC5])

HSP 1 Score: 108.997 bits (271), Expect = 5.469e-24
Identity = 131/501 (26.15%), Postives = 209/501 (41.72%), Query Frame = 3
Query:  351 FSFT-LDSFQNQAIQCIEN-NQTVLVSAHTSAGKTVCASYTIASCIKE--KRRVIYTTPIKALSNQKYREFKEEF-----EDVGLLTGDVTIDS----NASVLIMTTE----ILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL---------LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYA-KMLSKLDYTTKPEK------EKIELIFLNARNTLPEIDRTLPQIDAMLNLVRR-GIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITS--GEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSF------HLTYNMILNLMRVETISPEYLMENSFFQ 1727
            + FT  +  Q Q    + N +  VL+ A T +GKT+ A   I     +    + +Y  P+KAL  ++  ++K  F     + V  LTGDVT DS     A +++ T E    I R   ++  S +K+V  +I DEIH + D+ RG V E  +I+             +R+V LS  + NAR  A W+        N      RP PL+ +I                 F  +++   MA + K                  +AI  H  T           P +VF  S++   + A  +++ L     P++      E++E +    R             D+ L LV   GIG+HH GL    + +VE LF    I+ L AT T + G+N PA  V+      FDG   R +     + +QM GRAGR   D  G  ++++   +K    K+ +  E  P+ SS       HL   ++   +  +  + +Y+    FF+
Sbjct: 1327 YKFTHFNPVQTQVFHTVYNSDHNVLLGAPTGSGKTIIAELAIFRLFDKYPGAKAVYIAPLKALVRERMDDWKVRFGRKLGKRVIELTGDVTPDSRSISQADLIVTTPEKWDGISRS--WQTRSYVKQVNLLIIDEIHLLGDE-RGPVLE--VIVSRTNFISSHTDKKVRVVGLSTALANARDLADWLGIGSAGMFN-FRPSVRPVPLEVHIT---------------GFPGKHYCPRMATMNKPT---------------FEAIRIHSPT----------KPTLVFVSSRRQTRLTALDLIAFLAAQDDPKQWLHMPEEEMEQVLHAVR-------------DSNLKLVLSFGIGLHHAGLHERDRSVVEELFVNQKIQVLIATSTLAWGVNFPAHLVVIKGTEYFDGKKCRYVDFPITDVLQMMGRAGRPQYDDQGKAVILV-HDVKKHFYKKFLY-EPFPVESSLLEVLADHLNAEVVAGTITSKQDAMDYMTWTYFFR 1766          

HSP 2 Score: 97.4413 bits (241), Expect = 2.313e-20
Identity = 107/433 (24.71%), Postives = 178/433 (41.11%), Query Frame = 3
Query:  402 NNQTVLVSAHTSAGKTVCASYTIASCIKE----------KRRVIYTTPIKALSNQKYREFKEEFEDVGL----LTGDVTIDS----NASVLIMTTEILRLMLYRNS---SIIKEVGWVIFDEIHYMRDKSRGVVWE-------ESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIY---TDYRPTPL-QHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQI-----DAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLD--TNGNVILMLDR 1577
             N+ +L+ A T AGKT  A  TI   IK+          K +++Y  P+KAL+ +  R F +    +G+    LTGD+ +         +L+ T E   ++  +++   ++ + V  +I DE+H + D  RG V E         ++     +R+V LSAT+PN    A +   L   P   ++   + +RP PL Q +I   G +   Q                            ++MD I      + +E             K   V+VF  ++ +    A  L ++         + + +   A    P+    L Q+       + +L   G G HH G++   + +VE  F +GLIK L  T T + G+N+PA  VI      +D      +  G  + +Q+ GRAGR   D    G +I   DR
Sbjct:  496 TNENLLICAPTGAGKTNIAMMTIVREIKQNIEQGVIKKDKFKIVYVAPMKALAAEMVRNFSKRLAGLGISVRELTGDMQLTKMEILKTQMLVTTPEKWDVVTRKSTGDVALAQLVKLLIIDEVHLLHD-DRGSVIECLVARTLRQVLSSQSMIRIVGLSATLPNYLDVAHF---LRVDPYKGLFAFDSRFRPVPLGQTFIGVKGLNPFQQA---------------------------HEMDKICYEKVTENVE-------------KGYQVMVFVHARNATVRTAMTLREM------ASNQGDSMLFRAEQA-PDYGSALKQVMRSRNKQLRDLFPDGFGTHHAGMLRTDRTMVEQYFAKGLIKVLVCTATLAWGVNLPAHAVIIKGTEVYDAKKGSFVDLGILDVLQIFGRAGRPQFDKFGEGTIITAHDR 877          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Match: EDO49146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH22])

HSP 1 Score: 100.138 bits (248), Expect = 3.280e-21
Identity = 109/441 (24.72%), Postives = 190/441 (43.08%), Query Frame = 3
Query:  360 TLDSFQNQAIQ-CIENNQTVLVSAHTSAGKTVCASYTIASCI-----------KEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNAS--------VLIMTTEILRLMLYRNS--SIIKEVGWVIFDEIHYMRDKSRGVVWEE-------SIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIY---TDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFD-LKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQI---DAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSG--EYIQMSGRAGRRGLDTNGNVILM 1568
            TL+  Q++  +  + +++ +L+ A T AGKT  A  TI   I            E+ ++IY  P+++L  +    F +     GL   ++T D N +        +++ T E   ++  ++   +  + V  +I DEIH + D  RG V E         I      +R+V LSAT+PN    A +   +   P   ++     +RP PL+                   +F+                        I ++  +K +++  E + +KV +   K+ V+VF  S+K     AK +  +      E++ + L FL   +   E+ R+  +      + +L+  G  IHH G+  V + +VE LF +  I+ L +T T + G+N+PA TVI      +     R +  G  + +QM GRAGR   DT G  IL+
Sbjct:  480 TLNRIQSRLCETALNSDENLLLCAPTGAGKTNVALLTILREIGKHINLDGTINTEEFKIIYVAPMRSLVQEMVLNFSKRLSTYGLTVSELTGDHNLTKEQIHGTQIIVCTPEKWDIITRKSGERTFTQLVRLIIIDEIHLLHD-DRGPVLESLVARTIRQIETTQELVRLVGLSATLPNYEDVATF---MRVNPAKGLFFFDNSFRPVPLEQ------------------QFI-----------------------GITEKKPIKRMQATNEVVYEKVVEHAGKNQVLVFVHSRKETAKTAKAVRDMCL----ERDSLGL-FLREDSASTEVLRSEAEQVKNGELKDLLPYGFAIHHAGMSRVDRTLVEDLFADRHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWVELGALDILQMLGRAGRPQYDTKGEGILI 870          

HSP 2 Score: 81.6481 bits (200), Expect = 1.244e-15
Identity = 108/471 (22.93%), Postives = 196/471 (41.61%), Query Frame = 3
Query:  330 NSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKE--KRRVIYTTPIKALSNQKYREFKEEF-----EDVGLLTGDVTID----SNASVLIMTTEILRLM--LYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIIL---------LPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEY-----IQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNM 1661
            N I  + FS   DS +N           V + A T +GKT+CA + +   +++  + R +Y TPI+AL+ Q Y +++ +F     ++V +LTG+ + D    +  +V++ T E   ++   ++    ++ V   I DE H +   + G V E  II          L   +R+V LS+++ NA+  AQW+        N  + + RP PL+ +I              +G  +    +  +A+ +                   +AI  H            K P +VF  S++  ++ A  L  L ++   + E    +     +  P + R   +   +   V  GI   H GL     +IV  LF  G I+ +  + T  + +N+ A  V+      ++G   +  +  +Y     + M G A R  LD  G  +++   + K E  K+ +    EPL    HL + +
Sbjct: 1329 NPIQTQVFSTLYDSSEN-----------VFIGAPTGSGKTICAEFAVLRFLQQSPEGRCVYVTPIQALAEQVYADWQNKFGLQLGKNVVMLTGETSADLKLLAKGNVVVSTPEKWDVLSRRWKQRKNVQNVSLFIMDEAHLIGGDT-GPVME--IICSRMRYISSQLERTIRIVALSSSLANAKDVAQWLGVPSTGLFN-FHPNVRPVPLELHI--------------QGFNITHTSSRLIAMTKPV----------------YQAIMKHS----------PKKPAVVFVPSRRQTKLLA--LDILTFSGA-DNEPQRFLHCTEDDLNPFVSRLTDK--TLKETVTYGIAFLHEGLSDAEVKIVNQLFTSGAIQVVVVSRTLCLSVNLSAHLVVVMDTQFYEG---KTHSYADYPVTDVLHMIGHASRPLLDDAGKAVILCQAS-KKEFFKKFL---YEPLPIESHLDHTL 1732          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Match: EDO44748 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT3])

HSP 1 Score: 91.2781 bits (225), Expect = 9.021e-19
Identity = 111/472 (23.52%), Postives = 213/472 (45.13%), Query Frame = 3
Query:  315 PLKKRNSIPAKEFSFTLDSFQNQAIQ--CIENNQTVLVSAHTSAGKTVCAS-YTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTID----------SNASVLIMTTEILRLMLYRNSSI----IKEVGWVIFDEIHYMRDKS-RGVVWEESI---ILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQV--VNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKL---DYTTKPEKEKIELI---FLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSF 1643
            P+K ++   A      L  +Q+  ++   I+  + ++ S  TS GKT+ A    +   +   + V+   P  ++  +K +   +   ++G +  +              +  ++ I T E    ++  NS I    + ++G ++ DE+H + +   RG   E  +   +     +++V +SAT+ N     +++         V   D+RP  LQ Y+  +  + +Y+V   + K E  DE + +    +R+ G S   D  +I           H   L+ +V  + +   ++F  +KK+CE  AK++ +    + T     E++EL+      A    P + +++P           GI  HH GL    ++++E  + +G++  L  T T + G+N+PAK VI  +   + G N+  I   +Y QM GRAGR G+D+ G  IL++  T K++ A  +  GE +   SS 
Sbjct:    5 PIKVKDLFLAYRGIQNLYEWQDACLKLPAIQEKRNLIYSLPTSGGKTLVAEILMMKELLVHHKDVVLVLPFVSIVQEKVKTITQFAVELGFVVEEYAGSKGKFPPRKRRTKRALYIATIEKANSLV--NSLIEEKRMDDLGLIVVDELHMLGEGGGRGATLEMCLAKTLFSTNHIQIVGMSATLSNIGDLQKFLM------AEVYSNDFRPVELQEYVKVD--NIVYKVPCSSSKSE-ADEIYVQ----VRRIGHSP--DQRHIKD-------PDHLVPLVLEV--IPQHSCLIFCATKKNCENVAKLMVEFLPREMTQVKIGERMELLQALHHQANGLCPVLKKSVPY----------GIAYHHSGLTMDERKLIEDAYSQGVLCALTCTSTLAAGVNLPAKRVILRAP--YIGRNI--IRKSQYKQMIGRAGRAGIDSTGESILIIKTTDKHKVAP-LFSGEFDSCQSSL 435          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100304468])

HSP 1 Score: 901.353 bits (2328), Expect = 0.000e+0
Identity = 469/973 (48.20%), Postives = 662/973 (68.04%), Query Frame = 3
Query:  207 IDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKA---GDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKS-------LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++S+F   I    + T+  + C HEV  P +  +KPLK+R    AKE+ F LD FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S I++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR     G S     D  G++GG K   S    ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK  +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K LFATETF+MG+NMPA+TV+FTSA KFDG + R ITSGEYIQMSGRAGRRG+D  G VI M+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  LP ++ ++++ E+Q   I + N+E  S+ +++++ + L  + +E+   I K     PFL PGRLV +K ++ DFGW ++V+  +    K+        +V+ ++  + ES+       A P P  ET  +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK++  + ++  HP+ + D +LE + +L  K+          + E+ K  ++++MDELK RKR+LRR  F + +DVI  KGR+ACEIS+GDE++LTE++ +G F++L+ +Q  A LSCFVF+E  +EI +    L   L +M+E A+ I++VS + +LEV    DE+ Y+  FK  L+++V AWA GS+F ++C+ T+++EGSIIRC+RRL+E+L Q+  +++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:   80 LNLSEFMPQIKVEQVDTV--EGCSHEVALPADYEFKPLKQRVGKAAKEYPFVLDPFQREAILCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLITGDVTINPTASCLVMTTEILRSMLYRGSEIMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDVGDSGGSGGGKWDPRGRKGGTKG-PSSVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVAKLDFNTDDEKRLVEEVFNNAVDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKALFATETFAMGINMPARTVLFTSARKFDGKSHRFITSGEYIQMSGRAGRRGMDDRGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRALPGVVEKIKKLEEQYHTIEIPNEE--SVVTYFKIRQQLAKLSKEIQEFIHKPKYCLPFLQPGRLVKVKKDDADFGWGVVVNFCKKTNVKASTDSDPLYVVEVLLHCSKESMKNAATEAAKPAPPGETG-EMQVVPVMLHLLTSISSVRLYIPKDL-----RPFDNRQLMLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVIQKVEAFEHRMYTHPL-HSDPNLESVYSLCEKKALIATEVRTAKRELKKARTVLQMDELKCRKRVLRRLGFASPSDVIEMKGRVACEISSGDELLLTEMMFNGLFNDLSVEQATALLSCFVFQENASEIPKLTEQLAAPLRQMQECAKRIAKVSADAKLEV----DEETYLSQFKSHLMDVVFAWANGSSFSQICKMTDVFEGSIIRCMRRLEEVLRQMCSAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1036          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Match: mtrex (Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:100304468])

HSP 1 Score: 838.18 bits (2164), Expect = 0.000e+0
Identity = 448/973 (46.04%), Postives = 637/973 (65.47%), Query Frame = 3
Query:  207 IDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKA---GDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKS-------LLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARY-NTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMI-NLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYL 3089
            +++S+F   I    + T+  + C HEV  P +  +KPLK+R    AKE+ F LD FQ +AI CI+NNQ+VLVSAHTSAGKTVCA Y IA  ++EK+RVI+T+PIKALSNQKYRE  EEF+DVGL+TGDVTI+  AS L+MTTEILR MLYR S I++EV WVIFDEIHYMRD  RGVVWEE+IILLP  +  VFLSATIPNARQFA+WI HLHKQPC+V+YTDYRPTPLQHYI+P G D ++ VV+E G+F ++ FN AM VLR     G S     D  G++GG K   S    ++K + +    PVI+FSFSKK CE YA  ++KLD+ T  EK  +E +F NA + L + D+ LPQ++ +L L++RGIGIHHGGL+P+LKE +EILF EGL+K                     TS      A   +ITSGEYIQMSGRAGRRG+D  G VI M+D  +     KQ++KG  +PLNS+FHLTYNM+LNL+RVE I+PEY++E SF+QFQ Y  LP ++ ++++ E+Q   I + N+E  S+ +++++ + L  + +E+   I K     PFL PGRLV +K ++ DFGW ++V+  +    K+        +V+ ++  + ES+       A P P  ET  +  +  + L  +  +SSV +     L     +  + R+  L     +  R+ + + L+D   D+  K   + +  QK++  + ++  HP+ + D +LE + +L  K+          + E+ K  ++++MDELK RKR+LRR  F + +DVI  KGR+ACEIS+GDE++LTE++ +G F++L+ +Q  A LSCFVF+E  +EI +    L   L +M+E A+ I++VS + +LEV    DE+ Y+  FK  L+++V AWA GS+F ++C+ T+++EGSIIRC+RRL+E+L Q+  +++ IGN +LE KF E    IKR I+F++SLYL
Sbjct:   80 LNLSEFMPQIKVEQVDTV--EGCSHEVALPADYEFKPLKQRVGKAAKEYPFVLDPFQREAILCIDNNQSVLVSAHTSAGKTVCAEYAIALALREKQRVIFTSPIKALSNQKYREMYEEFQDVGLITGDVTINPTASCLVMTTEILRSMLYRGSEIMREVAWVIFDEIHYMRDAERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLHKQPCHVVYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDVGDSGGSGGGKWDPRGRKGGTKG-PSSVFKIVKMIMERNFQPVIIFSFSKKECEAYALQVAKLDFNTDDEKRLVEEVFNNAVDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLLKV--------------------TSVQFLQIATPLIITSGEYIQMSGRAGRRGMDDRGIVIFMVDEKMSPAVGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRALPGVVEKIKKLEEQYHTIEIPNEE--SVVTYFKIRQQLAKLSKEIQEFIHKPKYCLPFLQPGRLVKVKKDDADFGWGVVVNFCKKTNVKASTDSDPLYVVEVLLHCSKESMKNAATEAAKPAPPGETG-EMQVVPVMLHLLTSISSVRLYIPKDL-----RPFDNRQLMLKSIQEVQKRFPDGVPLLDPIDDMGIKDPGLKKVIQKVEAFEHRMYTHPL-HSDPNLESVYSLCEKKALIATEVRTAKRELKKARTVLQMDELKCRKRVLRRLGFASPSDVIEMKGRVACEISSGDELLLTEMMFNGLFNDLSVEQATALLSCFVFQENASEIPKLTEQLAAPLRQMQECAKRIAKVSADAKLEV----DEETYLSQFKSHLMDVVFAWANGSSFSQICKMTDVFEGSIIRCMRRLEEVLRQMCSAAKAIGNTELENKFAEGITKIKRDIVFAASLYL 1016          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Match: skiv2l (Ski2 like RNA helicase [Source:NCBI gene;Acc:101154960])

HSP 1 Score: 520.776 bits (1340), Expect = 1.711e-165
Identity = 329/953 (34.52%), Postives = 518/953 (54.35%), Query Frame = 3
Query:  324 KRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYA-ELPNLITRLREKEKQLEEIPLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH--DFGWCILVSKLRSGKFKSLLVDC---------VIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGC-TDQLLHSLKKNDEARKEFLNKRNSI---------IARYNT--IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            KR   PA ++ F LD FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F+DVGLLTGDV +   ++ LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+   VI T  RP PL+H++Y   + +    ++ +V+  G FL + +  A+     R +  +      N  +        S    L+  +   ++ PV+ F+FS+  C+  A+ L  +D TT  EK +I   F  + + L   DR LPQI  M +L++RG+ +HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    +    D   ++ G+   L S F LTY MILNL+RVE +    +M+ SF +    A E    I++LR+    L   PL  +  LS +  +Y     L    E +  +I +       L  GR++ +   +H    G  + VS     +  + L+ C             A   L+   L +   P  H  +      +++L+ I  ++   +    D+++ +  K  + R        +I         +A  N   +  +D   DL+ K   + E   +++ LQ  +++    +     E      +R+  +   D+L   ++ + SL  + E   R ++L+  ++      +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC VF +         + L +S+E++  +AR I  + +EC +   P T E+ +V  FK GL E+V  WA+G  F ++   T+I EG+++RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct:  306 KRIPNPAFKWPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKTTFKDVGLLTGDVQLSPESACLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPDHVSIILLSATVPNALEFSEWIGRIKKKHIYVISTMKRPVPLEHHLYTGNSTKTQKEMFLLVDAAGNFLTKGYYAAVDAKKERSSKHAQTFGAKNTSQNTTASQDRSVWLALLHFLSQRQQTPVVAFTFSRARCDDNARSLESMDLTTSVEKAEIHSFFQKSLSRLRGGDRQLPQILLMRDLLKRGVAVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAGVHEMADLHAMMMGKPTILQSQFRLTYTMILNLLRVEALRVTDMMKRSFSESHRNAQEHEKRISQLRQTLSSLP--PLDPEGQLSDLLPYYHTVAELRVTNESLQKAIVESVNGLKALSVGRVLVVNNKQHLNALGVILQVSSDAVNRTFTALIICEKGNEEGKGEPDAASPHLYNTALFIPEGPCSHTVQ------KLKLQDISAITVKTLKVIPDRIIDNYNKRQQPRFRHEPPGQAISTATQELLRLAEANPGGLATLDPVNDLQLKSVDVVEGSMRLRLLQDSLKSFTCIHSPTFAEQFARVKERMSVQEELDRLLFLVSDQ-SLTLLPEYHQRIKVLQSLQYIDSGGAVQLKGRVACQISSHELLLTELLFEN-VMSPLAPEESAALLSCLVFTQKTQVEPHLTSTLKESIERVLSVARRIGELQRECGI---PQTAEE-FVGQFKFGLTEVVYCWARGMPFAEIALLTDIQEGTVVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1244          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Match: skiv2l (Ski2 like RNA helicase [Source:NCBI gene;Acc:101154960])

HSP 1 Score: 518.85 bits (1335), Expect = 5.102e-165
Identity = 340/1020 (33.33%), Postives = 536/1020 (52.55%), Query Frame = 3
Query:  123 NASKKRKLDDFLVEYV--DKASDVEEKKTKIDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYA-ELPNLITRLREKEKQLEEIPLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH--DFGWCILVSKLRSGKFKSLLVDC---------VIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGC-TDQLLHSLKKNDEARKEFLNKRNSI---------IARYNT--IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            N  +   L+D  ++ +  DK    EEKK      D  +P +D   K IP                         PA ++ F LD FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F+DVGLLTGDV +   ++ LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+   VI T  RP PL+H++Y   + +    ++ +V+  G FL + +   +   R+  +  +                S    L+  +   ++ PV+ F+FS+  C+  A+ L  +D TT  EK +I   F  + + L   DR LPQI  M +L++RG+ +HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    +    D   ++ G+   L S F LTY MILNL+RVE +    +M+ SF +    A E    I++LR+    L   PL  +  LS +  +Y     L    E +  +I +       L  GR++ +   +H    G  + VS     +  + L+ C             A   L+   L +   P  H  +      +++L+ I  ++   +    D+++ +  K  + R        +I         +A  N   +  +D   DL+ K   + E   +++ LQ  +++    +     E      +R+  +   D+L   ++ + SL  + E   R ++L+  ++      +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC VF +         + L +S+E++  +AR I  + +EC +   P T E+ +V  FK GL E+V  WA+G  F ++   T+I EG+++RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct:  247 NVLRTNSLEDLGIKVIQLDKIQSPEEKKKWAIPVDITSPCDD-FYKRIPN------------------------PAFKWPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKTTFKDVGLLTGDVQLSPESACLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPDHVSIILLSATVPNALEFSEWIGRIKKKHIYVISTMKRPVPLEHHLYTGNSTKTQKEMFLLVDAAGNFLTKGYGFTVLCSRRCQEGDR----------------SVWLALLHFLSQRQQTPVVAFTFSRARCDDNARSLESMDLTTSVEKAEIHSFFQKSLSRLRGGDRQLPQILLMRDLLKRGVAVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAGVHEMADLHAMMMGKPTILQSQFRLTYTMILNLLRVEALRVTDMMKRSFSESHRNAQEHEKRISQLRQTLSSLP--PLDPEGQLSDLLPYYHTVAELRVTNESLQKAIVESVNGLKALSVGRVLVVNNKQHLNALGVILQVSSDAVNRTFTALIICEKGNEEGKGEPDAASPHLYNTALFIPEGPCSHTVQ------KLKLQDISAITVKTLKVIPDRIIDNYNKRQQPRFRHEPPGQAISTATQELLRLAEANPGGLATLDPVNDLQLKSVDVVEGSMRLRLLQDSLKSFTCIHSPTFAEQFARVKERMSVQEELDRLLFLVSDQ-SLTLLPEYHQRIKVLQSLQYIDSGGAVQLKGRVACQISSHELLLTELLFEN-VMSPLAPEESAALLSCLVFTQKTQVEPHLTSTLKESIERVLSVARRIGELQRECGI---PQTAEE-FVGQFKFGLTEVVYCWARGMPFAEIALLTDIQEGTVVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1211          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Match: skiv2l (Ski2 like RNA helicase [Source:NCBI gene;Acc:101154960])

HSP 1 Score: 466.848 bits (1200), Expect = 1.598e-145
Identity = 310/953 (32.53%), Postives = 490/953 (51.42%), Query Frame = 3
Query:  324 KRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADR----IYQVVNEKGEFLDEYFNEAMAVL--RKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKN-EDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYA-ELPNLITRLREKEKQLEEIPLSNQEYLS-IGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEH--DFGWCILVSKLRSGKFKSLLVDC---------VIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGC-TDQLLHSLKKNDEARKEFLNKRNSI---------IARYNT--IFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLY 3086
            KR   PA ++ F LD FQ QAI  +E + +V V+AHTSAGKTV A Y IA   K   R IYT+PIKALSNQK+R+FK  F+DVGLLTGDV +   ++ LIMTTEILR MLY  S +I+++ WVIFDE+HY+ D  RGVVWEE +I+LP  + ++ LSAT+PNA +F++WI  + K+   VI T  RP PL+H++Y   + +    ++ +V+  G FL + +  A+     R +  +      N  +        S    L+  +   ++ PV+ F+FS+  C+  A+ L  +D TT  EK +I   F  + + L   DR LPQI  M +L++RG+ +HH G++P+LKE++E+LF  GL+K LFATETF+MG+NMPA+TV+F S  K DG   R +  GEYIQM+GRAGRRGLD  G VI++    +    D   ++ G+   L S F LTY MILNL+RVE +    +M+ SF +    A E    I++LR+    L   PL  +  LS +  +Y     L    E +  +I +       L  GR++ +   +H    G  + VS     +  + L+ C             A   L+   L +   P  H  +      +++L+ I  ++   +    D+++ +  K  + R        +I         +A  N   +  +D   DL+ K   + E   +++ LQ  +++    +     E      +R+  +   D+L   ++ + SL  + E   R ++L+  ++      +  KGR+AC+IS+ + ++   L  +   S L  ++  A LSC V                    +  ++  H++   KE                                  F ++   T+I EG+++RCI+RLDE+L ++ +++R++G+  L  K   AS  I+R I+F++SLY
Sbjct:  306 KRIPNPAFKWPFELDVFQKQAILRLEAHDSVFVAAHTSAGKTVVAEYAIALSQKHMTRTIYTSPIKALSNQKFRDFKTTFKDVGLLTGDVQLSPESACLIMTTEILRSMLYNGSEVIRDLEWVIFDEVHYINDAERGVVWEEVLIMLPDHVSIILLSATVPNALEFSEWIGRIKKKHIYVISTMKRPVPLEHHLYTGNSTKTQKEMFLLVDAAGNFLTKGYYAAVDAKKERSSKHAQTFGAKNTSQNTTASQDRSVWLALLHFLSQRQQTPVVAFTFSRARCDDNARSLESMDLTTSVEKAEIHSFFQKSLSRLRGGDRQLPQILLMRDLLKRGVAVHHSGILPILKEVIEMLFSRGLVKVLFATETFAMGVNMPARTVVFDSIRKHDGTGFRNLLPGEYIQMAGRAGRRGLDATGTVIILCKAGVHEMADLHAMMMGKPTILQSQFRLTYTMILNLLRVEALRVTDMMKRSFSESHRNAQEHEKRISQLRQTLSSLP--PLDPEGQLSDLLPYYHTVAELRVTNESLQKAIVESVNGLKALSVGRVLVVNNKQHLNALGVILQVSSDAVNRTFTALIICEKGNEEGKGEPDAASPHLYNTALFIPEGPCSHTVQ------KLKLQDISAITVKTLKVIPDRIIDNYNKRQQPRFRHEPPGQAISTATQELLRLAEANPGGLATLDPVNDLQLKSVDVVEGSMRLRLLQDSLKSFTCIHSPTFAEQFARVKERMSVQEELDRLLFLVSDQ-SLTLLPEYHQRIKVLQSLQYIDSGGAVQLKGRVACQISSHELLLTELLFEN-VMSPLAPEESAALLSCLV------------------FTQKTQVEPHLTSTLKE---------------------------------PFAEIALLTDIQEGTVVRCIQRLDEVLKEVRQAARIVGDSVLGSKMERASLAIRRDIVFTASLY 1197          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Match: SMESG000063270.1 (SMESG000063270.1)

HSP 1 Score: 2040.77 bits (5286), Expect = 0.000e+0
Identity = 1004/1004 (100.00%), Postives = 1004/1004 (100.00%), Query Frame = 3
Query:   90 EVAEVPVEIKDNASKKRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYLATDK 3101
            EVAEVPVEIKDNASKKRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCFVFEEFVNEIIEPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYLATDK
Sbjct:   11 EVAEVPVEIKDNASKKRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSLNAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKFKSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCFVFEEFVNEIIEPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKRGIIFSSSLYLATDK 1014          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Match: SMESG000004673.1 (SMESG000004673.1)

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 464/1012 (45.85%), Postives = 651/1012 (64.33%), Query Frame = 3
Query:  135 KRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNP------INDI---------LLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLS-----IGSHYRLEKSL-NAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSG----KFKS-------LLVDCVIPVAHESLFAKEL---SMAIPPPK----HETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYH----KRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEA 3041
            +++L+DF+  ++D++  +E  + KI  +   N       I DI         + K    ++  HEV  P  I ++PLK+  + P K + F LD+FQ  AI+CI+N Q+VLVSAHTSAGKTV A Y IA  + +K+RVIYTTPIKALSNQKYREF EEF +VGLLTGDVT+  NASVLIMTTEIL+ MLYR SSI++EVGWVIFDEIHYMRD+ RGVVWEESI+LLP  +R  FLSATIPNARQFA+WI+ LH Q C+V++T+YRP PLQHY++P   D +  VV++KG FL++ F  AM  L    DS+     +I      K  ES+   +++ + + K +P+IVFSFSKK CE+YA  L+KL++ +  E   ++ +F NA   L + D+ LPQ+   L L+RRGIG+HHGGL+P+LKE VEILF EGL+KCLFATETF+MGLNMPA+TV+FTSA K+DG+  R I++ EYIQMSGRAGRRG D  G VILM+D T+ + DA+++I+G  +PLNS+FH+TYNM+LNLMRVE I+PEY++E SFFQFQ  A +P       E E+ L+ +  + +E          S+++L+++L NA  +EM   I K      F+ PGRL+ +K +  DFGW  +V+  R      K+ S        LV+C++ VA +    K+L   S AI   +     + RP GN  ++ +++I ++               +K  E + E ++   S   R   + ++D  KD+K   +   +  +KI+  + K+ NH   N     E++  +     KRLE E     L  EI KK S+I+M+ELKSRKR+LRR  +C D DVI  KGR+ACEI+  DE+++TELLL G F+NL   Q  AF+SC VFEE  +E+      L  +   ++  A+ ++ +S ECRL+V    + ++Y+++FK  ++++V  WA G TF++L   T I+EGSIIRCIR L+E+L QL  +++ IGN  LE+KF E 
Sbjct:   35 QKRLEDFIQPFIDESEKLETNE-KIQSNFLTNQCLLSEHITDIDIGKAARIKIHKVSGDESFSHEVAVPPTIEFEPLKEIVN-PLKAYPFELDNFQKAAIKCIDNRQSVLVSAHTSAGKTVIAEYAIAKALSDKQRVIYTTPIKALSNQKYREFSEEFSEVGLLTGDVTLSPNASVLIMTTEILQSMLYRGSSIMREVGWVIFDEIHYMRDRERGVVWEESIVLLPDEIRCAFLSATIPNARQFAEWISFLHNQLCHVVFTEYRPVPLQHYVFPCNGDGLLLVVDDKGRFLEDNFKSAMNKLGPNSDSTSERAGSIMVARSQKN-ESNVFKIVRLIMEHKLEPLIVFSFSKKECEIYATQLAKLNFNSDEETAYVDEVFKNAMECLSDADKELPQVLTSLPLLRRGIGVHHGGLLPILKETVEILFSEGLLKCLFATETFAMGLNMPARTVLFTSARKYDGSEYRWISANEYIQMSGRAGRRGKDERGTVILMVDETMSDIDARKIIQGTPDPLNSAFHITYNMLLNLMRVEGINPEYMIERSFFQFQNQAFVP-------EAEESLKALIAAYEEMEVEQEELAASYFKLDEALQNAYFKEM-DYIHKSSKLINFMQPGRLIKVKRDSEDFGWGAVVNIKRQQPQLLKYSSATTDEALYLVECLLTVAADRTTIKKLPQSSAAISAVRLVMPQDLRPTGNREKV-IQNIEKIK--------------EKFFEMKSEMMSSNKSPSVRNEDLPILDAIKDVKIDDESFLKIKRKIESYEKKLNNHEFLNISNFEEILKSFREKEKKRLEIEN----LEKEIIKKRSIIQMNELKSRKRVLRRLNYCNDKDVIELKGRVACEITGADELLVTELLLKGVFNNLNPSQTAAFVSCLVFEEKSSEMPTLNPALSTAFRTLQNEAKILADISVECRLDV----NSESYIDSFKPHMMDVVLRWADGQTFLQLVNKTTIFEGSIIRCIRLLEEVLRQLANAAKTIGNTNLEEKFLEG 1012          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Match: SMESG000004886.1 (SMESG000004886.1)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 459/1011 (45.40%), Postives = 641/1011 (63.40%), Query Frame = 3
Query:  135 KRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNP------INDI---------LLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLS-----IGSHYRLEKSL-NAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSG----KFKS-------LLVDCVIPVAHESLFAKELSMAIPPPK----------HETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEA 3041
            +++L+DF+  ++D++  +E  + KI  +   N       I DI         + K    ++  HEV  P  I ++PLK+  + P K + F LD+FQ  AI+CI+N Q+VLVSAHTSAGKTV A Y IA  + +K+RVIYTTPIKALSNQKYREF EEF +VGLLTGDVT+  NASVLIMTTEIL+ MLYR SSI++EVGWVIFDEIHYMRD+ RGVVWEESI+LLP  +R  FLSATIPNARQFA+WI+ LH Q C+V++T+YRP PLQHY++P   D +  VV++KG FL++ F  AM  L    DS+     +I      K  ES+   +++ + + K +P+IVFSFSKK CE+YA  L+KL++ +  E   ++ +F NA   L + D+ LPQ+   L L+RRGIG+HHGGL+P+LKE VEILF EGL+KCLFATETF+MGLNMPA+TV+FTSA K+DG+  R I++ EYIQMSGRAGRRG D  G VILM+D T+ + DA+++I+G  +PLNS+FH+TYNM+LNLMRVE I+PEY++E SFFQFQ  A +P       E E+ L+ +  + +E          S+++L+++L NA  +EM   I K      F+ PGRL+ +K +  DFGW  +V+  R      K+ S        LV+C++ VA +    K+L   +  P+           + RP GN  ++ +++I ++               +K  E + E ++   S   R   + ++D  KD+K     ID                     D+S   + +  KRLE E     L  EI KK S+I+M+ELKSRKR+LRR  +C D DVI  KGR+ACEI+  DE+++TELLL G F+NL   Q  AF+SC VFEE  +E+      L  +   ++  A+ ++ +S ECRL+V    + ++Y+++FK  ++++V  WA G TF++L   T I+EGSIIRCIR L+E+L QL  +++ IGN  LE+KF E 
Sbjct:   35 QKRLEDFIQPFIDESEKLETNE-KIQSNFLTNQCLLSEHITDIDIGKAARIKIHKVSGDESFSHEVAVPPTIEFEPLKEIVN-PLKAYPFELDNFQKAAIKCIDNRQSVLVSAHTSAGKTVIAEYAIAKALSDKQRVIYTTPIKALSNQKYREFSEEFSEVGLLTGDVTLSPNASVLIMTTEILQSMLYRGSSIMREVGWVIFDEIHYMRDRERGVVWEESIVLLPDEIRCAFLSATIPNARQFAEWISFLHNQLCHVVFTEYRPVPLQHYVFPCNGDGLLLVVDDKGRFLEDNFKSAMNKLGPNSDSTSERAGSIMVARSQKN-ESNVFKIVRLIMEHKLEPLIVFSFSKKECEIYATQLAKLNFNSDEETAYVDEVFKNAMECLSDADKELPQVLTSLPLLRRGIGVHHGGLLPILKETVEILFSEGLLKCLFATETFAMGLNMPARTVLFTSARKYDGSEYRWISANEYIQMSGRAGRRGKDERGTVILMVDETMSDIDARKIIQGTPDPLNSAFHITYNMLLNLMRVEGINPEYMIERSFFQFQNQAFVP-------EAEESLKALIAAYEEMEVEQEELAASYFKLDEALQNAYFKEM-DYIHKSSKLINFMQPGRLIKVKRDSEDFGWGAVVNIKRQQPQLLKYSSATTDEALYLVECLLTVAADRTTIKKLPQELRVPERRNAVRLVMPQDLRPTGNREKV-IQNIEKIK--------------EKFFEMKSEMMSSNKSPSVRNEDLPILDAIKDVK-----ID---------------------DESF--LKIKRKRLEIEN----LEKEIIKKRSIIQMNELKSRKRVLRRLNYCNDKDVIELKGRVACEITGADELLVTELLLKGVFNNLNPSQTAAFVSCLVFEEKSSEMPTLNPALSTAFRTLQNEAKILADISVECRLDV----NSESYIDSFKPHMMDVVLRWADGQTFLQLVNKTTIFEGSIIRCIRLLEEVLRQLANAAKTIGNTNLEEKFLEG 983          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Match: SMESG000004886.1 (SMESG000004886.1)

HSP 1 Score: 808.135 bits (2086), Expect = 0.000e+0
Identity = 459/1014 (45.27%), Postives = 641/1014 (63.21%), Query Frame = 3
Query:  135 KRKLDDFLVEYVDKASDVEEKKTKIDVSDFKNP------INDI---------LLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLS-----IGSHYRLEKSL-NAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSG----KFKS-------LLVDCVIPVAHESLFAKELSMAIPPPK-------------HETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEA 3041
            +++L+DF+  ++D++  +E  + KI  +   N       I DI         + K    ++  HEV  P  I ++PLK+  + P K + F LD+FQ  AI+CI+N Q+VLVSAHTSAGKTV A Y IA  + +K+RVIYTTPIKALSNQKYREF EEF +VGLLTGDVT+  NASVLIMTTEIL+ MLYR SSI++EVGWVIFDEIHYMRD+ RGVVWEESI+LLP  +R  FLSATIPNARQFA+WI+ LH Q C+V++T+YRP PLQHY++P   D +  VV++KG FL++ F  AM  L    DS+     +I      K  ES+   +++ + + K +P+IVFSFSKK CE+YA  L+KL++ +  E   ++ +F NA   L + D+ LPQ+   L L+RRGIG+HHGGL+P+LKE VEILF EGL+KCLFATETF+MGLNMPA+TV+FTSA K+DG+  R I++ EYIQMSGRAGRRG D  G VILM+D T+ + DA+++I+G  +PLNS+FH+TYNM+LNLMRVE I+PEY++E SFFQFQ  A +P       E E+ L+ +  + +E          S+++L+++L NA  +EM   I K      F+ PGRL+ +K +  DFGW  +V+  R      K+ S        LV+C++ VA +    K+L   +  P+              + RP GN  ++ +++I ++               +K  E + E ++   S   R   + ++D  KD+K     ID                     D+S   + +  KRLE E     L  EI KK S+I+M+ELKSRKR+LRR  +C D DVI  KGR+ACEI+  DE+++TELLL G F+NL   Q  AF+SC VFEE  +E+      L  +   ++  A+ ++ +S ECRL+V    + ++Y+++FK  ++++V  WA G TF++L   T I+EGSIIRCIR L+E+L QL  +++ IGN  LE+KF E 
Sbjct:   35 QKRLEDFIQPFIDESEKLETNE-KIQSNFLTNQCLLSEHITDIDIGKAARIKIHKVSGDESFSHEVAVPPTIEFEPLKEIVN-PLKAYPFELDNFQKAAIKCIDNRQSVLVSAHTSAGKTVIAEYAIAKALSDKQRVIYTTPIKALSNQKYREFSEEFSEVGLLTGDVTLSPNASVLIMTTEILQSMLYRGSSIMREVGWVIFDEIHYMRDRERGVVWEESIVLLPDEIRCAFLSATIPNARQFAEWISFLHNQLCHVVFTEYRPVPLQHYVFPCNGDGLLLVVDDKGRFLEDNFKSAMNKLGPNSDSTSERAGSIMVARSQKN-ESNVFKIVRLIMEHKLEPLIVFSFSKKECEIYATQLAKLNFNSDEETAYVDEVFKNAMECLSDADKELPQVLTSLPLLRRGIGVHHGGLLPILKETVEILFSEGLLKCLFATETFAMGLNMPARTVLFTSARKYDGSEYRWISANEYIQMSGRAGRRGKDERGTVILMVDETMSDIDARKIIQGTPDPLNSAFHITYNMLLNLMRVEGINPEYMIERSFFQFQNQAFVP-------EAEESLKALIAAYEEMEVEQEELAASYFKLDEALQNAYFKEM-DYIHKSSKLINFMQPGRLIKVKRDSEDFGWGAVVNIKRQQPQLLKYSSATTDEALYLVECLLTVAADRTTIKKLPQELRVPERRNAISAVRLVMPQDLRPTGNREKV-IQNIEKIK--------------EKFFEMKSEMMSSNKSPSVRNEDLPILDAIKDVK-----ID---------------------DESF--LKIKRKRLEIEN----LEKEIIKKRSIIQMNELKSRKRVLRRLNYCNDKDVIELKGRVACEITGADELLVTELLLKGVFNNLNPSQTAAFVSCLVFEEKSSEMPTLNPALSTAFRTLQNEAKILADISVECRLDV----NSESYIDSFKPHMMDVVLRWADGQTFLQLVNKTTIFEGSIIRCIRLLEEVLRQLANAAKTIGNTNLEEKFLEG 986          
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Match: SMESG000004886.1 (SMESG000004886.1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 435/985 (44.16%), Postives = 597/985 (60.61%), Query Frame = 3
Query:  168 VDKASDVEEKKTKIDVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSFTLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYTTPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYRNSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPNARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEFLDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLKKDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEIDRTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETFSMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNVILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLMENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLS-----IGSHYRLEKSL-NAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSG----KFKS-------LLVDCVIPVAHESLFAKELSMAIPPPK----------HETRPDGNLFEIELKHIFELSSVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCKPDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLRVEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEIMLTELLLDGEFSNLTGQQLVAFLSCXXXXXXXXXXXXPQNDLDKSLEKMKELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKLCENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEA 3041
            + KA+ ++  K   D S F + +  I+   +   N   +V  P  I ++PLK+  + P K + F LD+FQ  AI+CI+N Q+VLVSAHTSAGKTV A Y IA  + +K+RVIYTTPIKALSNQKYREF EEF +VGLLTGDVT+  NASVLIMTTEIL+ MLYR SSI++EVGWVIFDEIHYMRD+ RGVVWEESI+LLP  +R  FLSATIPNARQFA+WI+ LH Q C+V++T+YRP PLQHY++P   D +  VV++KG FL++ F  AM  L    DS+        + G +    S  E                                        E   ++ +F NA   L + D+ LPQ+   L L+RRGIG+HHGGL+P+LKE VEILF EGL+KCLFATETF+MGLNMPA+TV+FTSA K+DG+  R I++ EYIQMSGRAGRRG D  G VILM+D T+ + DA+++I+G  +PLNS+FH+TYNM+LNLMRVE I+PEY++E SFFQFQ  A +P       E E+ L+ +  + +E          S+++L+++L NA  +EM   I K      F+ PGRL+ +K +  DFGW  +V+  R      K+ S        LV+C++ VA +    K+L   +  P+           + RP GN  ++ +++I ++               +K  E + E ++   S   R   + ++D  KD+K      DE   KI+                         KRLE E     L  EI KK S+I+M+ELKSRKR+LRR  +C D DVI  KGR+ACEI+  DE+++TELLL G F+NL   Q  AF+SC VFEE  +E+      L  +   ++  A+ ++ +S ECRL+V    + ++Y+++FK  ++++V  WA G TF++L   T I+EGSIIRCIR L+E+L QL  +++ IGN  LE+KF E 
Sbjct:   78 IGKAARIKIHKVSGDES-FSHEVISIIFNILKLVNL--KVAVPPTIEFEPLKEIVN-PLKAYPFELDNFQKAAIKCIDNRQSVLVSAHTSAGKTVIAEYAIAKALSDKQRVIYTTPIKALSNQKYREFSEEFSEVGLLTGDVTLSPNASVLIMTTEILQSMLYRGSSIMREVGWVIFDEIHYMRDRERGVVWEESIVLLPDEIRCAFLSATIPNARQFAEWISFLHNQLCHVVFTEYRPVPLQHYVFPCNGDGLLLVVDDKGRFLEDNFKSAMNKLGPNSDSTSE------RAGSIMVARSQNE----------------------------------------ETAYVDEVFKNAMECLSDADKELPQVLTSLPLLRRGIGVHHGGLLPILKETVEILFSEGLLKCLFATETFAMGLNMPARTVLFTSARKYDGSEYRWISANEYIQMSGRAGRRGKDERGTVILMVDETMSDIDARKIIQGTPDPLNSAFHITYNMLLNLMRVEGINPEYMIERSFFQFQNQAFVP-------EAEESLKALIAAYEEMEVEQEELAASYFKLDEALQNAYFKEM-DYIHKSSKLINFMQPGRLIKVKRDSEDFGWGAVVNIKRQQPQLLKYSSATTDEALYLVECLLTVAADRTTIKKLPQELRVPERRNAVRLVMPQDLRPTGNREKV-IQNIEKIK--------------EKFFEMKSEMMSSNKSPSVRNEDLPILDAIKDVKID----DESFLKIK------------------------RKRLEIEN----LEKEIIKKRSIIQMNELKSRKRVLRRLNYCNDKDVIELKGRVACEITGADELLVTELLLKGVFNNLNPSQTAAFVSCLVFEEKSSEMPTLNPALSTAFRTLQNEAKILADISVECRLDV----NSESYIDSFKPHMMDVVLRWADGQTFLQLVNKTTIFEGSIIRCIRLLEEVLRQLANAAKTIGNTNLEEKFLEG 953          
The following BLAST results are available for this feature:
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTREX0.000e+049.21Mtr4 exosome RNA helicase [Source:HGNC Symbol;Acc:... [more]
SKIV2L4.836e-16634.64Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGN... [more]
SKIV2L4.836e-16634.64Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGN... [more]
SKIV2L4.836e-16634.64Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGN... [more]
SKIV2L4.836e-16634.64Ski2 like RNA helicase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtr-40.000e+043.43mRNA transport homolog 4 [Source:UniProtKB/Swiss-... [more]
skih-29.105e-12838.03SKI (Yeast SuperKIller) Helicase homolog [Source:... [more]
helq-15.796e-2526.40HELicase Q homolog [Source:UniProtKB/TrEMBL;Acc:Q... [more]
Y54E2A.46.172e-2525.26pep chromosome:WBcel235:II:14754622:14778149:1 gen... [more]
Y54E2A.48.697e-2525.26pep chromosome:WBcel235:II:14768462:14778149:1 gen... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtr40.000e+047.91gene:FBgn0001986 transcript:FBtr0080760[more]
tst3.570e-15234.15gene:FBgn0039117 transcript:FBtr0334895[more]
tst3.570e-15234.15gene:FBgn0039117 transcript:FBtr0084462[more]
obe1.074e-2626.29gene:FBgn0038344 transcript:FBtr0083147[more]
DNApol-theta1.210e-1926.39gene:FBgn0002905 transcript:FBtr0082662[more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrex0.000e+049.11Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GEN... [more]
skiv2l8.201e-16633.78SKI2 homolog, superkiller viralicidic activity 2-l... [more]
skiv2l3.333e-16032.83SKI2 homolog, superkiller viralicidic activity 2-l... [more]
hfm17.169e-3025.81helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
polq1.115e-2625.62polymerase (DNA directed), theta [Source:ZFIN;Acc:... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTREX0.000e+049.48Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
MTREX0.000e+049.36Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
MTREX0.000e+049.11Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
MTREX0.000e+046.56Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
SKIV2L6.300e-17736.66Ski2 like RNA helicase [Source:NCBI gene;Acc:10003... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtrex0.000e+048.74Mtr4 exosome RNA helicase [Source:MGI Symbol;Acc:M... [more]
Skiv2l9.103e-16734.78superkiller viralicidic activity 2-like (S. cerevi... [more]
Hfm14.341e-3226.45HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Hfm14.341e-3226.45HFM1, ATP-dependent DNA helicase homolog [Source:M... [more]
Polq2.178e-3125.96polymerase (DNA directed), theta [Source:MGI Symbo... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42285|MTREX_HUMAN0.000e+049.21Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 ... [more]
sp|Q9CZU3|MTREX_MOUSE0.000e+048.74Exosome RNA helicase MTR4 OS=Mus musculus OX=10090... [more]
sp|Q23223|MTR4_CAEEL0.000e+043.43mRNA transport homolog 4 OS=Caenorhabditis elegans... [more]
sp|O14232|MTR4_SCHPO0.000e+045.69ATP-dependent RNA helicase mtr4 OS=Schizosaccharom... [more]
sp|P47047|MTR4_YEAST0.000e+044.56ATP-dependent RNA helicase DOB1 OS=Saccharomyces c... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GWU10.000e+050.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GFM10.000e+050.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EQ230.000e+050.26Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GJY10.000e+050.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Y2HR770.000e+048.41Exosome RNA helicase MTR4 OS=Araneus ventricosus O... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrex0.000e+048.39Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
mtrex0.000e+048.28Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
skiv2l7.601e-13341.99Ski2 like RNA helicase [Source:NCBI gene;Acc:10302... [more]
hfm11.737e-3126.99helicase for meiosis 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
polq2.580e-2625.72DNA polymerase theta [Source:NCBI gene;Acc:1030397... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrex0.000e+046.66Mtr4 exosome RNA helicase [Source:ZFIN;Acc:ZDB-GEN... [more]
ascc37.069e-2326.69activating signal cointegrator 1 complex subunit 3... [more]
ascc39.213e-2327.58activating signal cointegrator 1 complex subunit 3... [more]
helq1.630e-1926.73helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
helq6.664e-1926.61helicase, POLQ like [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MTR40.000e+044.56ATP-dependent 3'-5' RNA helicase of the DExD/H fam... [more]
SKI23.293e-12543.44Ski complex component and putative RNA helicase; m... [more]
HFM11.044e-2927.59Meiosis specific DNA helicase; involved in the con... [more]
BRR21.027e-2324.89RNA-dependent ATPase RNA helicase (DEIH box); requ... [more]
SLH15.735e-2125.41Putative RNA helicase related to Ski2p; involved i... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO439760.000e+047.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381961.606e-13441.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467145.469e-2426.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491463.280e-2124.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447489.021e-1923.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtrex0.000e+048.20Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
mtrex0.000e+046.04Mtr4 exosome RNA helicase [Source:NCBI gene;Acc:10... [more]
skiv2l1.711e-16534.52Ski2 like RNA helicase [Source:NCBI gene;Acc:10115... [more]
skiv2l5.102e-16533.33Ski2 like RNA helicase [Source:NCBI gene;Acc:10115... [more]
skiv2l1.598e-14532.53Ski2 like RNA helicase [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of Superkiller viralicidic activity 2-like 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063270.10.000e+0100.00SMESG000063270.1[more]
SMESG000004673.10.000e+045.85SMESG000004673.1[more]
SMESG000004886.10.000e+045.40SMESG000004886.1[more]
SMESG000004886.10.000e+045.27SMESG000004886.1[more]
SMESG000004886.10.000e+044.16SMESG000004886.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010927 ID=SMED30010927|Name=Superkiller viralicidic activity 2-like 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3136bp
CTTAAATTAATAAAAATAAATGTTTGTTTAAATAATATTAATTGTTACCG
TGTTTGTAAATGGATTTTTTAGATATATTTGATGATATTGAAGTTGCTGA
AGTTCCAGTTGAAATTAAAGATAATGCTTCAAAAAAACGAAAGTTAGATG
ATTTTTTGGTAGAATATGTAGATAAAGCTTCTGATGTCGAAGAAAAAAAG
ACTAAAATTGATGTTTCAGATTTTAAAAACCCTATTAATGATATTCTACT
TAAAACAATTCCTACACAAAATTGCATACACGAAGTTGTCTATCCTAAAA
ATATTGTATATAAACCATTGAAGAAAAGAAATTCGATTCCAGCTAAAGAA
TTTAGTTTTACTCTCGATTCTTTTCAAAATCAAGCTATCCAATGTATTGA
AAACAATCAAACAGTTTTAGTGTCAGCTCATACGTCTGCTGGAAAAACTG
TTTGTGCCAGTTACACAATTGCTTCATGTATTAAAGAAAAACGAAGAGTA
ATTTATACAACTCCCATAAAGGCTTTGAGTAATCAAAAATATCGAGAATT
CAAAGAAGAATTTGAAGATGTTGGTTTATTAACCGGTGATGTTACAATTG
ATTCTAACGCCAGTGTTTTGATAATGACTACTGAAATTCTCCGGTTAATG
CTATATCGTAATTCATCGATAATTAAAGAAGTCGGCTGGGTGATATTCGA
TGAAATTCATTATATGCGAGACAAATCTCGAGGGGTTGTTTGGGAGGAAT
CGATTATTTTATTACCACCTGCAATGAGAATGGTATTTCTCAGTGCTACG
ATTCCCAACGCACGTCAATTCGCCCAATGGATAGCCCATTTACATAAACA
GCCTTGCAATGTCATTTACACCGATTACCGACCGACACCACTGCAACATT
ATATCTATCCCAATGGAGCCGATCGAATCTATCAAGTAGTAAATGAGAAA
GGTGAATTTCTCGATGAGTATTTCAATGAGGCAATGGCGGTGTTGAGGAA
AGCAGGCGACAGCTCAAAGAATGATATGGATAACATCGGGAAACGTGGCG
GAGTGAAAGCCATAGAATCTCACTGTGAAACTCTAATTAAAAAAGTGTTC
GATTTGAAGAAAGATCCAGTTATCGTGTTCTCATTTTCAAAAAAATCATG
CGAAGTCTACGCGAAAATGCTCAGTAAATTGGACTACACAACAAAGCCAG
AAAAAGAAAAGATTGAATTGATATTTTTGAACGCTAGGAATACACTACCG
GAAATCGATCGAACTCTCCCACAAATCGACGCAATGTTGAATCTGGTAAG
GCGGGGAATCGGCATTCACCATGGGGGACTGATGCCGGTTTTGAAGGAAA
TCGTTGAGATCCTATTCGGTGAAGGCTTGATCAAATGTCTGTTTGCCACC
GAGACGTTTTCAATGGGGCTCAATATGCCGGCTAAAACTGTCATTTTCAC
TTCGGCACTCAAATTCGATGGCGCTAACGTTCGCATGATTACGTCAGGTG
AGTACATTCAAATGTCCGGCCGTGCTGGGCGACGAGGCCTAGATACCAAT
GGAAACGTCATCCTGATGCTTGATAGGACTATTAAAAATGAAGACGCCAA
ACAGGTAATCAAAGGAGAAACCGAGCCGTTGAATTCCTCTTTCCATTTGA
CTTATAACATGATTTTGAATCTGATGCGAGTCGAAACAATCAGCCCGGAA
TATTTGATGGAAAATAGTTTCTTTCAGTTTCAAACCTACGCTGAACTCCC
TAATTTGATAACCAGGCTCCGGGAAAAAGAAAAACAATTGGAAGAAATCC
CGCTTTCCAATCAGGAATACCTTTCCATCGGATCGCATTATCGATTGGAG
AAATCACTCAACGCTATCAGGGAAGAAATGTGGTCATCCATCAGAAAGGA
GCACACTTACCGACCTTTTCTTGTTCCTGGTCGATTGGTCCATATCAAAT
ACAATGAACACGATTTCGGTTGGTGCATTCTGGTATCAAAATTACGAAGT
GGAAAATTCAAGTCGTTATTAGTGGATTGTGTCATTCCGGTTGCTCATGA
AAGTCTTTTTGCTAAAGAATTATCAATGGCAATTCCACCACCAAAACATG
AGACGAGACCTGACGGGAATTTGTTTGAAATTGAACTGAAACATATATTC
GAATTATCCTCCGTTGTAATTGGGTGCACAGATCAATTGTTGCATTCTTT
AAAGAAAAATGATGAAGCAAGAAAAGAGTTTTTAAATAAACGAAATAGTA
TTATAGCTCGTTACAATACGATTTTTTTGATTGATTTAAAAAAGGATTTA
AAATGCAAACCAGATCAAATTGACGAATATGATCAAAAAATTCAAGAATT
GCAAACCAAAATTGAAAATCATCCCATGTTTAATCATGATAAATCACTAG
AAATGATTAATTTGTATCACAAACGACTGGAATATGAAGGAATTGCTGAT
AAATTACGAGTGGAAATAAACAAGAAAGTTTCACTAATAAAAATGGACGA
ACTAAAATCTCGAAAAAGAATTCTAAGACGATTTAAATTTTGTACCGACA
CGGATGTTATAACAACAAAGGGGAGAATCGCCTGTGAAATTTCTACCGGT
GATGAAATAATGTTAACGGAATTATTATTGGATGGGGAATTTTCTAATCT
CACTGGTCAGCAATTAGTAGCTTTCTTGTCTTGCTTTGTATTTGAGGAGT
TCGTAAATGAAATAATCGAACCACAAAATGACCTTGACAAAAGTCTAGAG
AAAATGAAAGAACTCGCCAGACACATTAGCCGTGTTAGTAAAGAATGCCG
ATTGGAAGTGTATCCTGCCACTGATGAGAAAGCTTATGTAGAAAACTTCA
AATTAGGCCTTATAGAAATCGTTCGAGCATGGGCTAAAGGATCAACTTTC
ATTAAACTATGCGAAAACACCAATATTTACGAAGGAAGTATCATTAGATG
TATTCGACGACTGGATGAGTTATTAGGACAGCTATACGAATCATCGAGAG
TTATTGGAAATATTCAGTTAGAAAAGAAGTTCGGGGAAGCTTCACAATTG
ATCAAACGTGGAATTATATTTTCTTCTAGTCTATATTTGGCCACTGATAA
ATAATTTATTTAATAAATATTTTAGAAATAAAAAAA
back to top

protein sequence of SMED30010927-orf-1

>SMED30010927-orf-1 ID=SMED30010927-orf-1|Name=SMED30010927-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1015bp
MDFLDIFDDIEVAEVPVEIKDNASKKRKLDDFLVEYVDKASDVEEKKTKI
DVSDFKNPINDILLKTIPTQNCIHEVVYPKNIVYKPLKKRNSIPAKEFSF
TLDSFQNQAIQCIENNQTVLVSAHTSAGKTVCASYTIASCIKEKRRVIYT
TPIKALSNQKYREFKEEFEDVGLLTGDVTIDSNASVLIMTTEILRLMLYR
NSSIIKEVGWVIFDEIHYMRDKSRGVVWEESIILLPPAMRMVFLSATIPN
ARQFAQWIAHLHKQPCNVIYTDYRPTPLQHYIYPNGADRIYQVVNEKGEF
LDEYFNEAMAVLRKAGDSSKNDMDNIGKRGGVKAIESHCETLIKKVFDLK
KDPVIVFSFSKKSCEVYAKMLSKLDYTTKPEKEKIELIFLNARNTLPEID
RTLPQIDAMLNLVRRGIGIHHGGLMPVLKEIVEILFGEGLIKCLFATETF
SMGLNMPAKTVIFTSALKFDGANVRMITSGEYIQMSGRAGRRGLDTNGNV
ILMLDRTIKNEDAKQVIKGETEPLNSSFHLTYNMILNLMRVETISPEYLM
ENSFFQFQTYAELPNLITRLREKEKQLEEIPLSNQEYLSIGSHYRLEKSL
NAIREEMWSSIRKEHTYRPFLVPGRLVHIKYNEHDFGWCILVSKLRSGKF
KSLLVDCVIPVAHESLFAKELSMAIPPPKHETRPDGNLFEIELKHIFELS
SVVIGCTDQLLHSLKKNDEARKEFLNKRNSIIARYNTIFLIDLKKDLKCK
PDQIDEYDQKIQELQTKIENHPMFNHDKSLEMINLYHKRLEYEGIADKLR
VEINKKVSLIKMDELKSRKRILRRFKFCTDTDVITTKGRIACEISTGDEI
MLTELLLDGEFSNLTGQQLVAFLSCFVFEEFVNEIIEPQNDLDKSLEKMK
ELARHISRVSKECRLEVYPATDEKAYVENFKLGLIEIVRAWAKGSTFIKL
CENTNIYEGSIIRCIRRLDELLGQLYESSRVIGNIQLEKKFGEASQLIKR
GIIFSSSLYLATDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012961Ski2_C
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR016438Ski2-like
IPR025696rRNA_proc-arch_dom
IPR011545DEAD/DEAH_box_helicase_dom
Vocabulary: biological process
TermDefinition
GO:0006401RNA catabolic process
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0004386helicase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 892..912
NoneNo IPR availableGENE3DG3DSA:2.40.30.300coord: 622..738
e-value: 9.3E-121
score: 406.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 70..274
e-value: 1.4E-78
score: 264.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 275..525
e-value: 3.2E-78
score: 264.4
NoneNo IPR availableGENE3DG3DSA:1.20.1500.20coord: 554..805
e-value: 9.3E-121
score: 406.2
NoneNo IPR availableGENE3DG3DSA:1.10.3380.30coord: 532..1000
e-value: 9.3E-121
score: 406.2
NoneNo IPR availablePANTHERPTHR12131ATP-DEPENDENT RNA AND DNA HELICASEcoord: 69..1010
NoneNo IPR availablePANTHERPTHR12131:SF7EXOSOME RNA HELICASE MTR4coord: 69..1010
NoneNo IPR availableCDDcd18795SF2_C_Ski2coord: 274..503
e-value: 3.95539E-53
score: 180.442
NoneNo IPR availableCDDcd18024DEXHc_Mtr4-likecoord: 72..274
e-value: 8.33661E-135
score: 402.207
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 404..493
e-value: 2.3E-16
score: 70.4
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 377..493
e-value: 3.0E-7
score: 30.8
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 341..539
score: 13.83
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 98..281
e-value: 3.4E-35
score: 132.9
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 110..266
score: 24.436
IPR012961ATP-dependent RNA helicase Ski2, C-terminalSMARTSM01142DSHCT_2coord: 829..1010
e-value: 4.5E-71
score: 252.1
IPR012961ATP-dependent RNA helicase Ski2, C-terminalPFAMPF08148DSHCTcoord: 832..1005
e-value: 6.0E-49
score: 165.8
IPR025696rRNA-processing arch domainPFAMPF13234rRNA_proc-archcoord: 547..804
e-value: 8.8E-40
score: 137.3
IPR016438ATP-dependent RNA helicase Ski2-likePIRSFPIRSF005198SKI2coord: 8..1010
e-value: 0.0
score: 1147.8
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 105..249
e-value: 2.1E-20
score: 73.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 113..506