POU domain protein

Overview
NamePOU domain protein
Smed IDSMED30010910
Length (bp)3203
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of POU domain protein (SMED30010910) t-SNE clustered cells

Violin plots show distribution of expression levels for POU domain protein (SMED30010910) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of POU domain protein (SMED30010910) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for POU domain protein (SMED30010910) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010910

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010910SMESG000058834.1 dd_Smed_v4_13010_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of POU domain protein vs. Ensembl Human
Match: POU6F2 (POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:21694])

HSP 1 Score: 252.677 bits (644), Expect = 2.073e-71
Identity = 117/163 (71.78%), Postives = 141/163 (86.50%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  476 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEP 638          
BLAST of POU domain protein vs. Ensembl Human
Match: POU6F1 (POU class 6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9224])

HSP 1 Score: 232.646 bits (592), Expect = 7.119e-65
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  440 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 604          
BLAST of POU domain protein vs. Ensembl Human
Match: POU6F2 (POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:21694])

HSP 1 Score: 234.187 bits (596), Expect = 1.180e-64
Identity = 117/199 (58.79%), Postives = 141/199 (70.85%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  476 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEP 674          
BLAST of POU domain protein vs. Ensembl Human
Match: POU6F1 (POU class 6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9224])

HSP 1 Score: 230.72 bits (587), Expect = 1.584e-64
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  406 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 570          
BLAST of POU domain protein vs. Ensembl Human
Match: POU6F2 (POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:21694])

HSP 1 Score: 233.802 bits (595), Expect = 2.183e-64
Identity = 117/199 (58.79%), Postives = 141/199 (70.85%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  505 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEP 703          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-6 (Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Prot;Acc:P20268])

HSP 1 Score: 108.612 bits (270), Expect = 6.797e-25
Identity = 57/148 (38.51%), Postives = 85/148 (57.43%), Query Frame = 3
Query: 1401 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSA 1844
            +++ FA+ FK RR+ +G TQ  VG AL    G  +SQ+ ICRFE L ++ K+  K+KP+L KW++E++       NS  +       +KRK+RTS        L  HF+    P   E+  +A +L  ++EV+RVWFCN+RQ  K  A
Sbjct:  194 DLEGFAKQFKQRRIKLGYTQADVGVALGTLYGNIFSQTTICRFEALQLSFKNMCKLKPLLFKWLEEADST-TGSPNSTFEKMTGQAGRKRKKRTSIEVNVKSRLEFHFQSNQKPNAQEITQVAMELQLEKEVVRVWFCNRRQKEKRIA 340          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 96.6709 bits (239), Expect = 1.836e-21
Identity = 52/151 (34.44%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1392 DLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPA---YSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALK 1835
            D  +++ FA +FK RR+ +G+TQ  VG+AL   + P     SQS ICRFE L ++  +   +KPIL  W++++EE         D         K+++RTS        L   F+++  P+G  + ++A+ L+  + V+RVWFCN+RQ  K
Sbjct:  103 DPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQK 253          
BLAST of POU domain protein vs. Ensembl Celegans
Match: unc-86 (Transcription factor unc-86 [Source:UniProtKB/Swiss-Prot;Acc:P13528])

HSP 1 Score: 97.0561 bits (240), Expect = 2.884e-21
Identity = 52/151 (34.44%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1392 DLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPA---YSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALK 1835
            D  +++ FA +FK RR+ +G+TQ  VG+AL   + P     SQS ICRFE L ++  +   +KPIL  W++++EE         D         K+++RTS        L   F+++  P+G  + ++A+ L+  + V+RVWFCN+RQ  K
Sbjct:  159 DPRQLETFAEHFKQRRIKLGVTQADVGKALAHLKMPGVGSLSQSTICRFESLTLSHNNMVALKPILHSWLEKAEEAMKQKDTIGDINGILPNTDKKRKRTSIAAPEKRELEQFFKQQPRPSGERIASIADRLDLKKNVVRVWFCNQRQKQK 309          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 93.2041 bits (230), Expect = 2.874e-19
Identity = 54/187 (28.88%), Postives = 88/187 (47.06%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXIN------------------------------------KKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALK 1835
            D +D+ E++ FA+ FK +R+  G TQ  VG AL    G  +SQ+ I RFE L+++ K+  K++P+L++W+ + E     G+   D      I+                                    K+R++RT+        L+  F     P   +M  +AN L  DR+V+RVWFCN+RQ ++
Sbjct:  291 DRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMR 477          
BLAST of POU domain protein vs. Ensembl Celegans
Match: ceh-18 (Homeobox protein ceh-18 [Source:UniProtKB/Swiss-Prot;Acc:P41934])

HSP 1 Score: 92.8189 bits (229), Expect = 3.193e-19
Identity = 54/187 (28.88%), Postives = 88/187 (47.06%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXIN------------------------------------KKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALK 1835
            D +D+ E++ FA+ FK +R+  G TQ  VG AL    G  +SQ+ I RFE L+++ K+  K++P+L++W+ + E     G+   D      I+                                    K+R++RT+        L+  F     P   +M  +AN L  DR+V+RVWFCN+RQ ++
Sbjct:  289 DRIDMNELEAFAQTFKKQRIKFGFTQGDVGVALGKRYGTDFSQTTISRFEALNLSFKNMCKLRPLLKEWLADVEMAIEGGATVTDLIDKKTIHNGNHHTIHHVDIHETSISNSISSVTASSLLSREQHVKRRRKRTNLDMNQRNALDTFFALNPRPDHDKMTDIANSLELDRDVVRVWFCNRRQKMR 475          
BLAST of POU domain protein vs. Ensembl Fly
Match: pdm3 (gene:FBgn0261588 transcript:FBtr0339349)

HSP 1 Score: 243.432 bits (620), Expect = 8.666e-66
Identity = 118/175 (67.43%), Postives = 144/175 (82.29%), Query Frame = 3
Query: 1356 EPTAHNVT---VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEE----KYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            EPT +  T   VDG+DL EIKEFA+ FK+RRLS+GLTQTQVGQAL+  EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+KE+EE    +Y SG N + D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G+E+  LA+ L Y+REVIR+WFCNKRQALKN+ + + +
Sbjct: 1096 EPTINQATTNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK 1270          
BLAST of POU domain protein vs. Ensembl Fly
Match: pdm3 (gene:FBgn0261588 transcript:FBtr0302918)

HSP 1 Score: 230.335 bits (586), Expect = 5.305e-62
Identity = 117/193 (60.62%), Postives = 143/193 (74.09%), Query Frame = 3
Query: 1356 EPTAHNVT---VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------FEKLDITPKSAQKIKPILEKWIKESEE----KYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            EPT +  T   VDG+DL EIKEFA+ FK+RRLS+GLTQTQVGQAL+  EGPAYSQSAIC                   FEKLDITPKSAQKIKP+LE+W+KE+EE    +Y SG N + D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G+E+  LA+ L Y+REVIR+WFCNKRQALKN+ + + +
Sbjct:  799 EPTINQATTNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALAAQMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK 991          
BLAST of POU domain protein vs. Ensembl Fly
Match: pdm3 (gene:FBgn0261588 transcript:FBtr0302919)

HSP 1 Score: 230.335 bits (586), Expect = 1.841e-61
Identity = 117/193 (60.62%), Postives = 143/193 (74.09%), Query Frame = 3
Query: 1356 EPTAHNVT---VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------FEKLDITPKSAQKIKPILEKWIKESEE----KYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            EPT +  T   VDG+DL EIKEFA+ FK+RRLS+GLTQTQVGQAL+  EGPAYSQSAIC                   FEKLDITPKSAQKIKP+LE+W+KE+EE    +Y SG N + D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G+E+  LA+ L Y+REVIR+WFCNKRQALKN+ + + +
Sbjct: 1096 EPTINQATTNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSALAAQMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK 1288          
BLAST of POU domain protein vs. Ensembl Fly
Match: pdm3 (gene:FBgn0261588 transcript:FBtr0339350)

HSP 1 Score: 229.95 bits (585), Expect = 2.496e-61
Identity = 117/194 (60.31%), Postives = 143/194 (73.71%), Query Frame = 3
Query: 1356 EPTAHNVT---VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR-------------------FEKLDITPKSAQKIKPILEKWIKESEE----KYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            EPT +  T   VDG+DL EIKEFA+ FK+RRLS+GLTQTQVGQAL+  EGPAYSQSAIC                    FEKLDITPKSAQKIKP+LE+W+KE+EE    +Y SG N + D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G+E+  LA+ L Y+REVIR+WFCNKRQALKN+ + + +
Sbjct: 1096 EPTINQATTNVVDGIDLDEIKEFAKAFKLRRLSLGLTQTQVGQALSVTEGPAYSQSAICSSALAAQMYAAQLSTQQQNMFEKLDITPKSAQKIKPVLERWMKEAEESHWNRYKSGQNHLTDYIGVEPSKKRKRRTSFTPQALELLNAHFERNTHPSGTEITGLAHQLGYEREVIRIWFCNKRQALKNTVRMMSK 1289          
BLAST of POU domain protein vs. Ensembl Fly
Match: vvl (gene:FBgn0086680 transcript:FBtr0345911)

HSP 1 Score: 115.546 bits (288), Expect = 6.499e-27
Identity = 55/145 (37.93%), Postives = 88/145 (60.69%), Query Frame = 3
Query: 1401 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALK 1835
            +++ FA+ FK RR+ +G TQ  VG AL    G  +SQ+ ICRFE L ++ K+  K+KP+L+KW++E++    +  +       +   +KRK+RTS        L  HF ++  P+  E+ +LA+ L  ++EV+RVWFCN+RQ  K
Sbjct:  219 DLEAFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADS---TTGSPTSIDKIAAQGRKRKKRTSIEVSVKGALEQHFHKQPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEK 360          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 231.491 bits (589), Expect = 5.384e-64
Identity = 117/196 (59.69%), Postives = 140/196 (71.43%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ SG  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ
Sbjct:  478 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTGKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRSGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNSHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQ 673          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:30334])

HSP 1 Score: 228.794 bits (582), Expect = 6.933e-64
Identity = 104/155 (67.10%), Postives = 131/155 (84.52%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            + ++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LE+W+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ S PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  434 EAINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLERWLAEAELWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNTYFEKNSLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 588          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:30334])

HSP 1 Score: 228.794 bits (582), Expect = 1.175e-63
Identity = 104/155 (67.10%), Postives = 131/155 (84.52%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            + ++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LE+W+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ S PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  449 EAINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLERWLAEAELWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNTYFEKNSLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 603          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou1f1 (POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-040630-7])

HSP 1 Score: 125.561 bits (314), Expect = 1.045e-30
Identity = 62/149 (41.61%), Postives = 97/149 (65.10%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            +D   + E+++FA +FK+RR+ +G TQT VG+AL A  G  +SQ+ ICRFE L ++ K+A K+K IL KW++E+E+     + ++ +       +KRKRRT+ +  A E L   F  KS P+  E+  +A  L+ ++EV+RVWFCN+RQ
Sbjct:  186 MDSPQIRELEKFANDFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKSILAKWLEEAEQ-----AGALFNEKMGLHERKRKRRTTISLGAKEALERSFVEKSKPSSQEIVRMAEGLHLEKEVVRVWFCNRRQ 329          
BLAST of POU domain protein vs. Ensembl Zebrafish
Match: pou1f1 (POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-040630-7])

HSP 1 Score: 125.561 bits (314), Expect = 1.095e-30
Identity = 65/159 (40.88%), Postives = 101/159 (63.52%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            +D   + E+++FA +FK+RR+ +G TQT VG+AL A  G  +SQ+ ICRFE L ++ K+A K+K IL KW++E+E+     + ++ +       +KRKRRT+ +  A E L   F  KS P+  E+  +A  L+ ++EV+RVWFCN+RQ      KR+K
Sbjct:  186 MDSPQIRELEKFANDFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKSILAKWLEEAEQ-----AGALFNEKMGLHERKRKRRTTISLGAKEALERSFVEKSKPSSQEIVRMAEGLHLEKEVVRVWFCNRRQ----REKRVK 335          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: hoxa5 (homeobox A5 [Source:Xenbase;Acc:XB-GENE-486061])

HSP 1 Score: 235.343 bits (599), Expect = 4.333e-65
Identity = 120/210 (57.14%), Postives = 145/210 (69.05%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNS 1874
            S P   +  VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KRIKQ  P +
Sbjct:  474 SNPQTASGEVDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRIKQHEPGT 683          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: hoxa5 (homeobox A5 [Source:Xenbase;Acc:XB-GENE-486061])

HSP 1 Score: 234.958 bits (598), Expect = 5.061e-65
Identity = 120/210 (57.14%), Postives = 145/210 (69.05%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNS 1874
            S P   +  VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KRIKQ  P +
Sbjct:  473 SNPQTASGEVDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRIKQHEPGT 682          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:100126212])

HSP 1 Score: 230.72 bits (587), Expect = 2.708e-64
Identity = 105/155 (67.74%), Postives = 131/155 (84.52%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            DG++L EI+EFA+ FKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ S P G E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  443 DGINLEEIREFAKEFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAEMRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAVEVLNAYFEKNSLPAGQEITDIAKELNYDREVVRVWFCNRRQTLKNTSK 597          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:100126212])

HSP 1 Score: 229.95 bits (585), Expect = 3.975e-64
Identity = 105/155 (67.74%), Postives = 131/155 (84.52%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            DG++L EI+EFA+ FKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ S P G E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  433 DGINLEEIREFAKEFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAEMRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAVEVLNAYFEKNSLPAGQEITDIAKELNYDREVVRVWFCNRRQTLKNTSK 587          
BLAST of POU domain protein vs. Ensembl Xenopus
Match: POU1F1 (POU class 1 homeobox 1 [Source:NCBI gene;Acc:100492413])

HSP 1 Score: 135.191 bits (339), Expect = 2.137e-34
Identity = 70/181 (38.67%), Postives = 110/181 (60.77%), Query Frame = 3
Query: 1350 KSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQH 1892
            K++P    + +D  ++ E+++FA  FK+RR+ +G TQT VG+AL A  G  +SQ+ ICRFE L ++ K+A K+K IL KW+ E+E+       ++ +       +KRKRRT+ +  A E L  HF  +S P+  E+  +A  LN ++EV+RVWFCN+RQ  K     + Q + +S S + H
Sbjct:  116 KNKPIDEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKSILSKWLDEAEQ-----VGALYNEKIGGNERKRKRRTTISIAAKEALESHFGEQSKPSSQEIMRMAEGLNLEKEVVRVWFCNRRQREKRVKTSLHQNSFSSFSKDHH 291          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou6f2 (POU domain, class 6, transcription factor 2 [Source:MGI Symbol;Acc:MGI:2443631])

HSP 1 Score: 253.062 bits (645), Expect = 3.117e-72
Identity = 118/167 (70.66%), Postives = 143/167 (85.63%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSES 1880
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P S +
Sbjct:  422 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPTSAA 588          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou6f1 (POU domain, class 6, transcription factor 1 [Source:MGI Symbol;Acc:MGI:102935])

HSP 1 Score: 230.335 bits (586), Expect = 1.441e-67
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  130 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 294          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou6f2 (POU domain, class 6, transcription factor 2 [Source:MGI Symbol;Acc:MGI:2443631])

HSP 1 Score: 234.572 bits (597), Expect = 1.838e-65
Identity = 118/203 (58.13%), Postives = 143/203 (70.44%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSES 1880
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P S +
Sbjct:  422 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPTSAA 624          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou6f1 (POU domain, class 6, transcription factor 1 [Source:MGI Symbol;Acc:MGI:102935])

HSP 1 Score: 231.876 bits (590), Expect = 5.242e-65
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  405 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 569          
BLAST of POU domain protein vs. Ensembl Mouse
Match: Pou1f1 (POU domain, class 1, transcription factor 1 [Source:MGI Symbol;Acc:MGI:97588])

HSP 1 Score: 130.954 bits (328), Expect = 4.715e-33
Identity = 67/169 (39.64%), Postives = 105/169 (62.13%), Query Frame = 3
Query: 1350 KSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            KS+     + +D  ++ E+++FA  FK+RR+ +G TQT VG+AL A  G  +SQ+ ICRFE L ++ K+A K+K IL KW++E+E+       ++ +       +KRKRRT+ +  A + L  HF   S P+  E+  +A +LN ++EV+RVWFCN+RQ      KR+K
Sbjct:  114 KSKLVEEPIDMDSPEIRELEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQ-----VGALYNEKVGANERKRKRRTTISVAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNRRQ----REKRVK 273          
BLAST of POU domain protein vs. UniProt/SwissProt
Match: sp|Q07916|PO6F1_MOUSE (POU domain, class 6, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.008e-66
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  130 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLMEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 294          
BLAST of POU domain protein vs. UniProt/SwissProt
Match: sp|P56223|PO6F1_RAT (POU domain, class 6, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou6f1 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 1.441e-66
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  130 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 294          
BLAST of POU domain protein vs. UniProt/SwissProt
Match: sp|Q14863|PO6F1_HUMAN (POU domain, class 6, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 2.744e-66
Identity = 108/165 (65.45%), Postives = 136/165 (82.42%), Query Frame = 3
Query: 1353 SEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            S+P   ++  DG++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E +   G  ++ +  G + +KKRKRRTSFTPQA+E LN +FE+   PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  130 SKPHTPSLDEDGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQNLMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 294          
BLAST of POU domain protein vs. UniProt/SwissProt
Match: sp|Q8BJI4|PO6F2_MOUSE (POU domain, class 6, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou6f2 PE=2 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 2.757e-64
Identity = 118/203 (58.13%), Postives = 143/203 (70.44%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSES 1880
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P S +
Sbjct:  476 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPTSAA 678          
BLAST of POU domain protein vs. UniProt/SwissProt
Match: sp|P78424|PO6F2_HUMAN (POU domain, class 6, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU6F2 PE=1 SV=3)

HSP 1 Score: 234.187 bits (596), Expect = 5.666e-64
Identity = 117/199 (58.79%), Postives = 141/199 (70.85%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  476 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTAKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEP 674          
BLAST of POU domain protein vs. TrEMBL
Match: A0A2R4N9Z3 (POU domain protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 426/500 (85.20%), Postives = 459/500 (91.80%), Query Frame = 3
Query:  432 TNVLDMTKLDQQNQIISCGNSTNFTNKNTIDSSSNDTTQVSSTANNISSIEHFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGXXXXXXXXXXXXXXXXXQQLSVNRESNVINTNQTTNPNAAIIEHMMXXXXXXXXXKNSMIHQSWPNEFQQTSS--NNQTNSFIANNIPVATTN----SSTIKPIDKVNGSTQFQIPLNCNPAPLQNEKFTTNIISINDRAIDNKXXXXXXXXXXXXXGNKICQMIDVSHDYILSQEDHLVKEKAAELLRHSHNQKNAIKH-AQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHISPQVM 1910
            TNVLDMTK+DQQN IISC N  NF+ KNT+DSSSN+T+QVS+TANN+S+IE+FLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGNILANSLASLATTLTSIQQLSVNR+SN+IN NQ  NPNA IIEHMMQQYQQLQLLKNSMIHQSWPN+FQQ SS  NNQTNSFI+NN P         S+++KP +K+NGS+ FQIP+NCN    QNEKF TN++S+NDRAIDNKSPS NSSVSSRSVGNKICQMIDVSHDYILSQ+DHLVKEKA ELLRHSHNQKN  ++ +  SDKSE   HNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLSGSNSVDDG+GSDINKKRKRRTSFTPQALEILNIHFE+KSHPTGSEMRALAND NYDREVIRVWFCNKRQALKNSAKRIKQCTPN ++NNQHISPQ++
Sbjct:   10 TNVLDMTKMDQQNPIISCNNLVNFSTKNTVDSSSNETSQVSTTANNLSTIENFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGNILANSLASLATTLTSIQQLSVNRDSNIINNNQNNNPNAGIIEHMMQQYQQLQLLKNSMIHQSWPNDFQQPSSGGNNQTNSFISNNAPPPQPPTTTISNSVKPAEKINGSSSFQIPMNCNHNTFQNEKFNTNLLSLNDRAIDNKSPSANSSVSSRSVGNKICQMIDVSHDYILSQDDHLVKEKAVELLRHSHNQKNTNRNTSTISDKSENVTHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLSGSNSVDDGTGSDINKKRKRRTSFTPQALEILNIHFEKKSHPTGSEMRALANDPNYDREVIRVWFCNKRQALKNSAKRIKQCTPNGDTNNQHISPQII 509          
BLAST of POU domain protein vs. TrEMBL
Match: V4BHE9 (POU domain protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_126925 PE=3 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 3.147e-73
Identity = 121/181 (66.85%), Postives = 150/181 (82.87%), Query Frame = 3
Query: 1326 IKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            + +    D    +  + TVDG++L EIKEFAR FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+EE+Y +G +++ D  GS+ +KKRKRRTSFTPQAL++LN +FER +HP+G+EM  L+  LNYDREVIRVWFCNKRQALKN+ K++K  TP
Sbjct:    4 VDYLSLPDTVGNSTESTTVDGINLDEIKEFARQFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMMEAEERYKNGVDNLTDFIGSEPSKKRKRRTSFTPQALDVLNQYFERNTHPSGAEMTDLSEKLNYDREVIRVWFCNKRQALKNTIKKLKHDTP 184          
BLAST of POU domain protein vs. TrEMBL
Match: A0A1A6GKH9 (POU domain protein OS=Neotoma lepida OX=56216 GN=A6R68_05220 PE=3 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 3.851e-73
Identity = 121/176 (68.75%), Postives = 146/176 (82.95%), Query Frame = 3
Query: 1347 DKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNS 1874
            DK +P      VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+E ++ +G  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ  P S
Sbjct:    3 DKEDPQTAAGEVDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARHRAGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNAHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQHEPTS 178          
BLAST of POU domain protein vs. TrEMBL
Match: A0A1W0WHG8 (POU domain protein OS=Hypsibius dujardini OX=232323 GN=BV898_11156 PE=3 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 7.163e-73
Identity = 124/187 (66.31%), Postives = 157/187 (83.96%), Query Frame = 3
Query: 1296 LRHSHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            +RH    K+ I    C+ +S   A NV VDG+DL EI+EFA+ FK+RRLS+GLTQTQVGQAL+A EGP+YSQSAICRFEKLDITP+SAQKIKP+LE+W+KE+EE+Y +G  ++ +  G + NKKRKRRTSFTPQALEILN+HFE+ +HP+G+E+  LA++LNYDREV+RVWFCNKRQALKN+ K+IK
Sbjct:  310 IRHIRQDKSVI----CTARS--AASNV-VDGIDLEEIREFAKRFKMRRLSLGLTQTQVGQALSATEGPSYSQSAICRFEKLDITPRSAQKIKPVLERWMKEAEERYENGGQNLAEFVGCEPNKKRKRRTSFTPQALEILNVHFEKNTHPSGAEVTTLADELNYDREVVRVWFCNKRQALKNTIKKIK 489          
BLAST of POU domain protein vs. TrEMBL
Match: A0A2C9K2U7 (POU domain protein OS=Biomphalaria glabrata OX=6526 GN=106079117 PE=3 SV=1)

HSP 1 Score: 259.61 bits (662), Expect = 7.185e-73
Identity = 121/163 (74.23%), Postives = 144/163 (88.34%), Query Frame = 3
Query: 1371 NVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            + TVDG++L EIKEFAR FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+EE+Y +G  ++ D  GS+ +KKRKRRTSFTPQALE+LN +FER +HPTG+EM  L+  LNYDREVIRVWFCNKRQALKN+ K++KQ
Sbjct:  291 STTVDGINLDEIKEFARQFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEERYKNGVQNLTDFIGSEPSKKRKRRTSFTPQALELLNQYFERNTHPTGTEMTELSERLNYDREVIRVWFCNKRQALKNTIKKLKQ 453          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:103024874])

HSP 1 Score: 229.95 bits (585), Expect = 2.324e-64
Identity = 104/155 (67.10%), Postives = 132/155 (85.16%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            +G++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LE+W+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ + PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  428 EGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLERWLAEAELWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNTYFEKNALPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 582          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:103024874])

HSP 1 Score: 229.95 bits (585), Expect = 3.981e-64
Identity = 104/155 (67.10%), Postives = 132/155 (85.16%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            +G++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LE+W+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ + PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  449 EGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLERWLAEAELWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNTYFEKNALPTGQEITEIAKELNYDREVVRVWFCNRRQTLKNTSK 603          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou6f2 (POU class 6 homeobox 2 [Source:NCBI gene;Acc:103040383])

HSP 1 Score: 231.876 bits (590), Expect = 4.479e-64
Identity = 117/196 (59.69%), Postives = 140/196 (71.43%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ SG  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ
Sbjct:  484 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTGKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRSGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNSHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQ 679          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou6f2 (POU class 6 homeobox 2 [Source:NCBI gene;Acc:103040383])

HSP 1 Score: 231.876 bits (590), Expect = 4.479e-64
Identity = 117/196 (59.69%), Postives = 140/196 (71.43%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+A EGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ SG  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ
Sbjct:  484 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSATEGPAYSQSAICRHTILRSHFFLPQEAQENTIASSLTGKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRSGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNSHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQ 679          
BLAST of POU domain protein vs. Ensembl Cavefish
Match: pou1f1 (POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-040630-7])

HSP 1 Score: 127.872 bits (320), Expect = 9.717e-32
Identity = 68/169 (40.24%), Postives = 105/169 (62.13%), Query Frame = 3
Query: 1350 KSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            KS P      +D   + E+++FA +FK+RR+ +G TQT VG+AL A  G  +SQ+ ICRFE L ++ K+A K+K IL KW++E+E+     + ++ +       +KRKRRT+ +  A E L  +F  KS P+  E+  +A  L+ ++EV+RVWFCN+RQ      KR+K
Sbjct:  146 KSRPPEEPPDMDSPQIRELEKFANDFKLRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKSILAKWLEEAEQ-----AGALYNEKMGMQERKRKRRTTISLGAKEALERNFVEKSKPSSQEIVRMAEGLHLEKEVVRVWFCNRRQ----REKRVK 305          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 247.669 bits (631), Expect = 1.308e-74
Identity = 119/163 (73.01%), Postives = 141/163 (86.50%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L E++EFAR FKIRRLS+GLTQTQVGQAL+AAEGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W++E+E +  +G  S+ D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G EM A+A  L YDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  138 VDGVNLEEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMEEAEARKQAGLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALKNTIKRLKQHDP 300          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou6f2 (POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-091118-71])

HSP 1 Score: 247.284 bits (630), Expect = 1.624e-74
Identity = 119/163 (73.01%), Postives = 141/163 (86.50%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTP 1868
            VDGV+L E++EFAR FKIRRLS+GLTQTQVGQAL+AAEGPAYSQSAICRFEKLDITPKSAQKIKP+LE+W++E+E +  +G  S+ D  G + +KKRKRRTSFTPQALE+LN HFER +HP+G EM A+A  L YDREV+RVWFCNKRQALKN+ KR+KQ  P
Sbjct:  135 VDGVNLEEMREFARAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRFEKLDITPKSAQKIKPVLERWMEEAEARKQAGLQSLSDFVGGEPSKKRKRRTSFTPQALELLNAHFERNTHPSGQEMTAIAERLCYDREVVRVWFCNKRQALKNTIKRLKQHDP 297          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009070.1 (pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 gene:ENSPMAG00000008205.1 transcript:ENSPMAT00000009070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 227.639 bits (579), Expect = 2.064e-67
Identity = 114/183 (62.30%), Postives = 140/183 (76.50%), Query Frame = 3
Query: 1308 HNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            HN + A     CSD          +D + L EI+EFAR FKIRRLSMGLTQTQVGQA+++ E PAYSQSAICRFEKLDITPKSAQKIKP+LE+W+ E+E +  +G  S+ D  GS+ ++KR+RRTSFTPQALE LN +FER +HP+G EM A+A  L Y+REV+RVWFCNKRQ LKN+ KR+K
Sbjct:  137 HNPQGA-----CSD----------IDNMKLEEIREFARAFKIRRLSMGLTQTQVGQAMSSTEAPAYSQSAICRFEKLDITPKSAQKIKPVLERWMAEAEARQRTGLQSLSDFVGSEPSRKRRRRTSFTPQALEALNAYFERNTHPSGQEMTAIAEHLCYEREVVRVWFCNKRQMLKNTIKRLK 304          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002675.1 (pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 gene:ENSPMAG00000002443.1 transcript:ENSPMAT00000002675.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.394 bits (555), Expect = 6.774e-66
Identity = 107/171 (62.57%), Postives = 139/171 (81.29%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHI 1895
            + VDL EI+EFA+ FK+RRL++GLTQTQVGQAL+AAEGPAYSQSAICRFEKLD+TPKSAQK++PILE+W+ E+E ++  G++++ D  GS+ +K+RKRRTSFT +AL ILN HF+   HPT +EM  +A  L YDREV+R+WFCNKRQALKN+ K+IK        ++QHI
Sbjct:    1 EAVDLEEIREFAKVFKLRRLALGLTQTQVGQALSAAEGPAYSQSAICRFEKLDLTPKSAQKMRPILERWMGEAEARHRMGTHTLTDFIGSEPSKRRKRRTSFTQEALVILNAHFDVGMHPTSAEMTQIAEQLGYDREVVRIWFCNKRQALKNTIKQIK--------HHQHI 163          
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Match: pou2f1b (POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2422])

HSP 1 Score: 105.145 bits (261), Expect = 2.311e-24
Identity = 56/151 (37.09%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1383 DGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXX---XXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            D  DL E++ FA+ FK RR+ +G TQ  VG A+    G  +SQ+ I RFE L+++ K+  K+KP+LEKW+ ++E      S             + ++RK+RTS        L   F     PT  E+  +A  L+ ++EV+RVWFCN+RQ
Sbjct:  208 DPRDLEELEVFAKMFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDTEHIPADSSPGNQNASPSGLEGLGRRRKKRTSIDTHVRVALEKSFLENCKPTSEELSMIAEQLHMEKEVVRVWFCNRRQ 358          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO38767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC36])

HSP 1 Score: 125.176 bits (313), Expect = 4.817e-33
Identity = 68/159 (42.77%), Postives = 98/159 (61.64%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIK 1856
            VD   L E++EFA  FK+RR+ +G TQT VG AL A  G  +SQ+ ICRFE L ++ K+A K+KPIL +W++E+E       +    G      ++RKRRT+    A E L  HF +++ P+  E+  +A+ L  D+EV+RVWFCN+RQ      KR+K
Sbjct:    1 VDPSKLRELEEFATQFKLRRIKLGFTQTNVGAALAAVHGTDFSQTTICRFENLQLSFKNACKLKPILARWLEEAER------SGGACGEKFGAERRRKRRTTIGLAAKEALENHFMKQTKPSSPEIVRIADGLRLDKEVVRVWFCNRRQ----REKRVK 149          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO33532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRV9])

HSP 1 Score: 118.627 bits (296), Expect = 1.470e-30
Identity = 57/142 (40.14%), Postives = 87/142 (61.27%), Query Frame = 3
Query: 1401 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            ++++FA+ FK RR+ +G TQ  VG AL    G  +SQ+ ICRFE L ++ K+  K+KP+L+KW++E++    +   +      +   +KRK+RTS        L  HF +   PT  E+ ALA +L  D+EV+RVWFCN+RQ
Sbjct:   41 DLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLQKWLEEADN---NNGATGGVDKLATTGRKRKKRTSIEVAVKGALENHFCKSPKPTAQEISALAENLGLDKEVVRVWFCNRRQ 179          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO43881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXQ0])

HSP 1 Score: 114.005 bits (284), Expect = 3.850e-29
Identity = 59/149 (39.60%), Postives = 88/149 (59.06%), Query Frame = 3
Query: 1401 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKES-------EEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            E+  FA+ F+ RR+++G TQ  VG AL    G   SQ+ ICRFE L ++ K+  K+KP+L+KW++E+       E +     ++    + +   KKRKRRT        +L  HFE+   P+ S++ +LA  L  DREV+RVWFCN+RQ
Sbjct:    8 ELSTFAKQFRQRRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQ 156          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO30968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ94])

HSP 1 Score: 104.375 bits (259), Expect = 4.877e-26
Identity = 55/138 (39.86%), Postives = 81/138 (58.70%), Query Frame = 3
Query: 1434 RRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKES-------EEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            RR+++G TQ  VG AL    G   SQ+ ICRFE L ++ K+  K+KP+L+KW++E+       E +     ++    + +   KKRKRRT        +L  HFE+   P+ S++ +LA  L  DREV+RVWFCN+RQ
Sbjct:    3 RRVALGFTQADVGVALGTLYGNVLSQTTICRFEALQLSLKNMCKLKPLLQKWLQETDASSSGHEGEKQQNPSNFAFATHNGPYKKRKRRTIIEKNVKGVLENHFEKMPRPSTSDISSLAESLGLDREVVRVWFCNRRQ 140          
BLAST of POU domain protein vs. Ensembl Nematostella
Match: EDO47033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB5])

HSP 1 Score: 92.4337 bits (228), Expect = 1.059e-21
Identity = 52/145 (35.86%), Postives = 81/145 (55.86%), Query Frame = 3
Query: 1401 EIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPA---YSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQ 1826
            E++ FA  FK RR+ +G+TQ  VG AL   + P     SQS ICRFE L ++  +   +KP+L  W++E+E+ Y   +   +     + +KKRKR TS        L  +F     P+  ++ ++A  L+  + V+RVWFCN+RQ
Sbjct:    5 ELEWFAERFKQRRIKLGVTQADVGSALAHLKIPGVGSLSQSTICRFESLTLSHNNMMALKPVLTAWLEEAEKAY--KTKQCNSAFLPNSDKKRKR-TSIGAAEKRSLEAYFAMNPRPSSDKIASIAEKLDLSKNVVRVWFCNQRQ 146          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:101157777])

HSP 1 Score: 231.106 bits (588), Expect = 2.676e-65
Identity = 110/173 (63.58%), Postives = 139/173 (80.35%), Query Frame = 3
Query: 1329 KHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            K  Q   K + TA   + +G++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ + PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  354 KVGQLVSKPQQTAS--SEEGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLAEAEHWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNSYFEKNALPTGQEITEIARELNYDREVVRVWFCNRRQTLKNTSK 524          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:101157777])

HSP 1 Score: 233.032 bits (593), Expect = 4.066e-65
Identity = 110/173 (63.58%), Postives = 139/173 (80.35%), Query Frame = 3
Query: 1329 KHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
            K  Q   K + TA +   +G++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ + PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  441 KVGQLVSKPQQTASSE--EGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLAEAEHWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNSYFEKNALPTGQEITEIARELNYDREVVRVWFCNRRQTLKNTSK 611          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou6f2 (POU class 6 homeobox 2 [Source:NCBI gene;Acc:101164441])

HSP 1 Score: 233.417 bits (594), Expect = 5.382e-65
Identity = 118/196 (60.20%), Postives = 141/196 (71.94%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+AAEGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ SG  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ
Sbjct:  440 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRHTILRSHFFLPQEAQENTISNSLTGKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRSGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNSHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQ 635          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou6f2 (POU class 6 homeobox 2 [Source:NCBI gene;Acc:101164441])

HSP 1 Score: 233.417 bits (594), Expect = 5.382e-65
Identity = 118/196 (60.20%), Postives = 141/196 (71.94%), Query Frame = 3
Query: 1380 VDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICR------------------------------------FEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQ 1859
            VDGV+L EI+EFA+ FKIRRLS+GLTQTQVGQAL+AAEGPAYSQSAICR                                    FEKLDITPKSAQKIKP+LE+W+ E+E ++ SG  ++ +  GS+ +KKRKRRTSFTPQALEILN HFE+ +HP+G EM  +A  LNYDREV+RVWFCNKRQALKN+ KR+KQ
Sbjct:  440 VDGVNLEEIREFAKAFKIRRLSLGLTQTQVGQALSAAEGPAYSQSAICRHTILRSHFFLPQEAQENTISNSLTGKLNPGLLYPARFEKLDITPKSAQKIKPVLERWMAEAEARHRSGMQNLTEFIGSEPSKKRKRRTSFTPQALEILNSHFEKNTHPSGQEMTEIAEKLNYDREVVRVWFCNKRQALKNTIKRLKQ 635          
BLAST of POU domain protein vs. Ensembl Medaka
Match: pou6f1 (POU class 6 homeobox 1 [Source:NCBI gene;Acc:101157777])

HSP 1 Score: 232.261 bits (591), Expect = 1.111e-64
Identity = 113/201 (56.22%), Postives = 148/201 (73.63%), Query Frame = 3
Query: 1245 YILSQEDHLVKEKAAELLRHSHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAK 1847
             +++ +  ++K  A        N     K  Q   K + TA +   +G++L EI+EFA+NFKIRRLS+GLTQTQVGQALTA EGPAYSQSAICRFEKLDITPKSAQK+KP+LEKW+ E+E     G  ++ +  G + +KKRKRRTSFTPQA+E+LN +FE+ + PTG E+  +A +LNYDREV+RVWFCN+RQ LKN++K
Sbjct:  435 VVIAPQPSMLKTAATHPSMAPINCGELAKVGQLVSKPQQTASSE--EGINLEEIREFAKNFKIRRLSLGLTQTQVGQALTATEGPAYSQSAICRFEKLDITPKSAQKLKPVLEKWLAEAEHWNQKGQQNLMEFVGGEPSKKRKRRTSFTPQAIEVLNSYFEKNALPTGQEITEIARELNYDREVVRVWFCNRRQTLKNTSK 633          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000058834.1 (SMESG000058834.1)

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 492/493 (99.80%), Postives = 492/493 (99.80%), Query Frame = 3
Query:  432 TNVLDMTKLDQQNQIISCGNSTNFTNKNTIDSSSNDTTQVSSTANNISSIEHFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGXXXXXXXXXXXXXXXXXQQLSVNRESNVINTNQTTNPNAAIIEHMMXXXXXXXXXKNSMIHQSWPNEFQQTSSNNQTNSFIANNIPVATTNSSTIKPIDKVNGSTQFQIPLNCNPAPLQNEKFTTNIISINDRAIDNKXXXXXXXXXXXXXGNKICQMIDVSHDYILSQEDHLVKEKAAELLRHSHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLXXXXXXXXXXXXXINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHISPQVM 1910
            TNVLDMTKLDQQNQIISCGNSTNFTNKNTIDSSSNDTTQVSSTANNISSIEHFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGNILANSLASLATTLTSIQQLSVNRESNVINTNQ TNPNAAIIEHMMQQYQQLQLLKNSMIHQSWPNEFQQTSSNNQTNSFIANNIPVATTNSSTIKPIDKVNGSTQFQIPLNCNPAPLQNEKFTTNIISINDRAIDNKSPSVNSSVSSRSVGNKICQMIDVSHDYILSQEDHLVKEKAAELLRHSHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLSGSNSVDDGSGSDINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHISPQVM
Sbjct:   10 TNVLDMTKLDQQNQIISCGNSTNFTNKNTIDSSSNDTTQVSSTANNISSIEHFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLIPVFINSLGQMVLANTGNILANSLASLATTLTSIQQLSVNRESNVINTNQATNPNAAIIEHMMQQYQQLQLLKNSMIHQSWPNEFQQTSSNNQTNSFIANNIPVATTNSSTIKPIDKVNGSTQFQIPLNCNPAPLQNEKFTTNIISINDRAIDNKSPSVNSSVSSRSVGNKICQMIDVSHDYILSQEDHLVKEKAAELLRHSHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGLTQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESEEKYLSGSNSVDDGSGSDINKKRKRRTSFTPQALEILNIHFERKSHPTGSEMRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHISPQVM 502          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 377.096 bits (967), Expect = 0.000e+0
Identity = 198/200 (99.00%), Postives = 199/200 (99.50%), Query Frame = 2
Query: 1949 PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIAXXXXXXXXXXXXXXGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 2548
            PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPII NSSN+NINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL
Sbjct: 1019 PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIGNSSNNNINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 1218          

HSP 2 Score: 288.115 bits (736), Expect = 0.000e+0
Identity = 136/140 (97.14%), Postives = 136/140 (97.14%), Query Frame = 1
Query: 2533 FRPSSSYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 2952
            F P   YSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC
Sbjct: 1214 FDPPLQYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 1353          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 377.096 bits (967), Expect = 0.000e+0
Identity = 198/200 (99.00%), Postives = 199/200 (99.50%), Query Frame = 2
Query: 1949 PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIAXXXXXXXXXXXXXXGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 2548
            PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPII NSSN+NINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL
Sbjct: 1021 PGSHLGQMHPSMMDMYQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIGNSSNNNINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 1220          

HSP 2 Score: 287.73 bits (735), Expect = 0.000e+0
Identity = 136/140 (97.14%), Postives = 136/140 (97.14%), Query Frame = 1
Query: 2533 FRPSSSYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 2952
            F P   YSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC
Sbjct: 1216 FDPPLQYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 1355          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 372.859 bits (956), Expect = 0.000e+0
Identity = 198/201 (98.51%), Postives = 199/201 (99.00%), Query Frame = 2
Query: 1949 PGSHLGQMHPSMMDMY-QPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIAXXXXXXXXXXXXXXGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 2548
            PGSHLGQMHPSMMDMY QPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPII NSSN+NINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL
Sbjct: 1021 PGSHLGQMHPSMMDMYSQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIGNSSNNNINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 1221          

HSP 2 Score: 288.115 bits (736), Expect = 0.000e+0
Identity = 136/140 (97.14%), Postives = 136/140 (97.14%), Query Frame = 1
Query: 2533 FRPSSSYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 2952
            F P   YSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC
Sbjct: 1217 FDPPLQYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 1356          
BLAST of POU domain protein vs. Planmine SMEST
Match: SMESG000048961.1 (SMESG000048961.1)

HSP 1 Score: 372.474 bits (955), Expect = 0.000e+0
Identity = 198/201 (98.51%), Postives = 199/201 (99.00%), Query Frame = 2
Query: 1949 PGSHLGQMHPSMMDMY-QPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIAXXXXXXXXXXXXXXGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 2548
            PGSHLGQMHPSMMDMY QPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPII NSSN+NINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL
Sbjct: 1019 PGSHLGQMHPSMMDMYSQPHAFSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHTLNSLPEQPMDNNNHDQHDSPVPIIGNSSNNNINNNNSSSGRHHHRRKTRSRQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMNTIDSRDNAVNDCNSESNTAGAVSDNFDPPL 1219          

HSP 2 Score: 287.73 bits (735), Expect = 0.000e+0
Identity = 136/140 (97.14%), Postives = 136/140 (97.14%), Query Frame = 1
Query: 2533 FRPSSSYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 2952
            F P   YSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC
Sbjct: 1215 FDPPLQYSGHYDTNESKYRMDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPPLKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPARADEIYMRDQREGMYYHGDTHC 1354          
The following BLAST results are available for this feature:
BLAST of POU domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POU6F22.073e-7171.78POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU6F17.119e-6565.45POU class 6 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
POU6F21.180e-6458.79POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
POU6F11.584e-6465.45POU class 6 homeobox 1 [Source:HGNC Symbol;Acc:HGN... [more]
POU6F22.183e-6458.79POU class 6 homeobox 2 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of POU domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-66.797e-2538.51Homeobox protein ceh-6 [Source:UniProtKB/Swiss-Pr... [more]
unc-861.836e-2134.44Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
unc-862.884e-2134.44Transcription factor unc-86 [Source:UniProtKB/Swi... [more]
ceh-182.874e-1928.88Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
ceh-183.193e-1928.88Homeobox protein ceh-18 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of POU domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdm38.666e-6667.43gene:FBgn0261588 transcript:FBtr0339349[more]
pdm35.305e-6260.62gene:FBgn0261588 transcript:FBtr0302918[more]
pdm31.841e-6160.62gene:FBgn0261588 transcript:FBtr0302919[more]
pdm32.496e-6160.31gene:FBgn0261588 transcript:FBtr0339350[more]
vvl6.499e-2737.93gene:FBgn0086680 transcript:FBtr0345911[more]
back to top
BLAST of POU domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou6f25.384e-6459.69POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou6f16.933e-6467.10POU class 6 homeobox 1 [Source:NCBI gene;Acc:30334... [more]
pou6f11.175e-6367.10POU class 6 homeobox 1 [Source:NCBI gene;Acc:30334... [more]
pou1f11.045e-3041.61POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou1f11.095e-3040.88POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of POU domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxa54.333e-6557.14homeobox A5 [Source:Xenbase;Acc:XB-GENE-486061][more]
hoxa55.061e-6557.14homeobox A5 [Source:Xenbase;Acc:XB-GENE-486061][more]
pou6f12.708e-6467.74POU class 6 homeobox 1 [Source:NCBI gene;Acc:10012... [more]
pou6f13.975e-6467.74POU class 6 homeobox 1 [Source:NCBI gene;Acc:10012... [more]
POU1F12.137e-3438.67POU class 1 homeobox 1 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of POU domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pou6f23.117e-7270.66POU domain, class 6, transcription factor 2 [Sourc... [more]
Pou6f11.441e-6765.45POU domain, class 6, transcription factor 1 [Sourc... [more]
Pou6f21.838e-6558.13POU domain, class 6, transcription factor 2 [Sourc... [more]
Pou6f15.242e-6565.45POU domain, class 6, transcription factor 1 [Sourc... [more]
Pou1f14.715e-3339.64POU domain, class 1, transcription factor 1 [Sourc... [more]
back to top
BLAST of POU domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07916|PO6F1_MOUSE1.008e-6665.45POU domain, class 6, transcription factor 1 OS=Mus... [more]
sp|P56223|PO6F1_RAT1.441e-6665.45POU domain, class 6, transcription factor 1 OS=Rat... [more]
sp|Q14863|PO6F1_HUMAN2.744e-6665.45POU domain, class 6, transcription factor 1 OS=Hom... [more]
sp|Q8BJI4|PO6F2_MOUSE2.757e-6458.13POU domain, class 6, transcription factor 2 OS=Mus... [more]
sp|P78424|PO6F2_HUMAN5.666e-6458.79POU domain, class 6, transcription factor 2 OS=Hom... [more]
back to top
BLAST of POU domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R4N9Z30.000e+085.20POU domain protein OS=Dugesia japonica OX=6161 PE=... [more]
V4BHE93.147e-7366.85POU domain protein OS=Lottia gigantea OX=225164 GN... [more]
A0A1A6GKH93.851e-7368.75POU domain protein OS=Neotoma lepida OX=56216 GN=A... [more]
A0A1W0WHG87.163e-7366.31POU domain protein OS=Hypsibius dujardini OX=23232... [more]
A0A2C9K2U77.185e-7374.23POU domain protein OS=Biomphalaria glabrata OX=652... [more]
back to top
BLAST of POU domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou6f12.324e-6467.10POU class 6 homeobox 1 [Source:NCBI gene;Acc:10302... [more]
pou6f13.981e-6467.10POU class 6 homeobox 1 [Source:NCBI gene;Acc:10302... [more]
pou6f24.479e-6459.69POU class 6 homeobox 2 [Source:NCBI gene;Acc:10304... [more]
pou6f24.479e-6459.69POU class 6 homeobox 2 [Source:NCBI gene;Acc:10304... [more]
pou1f19.717e-3240.24POU class 1 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of POU domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou6f21.308e-7473.01POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pou6f21.624e-7473.01POU class 6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000009070.12.064e-6762.30pep scaffold:Pmarinus_7.0:GL476573:36580:49436:1 g... [more]
ENSPMAT00000002675.16.774e-6662.57pep scaffold:Pmarinus_7.0:GL479714:4410:5816:-1 ge... [more]
pou2f1b2.311e-2437.09POU class 2 homeobox 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of POU domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of POU domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO387674.817e-3342.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335321.470e-3040.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438813.850e-2939.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309684.877e-2639.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470331.059e-2135.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of POU domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pou6f12.676e-6563.58POU class 6 homeobox 1 [Source:NCBI gene;Acc:10115... [more]
pou6f14.066e-6563.58POU class 6 homeobox 1 [Source:NCBI gene;Acc:10115... [more]
pou6f25.382e-6560.20POU class 6 homeobox 2 [Source:NCBI gene;Acc:10116... [more]
pou6f25.382e-6560.20POU class 6 homeobox 2 [Source:NCBI gene;Acc:10116... [more]
pou6f11.111e-6456.22POU class 6 homeobox 1 [Source:NCBI gene;Acc:10115... [more]
back to top
BLAST of POU domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000058834.10.000e+099.80SMESG000058834.1[more]
SMESG000048961.10.000e+099.00SMESG000048961.1[more]
SMESG000048961.10.000e+099.00SMESG000048961.1[more]
SMESG000048961.10.000e+098.51SMESG000048961.1[more]
SMESG000048961.10.000e+098.51SMESG000048961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010910 ID=SMED30010910|Name=POU domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3203bp
TAGGGCTAAATGTAACGCTACTTATCGGTATTGCCACAATTATATTAAGG
CAGTGGCACAAACTTATTTTCTCTACCAGGCCTGCTGAATCGACAAACAA
ACATATTCATCGTCATTAAATGGGCAGTAGTAGTAGAAACACAGTGGTAA
AGACATGGCAAACACAGCAGCATCAGTGATAGCTGGAAGAGATAGCTACA
GCATCAGCAGCAGTAACTCTCGCAGCTAATAATGAAGATAATGAGCTAGA
CTTAATTATCTTGGCTAATAATTTCAAATAAAATATCGCAACTAATTTTG
TCATTCGTATTCTGTGAGGATAAATCACAAATTTGTTTCGATTGTTGGAA
ATTTAAATTTTTTTCCCTCGTATTTTCCAAATACTCCAGAGTTTGAAGAG
TATAATGAATTTGTTACCGAATCCGTTACTCACAAATGTGCTGGATATGA
CTAAACTTGACCAACAAAACCAAATTATCTCGTGTGGCAATTCGACAAAT
TTCACCAACAAAAACACAATTGACAGCTCTTCAAATGATACCACACAAGT
CAGTTCAACAGCCAACAACATCAGTTCAATTGAACATTTCCTTTCATCCC
GCAATTTAACAAATCAGCTGATAAATAATTCCGGACTCCCATTAGGGGCA
CAGATATTCACCATTCCGGCATCATTGGCGACATTCCCGAATTCGGATTT
GATTCCAGTATTCATCAACAGTTTAGGACAAATGGTTCTGGCAAATACTG
GGAATATTCTGGCGAACAGTTTGGCAAGTTTGGCCACCACACTCACGTCA
ATCCAGCAGCTGTCCGTGAACCGTGAATCGAATGTCATCAACACTAATCA
AACTACTAACCCAAATGCAGCTATCATAGAGCACATGATGCAGCAATACC
AACAGCTTCAGCTGCTGAAGAACTCAATGATCCATCAATCATGGCCGAAT
GAGTTCCAGCAGACATCCTCAAACAACCAAACCAATTCATTTATTGCAAA
TAATATACCAGTAGCAACTACAAATTCTAGTACAATTAAACCCATAGATA
AAGTTAATGGCAGTACGCAATTCCAAATTCCGTTGAATTGCAATCCTGCT
CCTCTTCAAAATGAAAAATTTACTACCAATATCATCTCCATAAATGATCG
TGCTATAGATAACAAATCCCCAAGCGTCAACTCTTCGGTATCCTCTAGAT
CAGTAGGAAACAAAATTTGTCAAATGATTGACGTCAGTCATGATTACATT
TTAAGTCAAGAAGATCATCTGGTGAAAGAAAAAGCCGCAGAATTACTCCG
ACATTCACACAACCAAAAAAACGCTATCAAACATGCCCAATGTTCTGATA
AATCAGAACCAACAGCACATAATGTCACAGTGGATGGTGTTGATCTCGGT
GAAATCAAAGAATTTGCCCGTAATTTCAAAATTAGACGTCTCAGCATGGG
GTTAACTCAAACACAAGTCGGTCAAGCGCTGACTGCAGCAGAAGGTCCGG
CATACAGTCAAAGTGCAATCTGCAGATTCGAAAAGTTGGATATCACACCG
AAATCGGCTCAGAAAATTAAACCAATTCTAGAGAAATGGATCAAAGAATC
CGAAGAAAAATATCTCAGTGGATCGAACAGTGTTGATGATGGATCCGGAT
CTGACATCAATAAAAAACGGAAACGTCGAACGAGTTTTACACCACAAGCA
CTGGAAATTCTGAATATTCATTTTGAGAGGAAATCTCATCCGACTGGATC
GGAAATGCGAGCATTGGCTAACGACCTCAATTATGACAGAGAGGTCATTA
GAGTTTGGTTTTGCAACAAAAGACAAGCGTTAAAGAATTCTGCCAAGCGA
ATTAAACAATGTACACCAAACAGCGAATCAAACAACCAGCACATATCTCC
CCAAGTCATGAACAGCAACAGCAACAGCAACAACACCACCATCACCAACC
GGGCAGTCACCTAGGCCAAATGCATCCATCCATGATGGACATGTATCAGC
CACACGCGTTCTCAAGACCCATTACTGCTGAATACCAACAGAGTCTCAAT
CGGCAACAATATCGACGCAGCGACAGCGATTGTGGAACTCATGAGCCTGG
ATATTCGTACCTGCCGACTCCTCATGGGCCAGAAGTGGTGTCATCTCGTC
AACATACTCTCAATAGTCTTCCAGAACAACCGATGGACAATAACAATCAT
GATCAGCATGATTCTCCAGTACCGATTATTGCCAACAGTAGCAACAGTAA
CATCAACAATAACAACAGCAGTTCTGGTCGACATCATCATCGTCGCAAAA
CCAGATCTCGACAAACCAATAATCAAGAGCCGACATCACTAGAACGGAGC
CAAGTAATGAAAAATCACAACGACATACCACCAATGTTAGCGCCACGGAC
AAAATTGCCGTATTCCGAGCATCAGGGAATTCATCGTCTATCCGCTCATG
AAATGAATACCATTGACAGTCGTGACAATGCTGTCAATGATTGCAATTCT
GAATCCAATACCGCTGGCGCTGTCAGCGATAATTTCGACCCTCCTCTTCA
TACTCCGGCCATTACGATACCAATGAGTCGAAGTACCGCATGGATTGCAA
CATCGATATGAATGAAAATGAAGCAACTCCCAGTAATTCTCTGTTGATTG
AGAACCTTCCCAGAGTTAGAGATGTTTCCGAGTATGGAATACCTATAAAC
AATAACAATCACAACATGAAACAAGCTCCCGTGCCTCCTCTTAAATCGAA
TAGTCGACATAATCCTGTGCCTAACAACAGTTACGGTCTCGAGTGCAATC
CTGATTATTATTCATCTGCCACATCTAGTGACAGATCCGGTCCCAGTCCT
CCCCCTAAATATGCGCCAGGAGTAGTTCTTCCTGCCCGTGCTGATGAAAT
ATATATGCGCGATCAAAGAGAAGGAATGTACTATCACGGAGATACTCATT
GTTGATAATTGTATTTCACAATTTCGTTTCATCGGGTGTTCTCGATTGCT
GATACTCTATCTCATACCTTTCGATGAATTTCTGATCCCAACTGACAGTT
GTACAATTCTTATCATCATCATCATCTTCCTCATCTTTTCATATTTTATC
TAGTCCTACTTGCAATCTTCTCCGTGTGCTCTCCACAGTGCGATTATTAT
TATAATAATAAATTATTGCTATTGATTATTATAATTATTGTTATTGATAA
TAA
back to top

protein sequence of SMED30010910-orf-1

>SMED30010910-orf-1 ID=SMED30010910-orf-1|Name=SMED30010910-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MDCNIDMNENEATPSNSLLIENLPRVRDVSEYGIPINNNNHNMKQAPVPP
LKSNSRHNPVPNNSYGLECNPDYYSSATSSDRSGPSPPPKYAPGVVLPAR
ADEIYMRDQREGMYYHGDTHC*
back to top

protein sequence of SMED30010910-orf-2

>SMED30010910-orf-2 ID=SMED30010910-orf-2|Name=SMED30010910-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=520bp
MNLLPNPLLTNVLDMTKLDQQNQIISCGNSTNFTNKNTIDSSSNDTTQVS
STANNISSIEHFLSSRNLTNQLINNSGLPLGAQIFTIPASLATFPNSDLI
PVFINSLGQMVLANTGNILANSLASLATTLTSIQQLSVNRESNVINTNQT
TNPNAAIIEHMMQQYQQLQLLKNSMIHQSWPNEFQQTSSNNQTNSFIANN
IPVATTNSSTIKPIDKVNGSTQFQIPLNCNPAPLQNEKFTTNIISINDRA
IDNKSPSVNSSVSSRSVGNKICQMIDVSHDYILSQEDHLVKEKAAELLRH
SHNQKNAIKHAQCSDKSEPTAHNVTVDGVDLGEIKEFARNFKIRRLSMGL
TQTQVGQALTAAEGPAYSQSAICRFEKLDITPKSAQKIKPILEKWIKESE
EKYLSGSNSVDDGSGSDINKKRKRRTSFTPQALEILNIHFERKSHPTGSE
MRALANDLNYDREVIRVWFCNKRQALKNSAKRIKQCTPNSESNNQHISPQ
VMNSNSNSNNTTITNRAVT*
back to top

protein sequence of SMED30010910-orf-3

>SMED30010910-orf-3 ID=SMED30010910-orf-3|Name=SMED30010910-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=251bp
MYTKQRIKQPAHISPSHEQQQQQQQHHHHQPGSHLGQMHPSMMDMYQPHA
FSRPITAEYQQSLNRQQYRRSDSDCGTHEPGYSYLPTPHGPEVVSSRQHT
LNSLPEQPMDNNNHDQHDSPVPIIANSSNSNINNNNSSSGRHHHRRKTRS
RQTNNQEPTSLERSQVMKNHNDIPPMLAPRTKLPYSEHQGIHRLSAHEMN
TIDSRDNAVNDCNSESNTAGAVSDNFDPPLHTPAITIPMSRSTAWIATSI
*
back to top
Aliases
The feature 'POU domain protein' has the following synonyms
Synonym
pou6*-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR013847POU
IPR000327POU_dom
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR010982Lambda_DNA-bd_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013847POU domainPRINTSPR00028POUDOMAINcoord: 420..440
score: 41.57
coord: 455..470
score: 58.66
coord: 384..399
score: 43.82
coord: 345..362
score: 47.74
coord: 368..381
score: 58.78
IPR000327POU-specific domainSMARTSM00352poucoord: 326..400
e-value: 3.9E-37
score: 139.4
IPR000327POU-specific domainPFAMPF00157Poucoord: 331..400
e-value: 7.0E-28
score: 96.4
IPR000327POU-specific domainPROSITEPS00465POU_2coord: 368..381
IPR000327POU-specific domainPROSITEPS51179POU_3coord: 326..400
score: 29.515
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 421..483
e-value: 1.3E-17
score: 74.6
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 422..477
e-value: 8.7E-15
score: 54.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 419..479
score: 15.742
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 422..479
e-value: 4.15581E-14
score: 64.9572
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 409..471
e-value: 1.9E-17
score: 64.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 481..505
NoneNo IPR availablePANTHERPTHR11636POU DOMAINcoord: 34..493
NoneNo IPR availablePANTHERPTHR11636:SF5POU DOMAIN MOTIF 3, ISOFORM Fcoord: 34..493
IPR010982Lambda repressor-like, DNA-binding domain superfamilyGENE3DG3DSA:1.10.260.40coord: 329..408
e-value: 3.8E-33
score: 115.1
IPR010982Lambda repressor-like, DNA-binding domain superfamilySUPERFAMILYSSF47413lambda repressor-like DNA-binding domainscoord: 332..400
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 417..481