Structural maintenance of chromosomes protein

Overview
NameStructural maintenance of chromosomes protein
Smed IDSMED30010906
Length (bp)3666
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Structural maintenance of chromosomes protein (SMED30010906) t-SNE clustered cells

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30010906) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Structural maintenance of chromosomes protein (SMED30010906) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Structural maintenance of chromosomes protein (SMED30010906) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010906

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010906SMESG000059543.1 SmedASXL_017296SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010906SMESG000059543.1 SmedASXL_017296SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010906SMESG000059543.1 dd_Smed_v4_7123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010906SMESG000059543.1 dd_Smed_v4_7123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010906SMESG000059543.1 dd_Smed_v4_7123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010906SMESG000059543.1 dd_Smed_v4_7123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010906SMESG000059543.1 Contig39600newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010906SMESG000059543.1 Contig39600uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010906SMESG000059543.1 dd_Smed_v6_7123_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30010906SMESG000059543.1 dd_Smed_v4_7123_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010906SMESG000059543.1 SMED_30516_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010906SMESG000059543.1 SMED_03484_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010906SMESG000059543.1 SMED_03484_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 476/1178 (40.41%), Postives = 735/1178 (62.39%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNA--IKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQ---SALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +     +  E   +++++ + +E + +N+++     + IE+L + +DK     L++++   AE Q+     ++A  +K+     +E+K   K+L+K M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L +K  +  K D+    +Q+  +    + E+L+A +  +NY + + E     +     D+ R+    +  + R P+    Y  P  +++   + G+VA+L+S+ D   + +L++  G RL+NV++D +    +L E+  L  R T +PLNK+S + I    +R A+ ++G +NV  AL +++Y    + A+ FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +EL  + + +   +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ RKA E+ ++ +  + N+ + +E+  K+A+ +   A+ +     +  K+ + + E + LE  + ++E       +EA  + + +      V + ++  +KES++  ++E+  Q  V   I  Q +  K    E  K+ +Q   S L++ +++H IS H++++ED   K+ K+L    WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V++R MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKR--KELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ---QELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEV---ITAQDTVIKAKYAEVAKHKEQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 476/1178 (40.41%), Postives = 735/1178 (62.39%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNA--IKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQ---SALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +     +  E   +++++ + +E + +N+++     + IE+L + +DK     L++++   AE Q+     ++A  +K+     +E+K   K+L+K M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L +K  +  K D+    +Q+  +    + E+L+A +  +NY + + E     +     D+ R+    +  + R P+    Y  P  +++   + G+VA+L+S+ D   + +L++  G RL+NV++D +    +L E+  L  R T +PLNK+S + I    +R A+ ++G +NV  AL +++Y    + A+ FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +EL  + + +   +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ RKA E+ ++ +  + N+ + +E+  K+A+ +   A+ +     +  K+ + + E + LE  + ++E       +EA  + + +      V + ++  +KES++  ++E+  Q  V   I  Q +  K    E  K+ +Q   S L++ +++H IS H++++ED   K+ K+L    WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V++R MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKR--KELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ---QELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEV---ITAQDTVIKAKYAEVAKHKEQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 476/1178 (40.41%), Postives = 735/1178 (62.39%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNA--IKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQ---SALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +     +  E   +++++ + +E + +N+++     + IE+L + +DK     L++++   AE Q+     ++A  +K+     +E+K   K+L+K M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L +K  +  K D+    +Q+  +    + E+L+A +  +NY + + E     +     D+ R+    +  + R P+    Y  P  +++   + G+VA+L+S+ D   + +L++  G RL+NV++D +    +L E+  L  R T +PLNK+S + I    +R A+ ++G +NV  AL +++Y    + A+ FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +EL  + + +   +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ RKA E+ ++ +  + N+ + +E+  K+A+ +   A+ +     +  K+ + + E + LE  + ++E       +EA  + + +      V + ++  +KES++  ++E+  Q  V   I  Q +  K    E  K+ +Q   S L++ +++H IS H++++ED   K+ K+L    WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V++R MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKR--KELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ---QELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEV---ITAQDTVIKAKYAEVAKHKEQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC3 (structural maintenance of chromosomes 3 [Source:HGNC Symbol;Acc:HGNC:2468])

HSP 1 Score: 194.897 bits (494), Expect = 9.223e-50
Identity = 316/1292 (24.46%), Postives = 565/1292 (43.73%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDX--XXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDN------ADGEYNR-LKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVES---DVNITLNTLNLRLVHTQSLLNQLASK---LGQTNKSDNS--------GELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELV-----YNRPRPDFDSRRI--------IGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAEL---FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNM--MDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKL--------LSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVD-----LRGMNVLGQTE-ERYSDL---------------MTKY----KKVLND-------KQVLQNVIDELDK--------------LKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT-------------PPEGKSLSD----------------GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++I GF+SY  +T +  F    N I G NGSGKSN   AI F+L     S +R      L+++     +  A V IIFDNS+ +  PI  E   E+++ R+++   K++Y ++  M   N V +L  S   + +NP++++ QG+I ++      + L LL E A T+ Y+ ++++++  +++ + K ++I++     EE    LE+ K E + Y ++ K+ R LEY    +   E   T+A +D         GE +R L++      + ++  E+Q    +  I  + EE++++  E+ + +K        Q   L+   K  +DE+    E  K+L K+ ++  E  ++ +  +A+ + +F+ +KEK E+       A Q   ++ +   Q + S  T    E   + +K E    D  I      +  +H + L +  A+K   L Q NK D           EL++K  ++  + ++L++  N +      W +   +Q A  +  R  L  +Q  +R      ++      N+    F  + I         G+V N     +P F   ++V  G RLF  I+D D V+ ++   F K  LP   TFLPLNK+  +         A  ++ K         ++Y+ R++ A   VFG  LI R+++++  +A        C+T +G+     G+L GG  +      E  +++   +  +  ++ +  EN  R  +  +N                E+ QL   M  ++ Q    KA  D   SE+K + E  +++EK +       +  + +L    S +E  + E  ++      QL L+++  K V+A    LN E    +QE +QLL                 R+  E II   E+        +N  + L ++E+++++ +++  E G  +  +   +  IN R+      SED +  I K          S  RW   E +H        D  N D KE    +EK+ + +  L +K +     +R +  L Q   E+Y  L               + KY    KK L+        K+ L    +ELD+               K E I+   +QV ++F ++F  L+PG +A L                EG   S+                G+  +++F     E   + +LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD  H + +  +I E   ++QFI  + +  +  +A+  +  KF + VS +
Sbjct:    6 VIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLS-DEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSD-NRLPIDKE---EVSL-RRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYT---IYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK--------QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAK--QGRGSQFTSK--EERDKWIKKELKSLDQAINDKKRQIAAIH-KDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYL------WREENAEQQALAAK-REDLEKKQQLLRAATGKAILNGIDSINKVLDHFRRKGINQHVQNGYHGIVMNNFEC-EPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISK---------LRYNPRFDKAFKHVFGKTLICRSMEVSTQLA--RAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINN----------------EIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDL---LSQLSLEDQ--KRVDA----LNDEIRQLQQENRQLLNE---------------RIKLEGIITRVETYLN-----ENLRKRLDQVEQELNELRET--EGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHM-------DAINHDTKE----LEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHI 1198          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Match: SMC2 (structural maintenance of chromosomes 2 [Source:HGNC Symbol;Acc:HGNC:14011])

HSP 1 Score: 160.999 bits (406), Expect = 7.524e-45
Identity = 77/151 (50.99%), Postives = 105/151 (69.54%), Query Frame = 1
Query: 2890 WIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQR 3342
            WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V++R MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQR
Sbjct:    7 WINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQR 157          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: mix-1 (Mitotic chromosome and X-chromosome-associated protein mix-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09591])

HSP 1 Score: 297.36 bits (760), Expect = 4.477e-83
Identity = 226/699 (32.33%), Postives = 374/699 (53.51%), Query Frame = 1
Query: 1576 RNPSYELVYNRPR---PDFDSRR-IIGVVANLVSLPDP--QFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPL-----NKMSFKPIPDFVVRKAKEILGKEN--VWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQI-EDNRKRHDEASAQLRAKSFELRQLERNMMDDQY----LNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLAN-SASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKI-----------IGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            ++  Y L Y RP      FD +R + G VA+L+ +     QF+++  +  GG L NV++    +A  L +     +R T +P+     N  S+  +PD  +R+AKEI  K N  V   +++I+Y     + I    G  L+  +LD+A+ +A+DE  K R +T  G+     G + GG  +  ++    + E +      +  QQR+ +  +R  Q+ E + ++  + + QL     +L Q++ N+ + ++     ++K   +E E    EI   ++       K  E+     E++ N   + +EK +KE  +  +KA+  +  ++   +  +A+ E++ L+ T  E E+      I+  E +   K   C    EK+           +  K + +      +NQ ++   + K   +C   + E  K   +   +  ++     +   + ++A  K+ K      W+ DE  HFN+ GG+YDF      + K +I++L D+   L R   ++ ++ L   E +  D+  K +++  D  +L+  I  LDK K + + +AHE V++DF +IF+ LLP + A L PPEGK++ +GLE K++FG V K+SL+ELSGGQRSLVALSLILA+L+FKPAPLYILDEVDAALD+SHT NIG +IK  F ++QFIIVSLK GMF+NA+VLF+T+F DG ST +R
Sbjct:  503 KDGRYALNYQRPPLHIDKFDEKRDVFGYVAHLIKMKPGCEQFAVAADIALGGVLGNVVVSTQDIARILIDGKAFTSRKTMIPVSENARNASSYNTLPDVKLRRAKEIAEKYNDTVTKMIDLIEYPDFISNTILNAVGQILVVDSLDVAREIAYDEVAKTRMITRRGDDVRTNGIMTGGYNDPGNKPALIALEPMYARRPQIEAQQRELDALNRELQLTEASSQKCRDLNNQLATAMRKLAQVKTNINNSEFGIVVRDLKVHSEEYEKNQAEIEATVK-----TLKDVEDKIKTLESMKNKDKNSQEKRKKELTALLQKAEQTVAQNKN--RGEKARREVMLLQATVEEMEK-----TIKKDEGIWEQKKKECDELEEKLPNAIAALKDAELEQKAAQAKLNDLKNNQRQISTRLGKIAKECDALIREKAKTKSKREEKEKELTSLQQSEASNRKEARSKLKKF----EWLSDEEAHFNKKGGLYDFEGYTVSKGKDEIKELTDKIETLERSCCIQNVSNLDTCEAKVLDIKNKRERITEDFNMLKKTIATLDKKKVDELIRAHESVNKDFGQIFNCLLPDAHASLVPPEGKTVCEGLEVKVSFGGVVKDSLHELSGGQRSLVALSLILAMLKFKPAPLYILDEVDAALDLSHTANIGMMIKTHFHHNQFIIVSLKQGMFSNADVLFQTRFADGHSTCTR 1185          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-3 (Structural maintenance of chromosomes protein 3 [Source:UniProtKB/Swiss-Prot;Acc:B2FDA8])

HSP 1 Score: 105.145 bits (261), Expect = 1.753e-22
Identity = 63/188 (33.51%), Postives = 103/188 (54.79%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLK 642
            + I GF+SY   T ++GF P  N + G NGSGKSN   AI F+L     + ++      L+++     +  A V I FDNSEK    + +E   E+ I RQ V   K++Y I+  M P   V +L  S   + +NP++++ QG+I ++        L LL E A T+ Y+ +++++LK +  K++K+K
Sbjct:    6 VRITGFRSYKDNTNVSGFSPRSNVVVGRNGSGKSNFFHAIQFVLS-DEYAHLKEEQRLGLLHESTGPKVAHARVEITFDNSEKR--LMAFEN-SEVKIVRQ-VGKKKDQYYIDNKMVPRAEVVNLMESAGFSRSNPYYIVKQGKINELATSPDAYKLKLLREVAGTRVYDERKEESLKIL--KETKMK 186          

HSP 2 Score: 69.3218 bits (168), Expect = 1.534e-11
Identity = 46/169 (27.22%), Postives = 91/169 (53.85%), Query Frame = 1
Query: 3115 LQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT--------PPEGKS---LSDGLEFKIAF----GNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++ ++  L+  K E I    +QV ++F+++F  L+P  + ++           EG +   L +G+   ++F    G+     + +LSGGQ+SLVAL++I ++ +  PAP Y+ DE+DAALD  H +++  +I+     +QF+  + +  +   A   +  +F + VS +
Sbjct: 1018 IEELLKVLENRKYEAIDLTFKQVKKNFEQVFKQLVPHGRGKMQMRAREQRDDEEGINSVELYEGISVLVSFVSDDGDSETREMTQLSGGQKSLVALAIIFSIQKCDPAPFYLFDEIDAALDAQHRKSVADMIQSLSDQAQFVTTTFRPELLATAEKFYGVRFRNKVSHI 1186          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-3 (Structural maintenance of chromosomes protein 3 [Source:UniProtKB/Swiss-Prot;Acc:B2FDA8])

HSP 1 Score: 105.145 bits (261), Expect = 1.755e-22
Identity = 63/188 (33.51%), Postives = 103/188 (54.79%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLK 642
            + I GF+SY   T ++GF P  N + G NGSGKSN   AI F+L     + ++      L+++     +  A V I FDNSEK    + +E   E+ I RQ V   K++Y I+  M P   V +L  S   + +NP++++ QG+I ++        L LL E A T+ Y+ +++++LK +  K++K+K
Sbjct:    6 VRITGFRSYKDNTNVSGFSPRSNVVVGRNGSGKSNFFHAIQFVLS-DEYAHLKEEQRLGLLHESTGPKVAHARVEITFDNSEKR--LMAFEN-SEVKIVRQ-VGKKKDQYYIDNKMVPRAEVVNLMESAGFSRSNPYYIVKQGKINELATSPDAYKLKLLREVAGTRVYDERKEESLKIL--KETKMK 186          

HSP 2 Score: 69.707 bits (169), Expect = 1.405e-11
Identity = 46/169 (27.22%), Postives = 91/169 (53.85%), Query Frame = 1
Query: 3115 LQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT--------PPEGKS---LSDGLEFKIAF----GNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++ ++  L+  K E I    +QV ++F+++F  L+P  + ++           EG +   L +G+   ++F    G+     + +LSGGQ+SLVAL++I ++ +  PAP Y+ DE+DAALD  H +++  +I+     +QF+  + +  +   A   +  +F + VS +
Sbjct: 1074 IEELLKVLENRKYEAIDLTFKQVKKNFEQVFKQLVPHGRGKMQMRAREQRDDEEGINSVELYEGISVLVSFVSDDGDSETREMTQLSGGQKSLVALAIIFSIQKCDPAPFYLFDEIDAALDAQHRKSVADMIQSLSDQAQFVTTTFRPELLATAEKFYGVRFRNKVSHI 1242          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-4 (Structural maintenance of chromosomes protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q20060])

HSP 1 Score: 95.1301 bits (235), Expect = 2.621e-19
Identity = 52/155 (33.55%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQF--DEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKP 537
            + +D FKSY  +  I  F  +F +I G NGSGKSN++D++ F+ G    S++R++ +  L++K      +K TV I F        P  YE     E TI+R       + Y I+G  A  N V+   R V +++ +  FLI+QG + ++  MKP
Sbjct:   95 VEVDNFKSYFGKASIGPFHKSFTSIIGPNGSGKSNLIDSLLFVFGF-RASKIRSAKVSNLIHKSAGRNPDKCTVTIHFQRI--VDIPGHYEVVKDSEFTISRTAFQNNSSSYAIDGRPATKNEVEARLRRVDIDIEHNRFLILQGEVEQIAMMKP 246          

HSP 2 Score: 80.1073 bits (196), Expect = 8.919e-15
Identity = 141/609 (23.15%), Postives = 279/609 (45.81%), Query Frame = 1
Query: 1948 GFLIARTLDMAKTVAFDERIKCRCVTFD-GEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLR--AKSFELRQ-----LE--RNMMDDQYLNIKAKYDETESELK------------EITEAIRENEKLYRKACEETK--------LAK--ENLANSASIKEKAQKEAESEYKKAQD--QLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRV-LQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRIST------HRKDSEDAERK---IGKLLSTNRW---------IPDESKHFNQSGG-------------IYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT-PPEGKSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVS 3570
            G ++     MAK V  +++   R +    G++ D    L G E E+D ++ E  R++  M N +  +    +  A     ++      ++ +A+++  AK+ E +Q     LE  R+ + ++   +KA+  E +S+L             E  E++++ +KL +   +ET         +AK  EN++      EK +K+ E   +KA D  ++K  +E  +  E Q + L  +  +  ++Q +L     AAE  +  ++  C   SE I   KESM A        +R+ +++IEK+++  K + +   + + +S+ R  D+  +I          +  E+ ER+   +  ++S   +         + + ++ +    G             I + +++D +E + K++  E +   L  KVD+  +       ++Y++ + K        +     +  + +++ E    A E + +    +F  L  G  A+L    +      G+ F +      WK+ +  LSGG+++L +L+LI AL  F+P P Y++DE+DAALD  +   I   ++++  N+QFII+SL++ MF  AN L     VDG +
Sbjct:  768 GLILTDKNKMAKQVTPEDKAAERDLAEKLGKLRDEADELKGQEHEMDGQLIEARRKVAEMSNRLSIVTSSVQSAAPAIETLKKTIANQEKEAAKVKVDAKTLEDKQKIVEELEKKRDELGEEAAKVKARQAEIQSKLDGIFKELVQCHRDEAKESLQKRQKLEKDIAKETANISNSGRNIAKCDENISRHDKDIEKMKKKCEELMEKAIDDEEVKSKKETVERFEKQIKKLQTKGEEMTKKQSEL----SAAETKLEGELKKC---SEGIKELKESMLA--------DRLKVEDIEKKLAALKVNRIPRFQFLIESS-RPEDLEMQIDDKMPVVDENQSPEEVERQKKHMACVMSDAAYALEFEMRQKVLENTESYENVDGEDRVPVELLSDEKINEISSRDAEEMQMKLKVCEQQVEALKAKVDISSIKAYVDKVKQYNEQVIKLTIATEVHRKHNQELQRIKQMRLEEFHSAFEFIGKHLVAVFKMLTDGGDAKLEYIDKDDPFRQGISFMVRPAKKAWKQ-IQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQKTENAQFIIISLRNNMFELANRLVGIYKVDGCT 1359          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Match: smc-4 (Structural maintenance of chromosomes protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q20060])

HSP 1 Score: 95.1301 bits (235), Expect = 2.621e-19
Identity = 52/155 (33.55%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQF--DEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKP 537
            + +D FKSY  +  I  F  +F +I G NGSGKSN++D++ F+ G    S++R++ +  L++K      +K TV I F        P  YE     E TI+R       + Y I+G  A  N V+   R V +++ +  FLI+QG + ++  MKP
Sbjct:   95 VEVDNFKSYFGKASIGPFHKSFTSIIGPNGSGKSNLIDSLLFVFGF-RASKIRSAKVSNLIHKSAGRNPDKCTVTIHFQRI--VDIPGHYEVVKDSEFTISRTAFQNNSSSYAIDGRPATKNEVEARLRRVDIDIEHNRFLILQGEVEQIAMMKP 246          

HSP 2 Score: 80.1073 bits (196), Expect = 8.919e-15
Identity = 141/609 (23.15%), Postives = 279/609 (45.81%), Query Frame = 1
Query: 1948 GFLIARTLDMAKTVAFDERIKCRCVTFD-GEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLR--AKSFELRQ-----LE--RNMMDDQYLNIKAKYDETESELK------------EITEAIRENEKLYRKACEETK--------LAK--ENLANSASIKEKAQKEAESEYKKAQD--QLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRV-LQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRIST------HRKDSEDAERK---IGKLLSTNRW---------IPDESKHFNQSGG-------------IYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT-PPEGKSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVS 3570
            G ++     MAK V  +++   R +    G++ D    L G E E+D ++ E  R++  M N +  +    +  A     ++      ++ +A+++  AK+ E +Q     LE  R+ + ++   +KA+  E +S+L             E  E++++ +KL +   +ET         +AK  EN++      EK +K+ E   +KA D  ++K  +E  +  E Q + L  +  +  ++Q +L     AAE  +  ++  C   SE I   KESM A        +R+ +++IEK+++  K + +   + + +S+ R  D+  +I          +  E+ ER+   +  ++S   +         + + ++ +    G             I + +++D +E + K++  E +   L  KVD+  +       ++Y++ + K        +     +  + +++ E    A E + +    +F  L  G  A+L    +      G+ F +      WK+ +  LSGG+++L +L+LI AL  F+P P Y++DE+DAALD  +   I   ++++  N+QFII+SL++ MF  AN L     VDG +
Sbjct:  768 GLILTDKNKMAKQVTPEDKAAERDLAEKLGKLRDEADELKGQEHEMDGQLIEARRKVAEMSNRLSIVTSSVQSAAPAIETLKKTIANQEKEAAKVKVDAKTLEDKQKIVEELEKKRDELGEEAAKVKARQAEIQSKLDGIFKELVQCHRDEAKESLQKRQKLEKDIAKETANISNSGRNIAKCDENISRHDKDIEKMKKKCEELMEKAIDDEEVKSKKETVERFEKQIKKLQTKGEEMTKKQSEL----SAAETKLEGELKKC---SEGIKELKESMLA--------DRLKVEDIEKKLAALKVNRIPRFQFLIESS-RPEDLEMQIDDKMPVVDENQSPEEVERQKKHMACVMSDAAYALEFEMRQKVLENTESYENVDGEDRVPVELLSDEKINEISSRDAEEMQMKLKVCEQQVEALKAKVDISSIKAYVDKVKQYNEQVIKLTIATEVHRKHNQELQRIKQMRLEEFHSAFEFIGKHLVAVFKMLTDGGDAKLEYIDKDDPFRQGISFMVRPAKKAWKQ-IQFLSGGEKTLSSLALIFALHMFRPTPFYVMDEIDAALDYRNVSIIAQYVRQKTENAQFIIISLRNNMFELANRLVGIYKVDGCT 1359          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC2 (gene:FBgn0027783 transcript:FBtr0087461)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 440/1197 (36.76%), Postives = 731/1197 (61.07%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQK-QKQLATEIEQLKANVNAINYSQPEWE---QAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSF-------ELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAK-------ENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTD-------NEQEQQQLLANIEAAEKVVTN-KIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVN 3591
            +V+DGFKSY +RTEI GFDP F AITGLNGSGKSNILD+ICF+LGI+NL  VRAS LQ+LVYK GQAGI KATV I+FDN+  +  P GYE+  EI++TRQ+VVGGKNK+LING +  N +VQD F S+QLNVNNP+FLIMQG+I +VLNMKP+E+LS++EEAA T  Y++KRD T   IEKK++K++E   +L EE+ PKL KL+ ERS+Y EYQKI RD+++L +  ++ +Y      +   +   +++++++   + T  KN  +  + EN+++++ ++ D      ++N++T+ +  +  EA    ++K A+  +++ ++ ++   K +++D  +  + +  +AK+QG+F+ LKE   +  + Y+ A ++L  V+ G   ++   A+ +L E L  A +  S+   T+ T  + L HT+ +L Q   + G+T  +D +   ++K   QL  EI+ L+  + +++Y    +E   Q ++D      DL+R L DR    R    Y+L Y  P P+FD R++ G+V  L  + D Q S++L    GG L++ + D D  + ++ ++  L  R T +P+NK+    +   VV  A+  +G ENV  A+ +I YD+ YE  + F FGG LI + L +AK +++D RI CR VT +G+V DP G++ GG       + E   EL    ++I  +++  +E      Q+E        AS + +A +F       +LRQ E  M +++    +  + + ++E++E+ E ++  E+    + E+ K ++         LA++   +E+    A +E K  + + +     +K  E ++E L LE T+        +++ Q+++ N+E  +  +   K++S   +SE +   ++++   K +L +QN+   E+  Q+ + K+ +L+  + I+    +  +   +IS+   D+++A++++  L +   WIP+E   F      YD++ +D  E   K+ K++++K K+ R +++  + VL + EE + +   +   V  DK+ ++ +I ++D+ + + + KA  +V+ +F  IFS+LLPG++A+L P        GLE K+ F  +WKESL ELSGGQ+SLVALSL+LA+L+F PAPLYILDEVDAALD+SHTQNIG+++K+ F NSQF+IVSLKDG+FN+ANVLF+T F +GVST++R V+
Sbjct:    6 LVLDGFKSYGRRTEIEGFDPEFTAITGLNGSGKSNILDSICFVLGISNLQNVRASALQDLVYKNGQAGITKATVTIVFDNTNPAQCPQGYEKCREISVTRQVVVGGKNKFLINGKLVQNKKVQDFFCSIQLNVNNPNFLIMQGKIQQVLNMKPKEVLSMVEEAAGTSQYKTKRDATKTLIEKKETKVRETKVLLDEEVLPKLVKLRQERSAYQEYQKICRDIDFLIRIHISAKYLKQCETLKTVEANEHKIEDRIANCKATHAKNLAEVESIENSVKEMQQQIDAEMGGSIKNLETQLSAKRALEATATGSLKAAQGTIQQDEKKIRMASKNIEDDERALAKKEADMAKVQGEFESLKEADARDSKAYEDAQKKLEAVSQGLSTNENGEAS-TLQEQLIVAKEQFSEAQTTIKTSEIELRHTRGVLKQ---REGETQTNDAAYVKDKKLHDQLVVEIKNLERQLQSLDYEGGHFEKLKQRRNDLHMRKRDLKREL-DRCNASR----YDLQYQDPEPNFDRRKVRGLVGKLFQVKDMQNSMALVQTAGGSLYSYVTDDDVTSKKILQRGNLQRRVTLIPINKIQSGSLNRNVVEYAQNKVGAENVQWAMSLIDYDRYYEPVMKFCFGGTLICKDLIVAKQISYDPRINCRSVTLEGDVVDPHGTVSGGAAPKGANVLE---EL----HAIKQIEKEYREIDSEIAQVEKQI-----ASIENQALAFNKMKENLDLRQHELTMCENRL--AQTTFQQNQAEIEEMRERVKTLEQQIIDSREKQKTSQAKIVDIEAKLADAKGYRERELNAATNEIKVTKQRAEKSRANWKKREQEFETLQLEITELQKSIETAKKQHQEMIDNLEKFKAELDALKVNSSSAASE-VTELEQAIKEQKDKLRDQNK---EMRNQLVK-KEKMLKENQEIELEVKKKENEQKKISS---DAKEAKKRMEALEAKYPWIPEEKNCFGMKNTRYDYSKEDPHEAGNKLAKMQEKKDKMERTLNMNAIMVLDREEENFKETERRRNIVAMDKEKIKKIIVKMDEEEQDQLNKAATEVNTNFSGIFSSLLPGAEAKLNPVHTNGCLTGLEIKVGFNGIWKESLGELSGGQKSLVALSLVLAMLKFSPAPLYILDEVDAALDMSHTQNIGSMLKQHFTNSQFLIVSLKDGLFNHANVLFRTLFEEGVSTITRQVS 1171          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC3 (gene:FBgn0015615 transcript:FBtr0074290)

HSP 1 Score: 118.627 bits (296), Expect = 1.952e-26
Identity = 169/686 (24.64%), Postives = 306/686 (44.61%), Query Frame = 1
Query: 1672 DPQFSLSLQVGGGGRLFNVIIDHDSVAAELFE---KNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLD----MAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAK--YDETESELKEITEAIRENEKLYRKACEETKLA--KENLANSASIKEKAQKEAESEYKK---AQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSC------RVSSEKIIGHKE-SMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGK------LLST-----NRWIPDESKHFNQSGGIY----DFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPP----EGKSL------SD---GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            D     +++V    RLF+ I++ +    ++ +   K  LP   TF+PLN++  K I D+            +    +  ++YD++++ A+ ++FG  LI R L+    +AK+   D      CVT DG+    +GSL GG        F  SR  L M          QK+  +  +QI +  K+  +   +L++    +  +   M   +    K+K  +++ + E++ + E +   E+ YR A +E  LA  K +L +  S K   + E + E      +QDQ ++D+            LN +     QE ++        E V  NK+D+       R   E I   +E S+   K++L+N    L   EK+I +    + E  K + ++     ++   + TH +  ++AE  + K        ST     N  I + ++     G +      +T    K   +++EK     +K +  V+ + ++      E+   L  + +++    Q +  +I  L+  K E I+    QV ++F K+F  L+P     L       EG  +      SD   G+  +++F  V  E   +N+LSGGQ+SLVAL+LI ++ +  PAP Y+ DE+D ALD  H + +  +I E    +QFI  + +  +  NA+  +  +F + VS +
Sbjct:  544 DKTIYTAVEVTAANRLFHHIVESEYEGTQILKEMNKLKLPGEVTFMPLNRLQVK-IHDYP--------DDPDSIPMISKLKYDEQHDKALRYIFGKTLICRNLERATELAKSTGLD------CVTLDGDQVSSKGSLTGG-------YFNTSRSRLEM----------QKKRTEYTSQIAEFEKKLSKLRNELKSTENNINSIVSEMQKTETKQGKSKDVFEKVQGEIRLMKEELVRIEQ-YR-APKERSLAQCKASLESMTSTKSSLEAELKQELMSTLSSQDQREIDQ------------LNDDIRRLNQENKEAFTQRMQFE-VRKNKLDNLLINNLFRRRDELIQALQEISVEDRKRKLNNCKTELVSAEKRIKKVNSDLEEIEKRVMEAVQLQKELQQELETHVRKEKEAEENLNKDSKQLEKWSTKENMLNEKIDECTEKIASLGAVPLVDPSYTRMSLKNIFKELEKANQHLKKYNH-VNKKALDQFLSFSEQKEKLYRRKEELDIGDQKIHMLIQSLEMQKVEAIQFTFRQVAQNFTKVFKKLVPMGAGFLILKTKDNEGDEMEKEVENSDAFTGIGIRVSFTGVEAEMREMNQLSGGQKSLVALALIFSIQKCDPAPFYLFDEIDQALDAMHRKAVANMIHELSDTAQFITTTFRPELLENAHKFYGVRFRNKVSHI 1181          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: SMC1 (gene:FBgn0040283 transcript:FBtr0084541)

HSP 1 Score: 72.7886 bits (177), Expect = 2.153e-12
Identity = 48/168 (28.57%), Postives = 80/168 (47.62%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY--KCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT 576
            I ++ FKSY     + G    FNA+ G NGSGKSN +DAI F++G    S +R   L +L++    G+       V   F  +E+                ++ V+GG ++Y ING    ++   +    + +NV   +FL+ QG +  +    P+E  +L EE + +
Sbjct:   30 IEMENFKSYRGHI-VVGPLKQFNAVIGPNGSGKSNFMDAISFVMG-EKTSSLRVKRLNDLIHGSSIGKPVSRSCYVTAKFVLNEERHMDF-----------QRAVIGGSSEYRINGESVSSSTYLNKLEKIGINVKAKNFLVFQGAVENIAMKTPKERTALFEEISGS 184          

HSP 2 Score: 67.3958 bits (163), Expect = 8.213e-11
Identity = 43/133 (32.33%), Postives = 73/133 (54.89%), Query Frame = 1
Query: 3193 FDKIFSTLL--PGSQARLTP--PEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVS 3579
             D I+  L     +QA + P  PE   L DG+ +         + +N LSGG++++ AL+L+ +   F PAP ++LDE+DAALD ++   + + I++   N Q I++SLK+  + +A+ L      +G   VS
Sbjct: 1094 IDGIYKKLARNEAAQAYIGPDNPEEPYL-DGINYNCVAPGKRFQPMNNLSGGEKTIAALALLFSTHSFHPAPFFVLDEIDAALDNTNIGKVASYIRDHTTNLQTIVISLKEEFYGHADALVGITPGEGDCLVS 1225          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Match: glu (gene:FBgn0015391 transcript:FBtr0080935)

HSP 1 Score: 71.2478 bits (173), Expect = 5.578e-12
Identity = 50/178 (28.09%), Postives = 81/178 (45.51%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQ-AGINKATVCIIFDN-SEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPR-------EILSLLEEAANTKHY 585
            IV   FKSYA   E+  F  +F AI G NGSGKSN++D++ F+ G    +++R   +  L++       +   +V + F    +K            I I R  +    + Y IN   A    V  L +   +++ +  FLI+QG +  +  MKP+        +L  LE+   T+ Y
Sbjct:   92 IVNRNFKSYAGEVELGPFHQSFTAIIGPNGSGKSNVIDSMMFVFGC-RANRIRCKRVSTLIHSSSSYPNLRSCSVAVHFKQIVDKGDGTCEDVPDSSIVIERTAMSDNSSYYQINDKRAQLKDVAKLLKKHHVDLEHNRFLILQGEVESIAMMKPKGQTENETGMLEYLEDIVGTQRY 268          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 481/1180 (40.76%), Postives = 740/1180 (62.71%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATE-IEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNT 3594
            SIV++GFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRA+NLQ+LVYK G AGI KATV I FDNS K  SP+G+E  DEITITRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKKD+KLKEI  IL EEI P +EKLK ER+SYLEYQK++R++E+L++  VAY +   +     ++ E   +++ + + +E +K+NE +       I++L   RDK     L+ ++   +E Q+ +   ++A+   +  +K+  +  K+L K M+ED +     +  +AK   +   +KE+ +K  +  ++A Q    V++G     ++N  G+ A L  + +  ++D++          ++L H Q    +L +K  Q  K D+  + +Q   +   + IE+L+A +  +NY     E     +     ++ ++    ++ + + P+    Y  P  +++  ++ G+VANL ++ D   + +L+V  GGRL+NV++D++    +L EK  L  R T +PLNK+S + + D VVR AK+++G +NV +AL ++ Y+     A+ +VFG  L+  +LD AK VAFD+ +  + VT  G+VFDP+G+L GG +     +  +  E+  + +S+ + +          + ++   +++ +   QL  K+ E R LE  +    +   + + +     ++E  + +++ +++ +KA E+  + +  + N+A+ +EK  K A+ +  +A+ +     +  K+ + + + + LE  + ++EQ   +Q +  ++ A K V  +ID+    + ++  +KE++   +++L  Q  V+   E++I           +  + + L++ ++ H IS H+KDS DA  K+ ++L+ N WI  E   F Q    YDF   + KE  Q++++LE+ K KL R V+ R MN+L + EERY+DL  K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ ARL PPEG  + DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQF++VSLKDGMF NANVLFKTKFVDG+STV+R   T
Sbjct:    5 SIVLEGFKSYAERTEINGFDPFFNAITGLNGSGKSNILDSICFLLGISNLSQVRATNLQDLVYKNGLAGITKATVSITFDNSNKKQSPLGFETHDEITITRQVVIGGRNKYLINGVNANNLRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKISAQKTIEKKDAKLKEIQTILDEEITPAMEKLKEERASYLEYQKLMREIEHLSRLYVAYLFVCAEETKLKSNEELQEMQSSIAKLQENMKQNEAKVKELSAEIQELERRRDKEVGGVLRTLEETLSEAQRVDTKAQSALDLKKQNLKDETKKRKELVKNMEEDKKVMSAKEAEVAKAVERLKAVKEEGQKDAEALEAAQQHFKAVSAGL----SANEDGAEATLSGQMMTCKNDISKAETEAKQAQMKLKHAQ---QELKTKQAQVKKMDSGYKKDQDTFEAVNKCIEKLQAEMKKLNYEDGREECLLEQKRQFSREVIQLREAYESLMGQFPNLRFEYTDPERNWERSKVKGLVANLFTVTDVSNATALEVVAGGRLYNVVVDNEVTGKKLLEKGELRRRYTIIPLNKISARTLNDNVVRTAKKLVGPDNVHTALSLVGYESELRKAMEYVFGTTLVCDSLDNAKKVAFDKGVSTKTVTLGGDVFDPQGTLTGGARAQTASVLSKLAEVKDIQDSLRNKEAELSAVESELSGLKGTAEKYRQLKQQLDLKTEEARILETKLQQSSFHKQQEELENLRKTIEECEDTLQKTKEVQKKAEEKYNVLENKMKNAAAEREKELKAAQQKLNQAKSKADAFSKRLKEKQQEADAVALELEELKREQAGYEQQIQAVDEALKAVQEQIDNM---TTEVSANKEAVRVAQEKLSQQKEVIMGQEREIKGKSGEANRLREQNNDAQLKIKELEHNISKHKKDSADATAKVARMLAENDWISSEKHLFGQPNTAYDFKTNNPKEAGQRLKRLEETKDKLERNVNRRAMNMLSEAEERYNDLKKKKRIVENDKAKILETIEELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEGCGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGISTVTRTAQT 1174          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 806.209 bits (2081), Expect = 0.000e+0
Identity = 481/1180 (40.76%), Postives = 740/1180 (62.71%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATE-IEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNT 3594
            SIV++GFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRA+NLQ+LVYK G AGI KATV I FDNS K  SP+G+E  DEITITRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKKD+KLKEI  IL EEI P +EKLK ER+SYLEYQK++R++E+L++  VAY +   +     ++ E   +++ + + +E +K+NE +       I++L   RDK     L+ ++   +E Q+ +   ++A+   +  +K+  +  K+L K M+ED +     +  +AK   +   +KE+ +K  +  ++A Q    V++G     ++N  G+ A L  + +  ++D++          ++L H Q    +L +K  Q  K D+  + +Q   +   + IE+L+A +  +NY     E     +     ++ ++    ++ + + P+    Y  P  +++  ++ G+VANL ++ D   + +L+V  GGRL+NV++D++    +L EK  L  R T +PLNK+S + + D VVR AK+++G +NV +AL ++ Y+     A+ +VFG  L+  +LD AK VAFD+ +  + VT  G+VFDP+G+L GG +     +  +  E+  + +S+ + +          + ++   +++ +   QL  K+ E R LE  +    +   + + +     ++E  + +++ +++ +KA E+  + +  + N+A+ +EK  K A+ +  +A+ +     +  K+ + + + + LE  + ++EQ   +Q +  ++ A K V  +ID+    + ++  +KE++   +++L  Q  V+   E++I           +  + + L++ ++ H IS H+KDS DA  K+ ++L+ N WI  E   F Q    YDF   + KE  Q++++LE+ K KL R V+ R MN+L + EERY+DL  K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ ARL PPEG  + DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQF++VSLKDGMF NANVLFKTKFVDG+STV+R   T
Sbjct:    5 SIVLEGFKSYAERTEINGFDPFFNAITGLNGSGKSNILDSICFLLGISNLSQVRATNLQDLVYKNGLAGITKATVSITFDNSNKKQSPLGFETHDEITITRQVVIGGRNKYLINGVNANNLRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKISAQKTIEKKDAKLKEIQTILDEEITPAMEKLKEERASYLEYQKLMREIEHLSRLYVAYLFVCAEETKLKSNEELQEMQSSIAKLQENMKQNEAKVKELSAEIQELERRRDKEVGGVLRTLEETLSEAQRVDTKAQSALDLKKQNLKDETKKRKELVKNMEEDKKVMSAKEAEVAKAVERLKAVKEEGQKDAEALEAAQQHFKAVSAGL----SANEDGAEATLSGQMMTCKNDISKAETEAKQAQMKLKHAQ---QELKTKQAQVKKMDSGYKKDQDTFEAVNKCIEKLQAEMKKLNYEDGREECLLEQKRQFSREVIQLREAYESLMGQFPNLRFEYTDPERNWERSKVKGLVANLFTVTDVSNATALEVVAGGRLYNVVVDNEVTGKKLLEKGELRRRYTIIPLNKISARTLNDNVVRTAKKLVGPDNVHTALSLVGYESELRKAMEYVFGTTLVCDSLDNAKKVAFDKGVSTKTVTLGGDVFDPQGTLTGGARAQTASVLSKLAEVKDIQDSLRNKEAELSAVESELSGLKGTAEKYRQLKQQLDLKTEEARILETKLQQSSFHKQQEELENLRKTIEECEDTLQKTKEVQKKAEEKYNVLENKMKNAAAEREKELKAAQQKLNQAKSKADAFSKRLKEKQQEADAVALELEELKREQAGYEQQIQAVDEALKAVQEQIDNM---TTEVSANKEAVRVAQEKLSQQKEVIMGQEREIKGKSGEANRLREQNNDAQLKIKELEHNISKHKKDSADATAKVARMLAENDWISSEKHLFGQPNTAYDFKTNNPKEAGQRLKRLEETKDKLERNVNRRAMNMLSEAEERYNDLKKKKRIVENDKAKILETIEELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEGCGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGISTVTRTAQT 1174          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc4 (structural maintenance of chromosomes 4 [Source:ZFIN;Acc:ZDB-GENE-020419-21])

HSP 1 Score: 84.3445 bits (207), Expect = 7.126e-16
Identity = 207/929 (22.28%), Postives = 381/929 (41.01%), Query Frame = 1
Query: 1033 VKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNS-----GFFQSKTSNATGSLAELLAEAVK----------------------VESDVNITLNTLNLRLVHTQSLLNQL---ASKLGQTNKS--DNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLP--DPQFSLSLQVGGGGRLFNVIIDHDSVAAEL--FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENA--DRFTQIEDNRKRHDEASAQLRAKSFELRQLERNM---------MDDQYLNIKAKYDETESEL------KEITEAIRENEKLYRKACE-----------ETKLAKENLANSASIKEKAQK-----------EAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQ------------EQQ--QLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEG-KSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLF 3543
            ++  KE   +L  Q  E  E  K TK    K+Q Q  K +EKLE+ +    S+++ +   ++        +         + E L E  K                        S +++  + L++ L    + +NQL    S L +T  +  +    ++  Q ++  + EQLK +   +     + +Q +    A   D+R+ + + ++ +  N S   V +       S +I G++  L  L   D ++ +++     G L N+++D    A +   F K       TF+ L+KM          +    I   EN+    ++++  D+    A  F     L+A+ L+ A  VAF +  + R VT  G++ +  G++ GG      R+  + R   ++   +   Q  + E+A     TQ++D +KR ++   ++     ELR ++  +         + +Q L++K +  + E+ +      K   + + ++ + YRK  E           E K     + +  S K KAQ+           +  S   KAQ  +K      K  E     L  E ++NE+            E+Q  +++ + + AE+ +    D  R   ++I   +E   A +KE  +    ++ I+  I++C + +    K   +  L           H  D   AE    +L + N   PD+         + D  N D    K +I  LED  R  + K +L  +    + EE Y   + +   +   +   +   ++L K +          +     + +  L  G  A L   +     S+G+ F +      WK+  N LSGG+++L +L+L+ AL  FKP PLY +DE+DAALD  +   +   I EQ  N+QFII+SL++ MF  A+ L 
Sbjct:  382 IESQKEKFTQLDLQDVEVREKLKHTKSKTKKLQKQLQKDQEKLEEVRGVPASSEKIITEASAQKEELEKKKLLEEQKLAEVMESLKEETKGLQEDKEKKEKELLELSKSVNETRSRMDVAQSELDIYLSQHNTAINQLNQAKSALQETVDTLRERRAAIKDLQVKIPAQEEQLKKDERELEQISEQDKQTR----AQVGDMRQKVAEAKSSLSSNRSRSKVLDTLMQQKRSGKIPGILGRLGDLGAIDEKYDVAIS-SSCGSLDNILVDTIDTAQKCVTFLKAQNIGVATFIGLDKMKVWQ------QSMGSISTPENIPRLFDMVRVKDESVRPAFYFALRDTLVAKDLEQATRVAFQKDKRWRVVTLQGQIIEQAGTMTGG----GGRVM-KGRMGSSVCADVTQEQLDKMESALNKEVTQLQDCQKRKNQLEEKVHKARCELRDMKNTLEKYTATIQSLTEQELHLKPQIKDLEANVIAAAPDKAKQKQMEKSLEAYRKDFEAASNKAGKVEAEVKRLHTLIVDINSHKLKAQQDKLDQINTQLDQCSSAVTKAQVAIKTAGRNLKKSEDGVSRLEQEISENEKLMEELTEQLKKLEEQAGEIMQSYQQAEEALPEVQDQHRAVVQEIKALQEQEHALQKESLSVRLKVEHIDTAITECHNKIKHWQKEASKLCL-----------HHIDGVPAE----ELPALN---PDQ---------LQDIGNPDV--IKNEIALLED--RCANMKPNLGAIAEFKKKEELYLQRVAELDDITTQRDSFKRGCEDLRKQRLHEFMAGFNIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIYN-LSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEMADRLI 1262          

HSP 2 Score: 69.707 bits (169), Expect = 2.550e-11
Identity = 49/159 (30.82%), Postives = 74/159 (46.54%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKC-GQAGINKATVCI----IFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPR 540
            IV   FKSYA    +  F   F+ I G NGSGKSN++D++ F+ G     ++R+  L  L++   G   I   TV +    I D        I    F    + R       + Y IN   A    V  L RS  +++++  FLI+QG + ++  MKP+
Sbjct:   86 IVNRNFKSYAGEQILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY-RAQKIRSKKLSVLIHSSDGHPDIQSCTVEVHFQKIIDKEGDDYDVIPDSSF---YVARTAGKDNSSAYYINTKKATFKDVGTLLRSHGIDLDHNRFLILQGEVEQIAMMKPK 240          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1a (structural maintenance of chromosomes 1A [Source:ZFIN;Acc:ZDB-GENE-090506-9])

HSP 1 Score: 79.337 bits (194), Expect = 2.380e-14
Identity = 57/189 (30.16%), Postives = 94/189 (49.74%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY--KCGQAGINKATVCIIF--DNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT----KHYESKRDDTLKTIE 621
            I I+ FKSY  R  I  F   F AI G NGSGKSN++DAI F+L     S +R   L++L++    G+   N+A V +++  DN E            E T TR I +G  ++Y IN  +   +   +    + + +   +FL+ QG +  +    P+E  +L EE + +    + Y+ ++ + +K  E
Sbjct:    7 IEIENFKSYKGRQIIGPFH-KFTAIIGPNGSGKSNLMDAISFVLA-EKTSNLRVKTLKDLIHGAPVGKPAANRAFVSMVYCEDNGE------------ECTFTRAI-IGSSSEYRINSKVVGLSDYSEELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEE 180          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Match: smc1al (structural maintenance of chromosomes 1A, like [Source:ZFIN;Acc:ZDB-GENE-040426-57])

HSP 1 Score: 75.8702 bits (185), Expect = 2.597e-13
Identity = 49/168 (29.17%), Postives = 86/168 (51.19%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY--KCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT 576
            I I+ FKSY  R +I G    F AI G NGSGKSN++DAI F+L     S +R   L++L++    G+   N+A V +++            +   E++ +R I++G  ++Y IN  +   +   +    + + +   +FL+ QG +  +    P+E  +L EE + +
Sbjct:    7 IEIENFKSYKGR-QIIGPFHKFTAIIGPNGSGKSNLMDAISFVLA-EKTSNLRVKTLKDLIHGAPVGKPAANRAFVTMVYQQ----------DGGQELSFSR-IIIGSSSEYRINNKVVGLSDYSEELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRS 161          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cnih1 (cornichon family AMPA receptor auxiliary protein 1 [Source:Xenbase;Acc:XB-GENE-1004741])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 491/1179 (41.65%), Postives = 733/1179 (62.17%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLAS---KLGQTNKSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGK---NIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  +AY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   AE Q+ +  +++A+   +  +K  ++  K+L K M+EDA++    +  + KI      L+E  +K  +    A Q    V++G     +SN  G  A L  + +  +++++          ++L H Q  L    +   K+    K DN   E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD +I  + VT  G+ FDP+G+L GG +  +  +  + +EL  +   + + + + +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++   E +++ +++  KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + +   LE  + ++EQ      IE  ++ +    +     + ++  +KES+   ++EL  Q  ++   +K+I   K    E GK   N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q+++KL+++K KL R V++R MN+L Q EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYIAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIGELEKLRDQEVGGALRSLEEALAEAQRSDTKVQSALDLKKQNMKAEEKKRKELVKSMEEDAKALTAKEKEVKKITDSLSSLQETSQKDAEALTGAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNEISKAETEAKQAQMKLKHAQQELKTKQAEVKKMDSGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSSRVKGLVASLISVKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVHLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDRKIMTKTVTLGGDTFDPQGTLSGGARSQNASVLAKLQELKHVQEELRAKETQLQEVEKELMSLKNTVERYRQLKQQWEMKSEEADLLQTKLQQSSYHKQQEELDTLKQTIEGSEETLKKTKEVQMKAEEKFKVLEHKMKNAEAERERELKEAQQKLDGAKKKADASNKKMKEKQQEVDAFVLELEELKREQTTYKQQIEVVDEAMKAYQEQADNMASEVAKNKESVKKAQEELAKQKEIIMGHDKEI---KTKSAEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLQKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKKKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cnih1 (cornichon family AMPA receptor auxiliary protein 1 [Source:Xenbase;Acc:XB-GENE-1004741])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 491/1179 (41.65%), Postives = 733/1179 (62.17%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLAS---KLGQTNKSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGK---NIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  +AY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   AE Q+ +  +++A+   +  +K  ++  K+L K M+EDA++    +  + KI      L+E  +K  +    A Q    V++G     +SN  G  A L  + +  +++++          ++L H Q  L    +   K+    K DN   E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD +I  + VT  G+ FDP+G+L GG +  +  +  + +EL  +   + + + + +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++   E +++ +++  KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + +   LE  + ++EQ      IE  ++ +    +     + ++  +KES+   ++EL  Q  ++   +K+I   K    E GK   N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q+++KL+++K KL R V++R MN+L Q EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYIAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIGELEKLRDQEVGGALRSLEEALAEAQRSDTKVQSALDLKKQNMKAEEKKRKELVKSMEEDAKALTAKEKEVKKITDSLSSLQETSQKDAEALTGAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNEISKAETEAKQAQMKLKHAQQELKTKQAEVKKMDSGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSSRVKGLVASLISVKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVHLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDRKIMTKTVTLGGDTFDPQGTLSGGARSQNASVLAKLQELKHVQEELRAKETQLQEVEKELMSLKNTVERYRQLKQQWEMKSEEADLLQTKLQQSSYHKQQEELDTLKQTIEGSEETLKKTKEVQMKAEEKFKVLEHKMKNAEAERERELKEAQQKLDGAKKKADASNKKMKEKQQEVDAFVLELEELKREQTTYKQQIEVVDEAMKAYQEQADNMASEVAKNKESVKKAQEELAKQKEIIMGHDKEI---KTKSAEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLQKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKKKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cnih1 (cornichon family AMPA receptor auxiliary protein 1 [Source:Xenbase;Acc:XB-GENE-1004741])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 491/1179 (41.65%), Postives = 733/1179 (62.17%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLAS---KLGQTNKSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGK---NIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  +AY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   AE Q+ +  +++A+   +  +K  ++  K+L K M+EDA++    +  + KI      L+E  +K  +    A Q    V++G     +SN  G  A L  + +  +++++          ++L H Q  L    +   K+    K DN   E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD +I  + VT  G+ FDP+G+L GG +  +  +  + +EL  +   + + + + +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++   E +++ +++  KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + +   LE  + ++EQ      IE  ++ +    +     + ++  +KES+   ++EL  Q  ++   +K+I   K    E GK   N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q+++KL+++K KL R V++R MN+L Q EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYIAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIGELEKLRDQEVGGALRSLEEALAEAQRSDTKVQSALDLKKQNMKAEEKKRKELVKSMEEDAKALTAKEKEVKKITDSLSSLQETSQKDAEALTGAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNEISKAETEAKQAQMKLKHAQQELKTKQAEVKKMDSGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSSRVKGLVASLISVKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVHLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDRKIMTKTVTLGGDTFDPQGTLSGGARSQNASVLAKLQELKHVQEELRAKETQLQEVEKELMSLKNTVERYRQLKQQWEMKSEEADLLQTKLQQSSYHKQQEELDTLKQTIEGSEETLKKTKEVQMKAEEKFKVLEHKMKNAEAERERELKEAQQKLDGAKKKADASNKKMKEKQQEVDAFVLELEELKREQTTYKQQIEVVDEAMKAYQEQADNMASEVAKNKESVKKAQEELAKQKEIIMGHDKEI---KTKSAEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLQKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKKKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cnih1 (cornichon family AMPA receptor auxiliary protein 1 [Source:Xenbase;Acc:XB-GENE-1004741])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 491/1179 (41.65%), Postives = 733/1179 (62.17%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLAS---KLGQTNKSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGK---NIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  +AY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   AE Q+ +  +++A+   +  +K  ++  K+L K M+EDA++    +  + KI      L+E  +K  +    A Q    V++G     +SN  G  A L  + +  +++++          ++L H Q  L    +   K+    K DN   E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD +I  + VT  G+ FDP+G+L GG +  +  +  + +EL  +   + + + + +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++   E +++ +++  KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + +   LE  + ++EQ      IE  ++ +    +     + ++  +KES+   ++EL  Q  ++   +K+I   K    E GK   N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q+++KL+++K KL R V++R MN+L Q EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYIAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIGELEKLRDQEVGGALRSLEEALAEAQRSDTKVQSALDLKKQNMKAEEKKRKELVKSMEEDAKALTAKEKEVKKITDSLSSLQETSQKDAEALTGAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNEISKAETEAKQAQMKLKHAQQELKTKQAEVKKMDSGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSSRVKGLVASLISVKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVHLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDRKIMTKTVTLGGDTFDPQGTLSGGARSQNASVLAKLQELKHVQEELRAKETQLQEVEKELMSLKNTVERYRQLKQQWEMKSEEADLLQTKLQQSSYHKQQEELDTLKQTIEGSEETLKKTKEVQMKAEEKFKVLEHKMKNAEAERERELKEAQQKLDGAKKKADASNKKMKEKQQEVDAFVLELEELKREQTTYKQQIEVVDEAMKAYQEQADNMASEVAKNKESVKKAQEELAKQKEIIMGHDKEI---KTKSAEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLQKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKKKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Match: cnih1 (cornichon family AMPA receptor auxiliary protein 1 [Source:Xenbase;Acc:XB-GENE-1004741])

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 491/1179 (41.65%), Postives = 733/1179 (62.17%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLAS---KLGQTNKSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGK---NIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  +AY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   AE Q+ +  +++A+   +  +K  ++  K+L K M+EDA++    +  + KI      L+E  +K  +    A Q    V++G     +SN  G  A L  + +  +++++          ++L H Q  L    +   K+    K DN   E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD +I  + VT  G+ FDP+G+L GG +  +  +  + +EL  +   + + + + +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++   E +++ +++  KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + +   LE  + ++EQ      IE  ++ +    +     + ++  +KES+   ++EL  Q  ++   +K+I   K    E GK   N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q+++KL+++K KL R V++R MN+L Q EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYIAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIGELEKLRDQEVGGALRSLEEALAEAQRSDTKVQSALDLKKQNMKAEEKKRKELVKSMEEDAKALTAKEKEVKKITDSLSSLQETSQKDAEALTGAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNEISKAETEAKQAQMKLKHAQQELKTKQAEVKKMDSGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSSRVKGLVASLISVKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVHLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDRKIMTKTVTLGGDTFDPQGTLSGGARSQNASVLAKLQELKHVQEELRAKETQLQEVEKELMSLKNTVERYRQLKQQWEMKSEEADLLQTKLQQSSYHKQQEELDTLKQTIEGSEETLKKTKEVQMKAEEKFKVLEHKMKNAEAERERELKEAQQKLDGAKKKADASNKKMKEKQQEVDAFVLELEELKREQTTYKQQIEVVDEAMKAYQEQADNMASEVAKNKESVKKAQEELAKQKEIIMGHDKEI---KTKSAEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLQKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKKKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 479/1179 (40.63%), Postives = 736/1179 (62.43%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNI---DQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +   + + GE   +++++   +E + +NE++       IE+L   +DK    KL++++   AE Q+     ++A    +  +   +   K+LQ  M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L SK  +  K D+  + +Q   +   +  E+L+  +  +NY + + E+          D+  +    +  + + P+ +  Y  P  +++   + G+VA+L+++ D   + +L+V  G RL+NV++D +  A +L EK  L  R T +PLNK+S + I    +R A+ ++G +NV  AL ++ Y    +  + FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +E+  + + + + +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ +KA E+ +  +  + N+ + +EK  K+A+ +   A+ +     +  K+ + + E + LE  + ++E    +Q L  +  A K    +I+  ++++E +  +KES++  + EL  Q ++   I  Q +  KD   E  K+    ++S L++ +++H IS H+++++DA  K+ K+LS   WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V+LR MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLRAEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEIEELERRKDKETGGKLKSLEDACAEAQRVNTKSQSAFDLKKKNLASEETKRKELQNSMAEDSKALAAKEKEVKKITDGLHGLQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMIACKNDISKAQTEAKQAQMKLKHAQQ---ELKSKQAEVKKMDSGYKKDQDAFEAVKKAKEKLETEMKKLNYEENKEEKLLEKHRQLSRDINNLKGKHEALLAKFPNLQFAYKDPEKNWNRNSVKGLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLEKGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENELRALEEELAGLKNVAEKYRQLKQQWEMKTEEGDLLQTKLQQSSYHKQQEELDALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHASNEQQLDAVNEAIKAYEGQIE--KMAAE-VAKNKESVNKAQDELMKQKQI---ITAQDNIIKDKCAEVAKHNLQNNESQLKIKELDHSISKHKREADDAAAKVSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGRNVNLRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 479/1179 (40.63%), Postives = 736/1179 (62.43%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNI---DQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +   + + GE   +++++   +E + +NE++       IE+L   +DK    KL++++   AE Q+     ++A    +  +   +   K+LQ  M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L SK  +  K D+  + +Q   +   +  E+L+  +  +NY + + E+          D+  +    +  + + P+ +  Y  P  +++   + G+VA+L+++ D   + +L+V  G RL+NV++D +  A +L EK  L  R T +PLNK+S + I    +R A+ ++G +NV  AL ++ Y    +  + FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +E+  + + + + +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ +KA E+ +  +  + N+ + +EK  K+A+ +   A+ +     +  K+ + + E + LE  + ++E    +Q L  +  A K    +I+  ++++E +  +KES++  + EL  Q ++   I  Q +  KD   E  K+    ++S L++ +++H IS H+++++DA  K+ K+LS   WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V+LR MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLRAEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEIEELERRKDKETGGKLKSLEDACAEAQRVNTKSQSAFDLKKKNLASEETKRKELQNSMAEDSKALAAKEKEVKKITDGLHGLQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMIACKNDISKAQTEAKQAQMKLKHAQQ---ELKSKQAEVKKMDSGYKKDQDAFEAVKKAKEKLETEMKKLNYEENKEEKLLEKHRQLSRDINNLKGKHEALLAKFPNLQFAYKDPEKNWNRNSVKGLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLEKGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENELRALEEELAGLKNVAEKYRQLKQQWEMKTEEGDLLQTKLQQSSYHKQQEELDALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHASNEQQLDAVNEAIKAYEGQIE--KMAAE-VAKNKESVNKAQDELMKQKQI---ITAQDNIIKDKCAEVAKHNLQNNESQLKIKELDHSISKHKREADDAAAKVSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGRNVNLRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc2 (structural maintenance of chromosomes 2 [Source:MGI Symbol;Acc:MGI:106067])

HSP 1 Score: 357.066 bits (915), Expect = 5.780e-111
Identity = 214/445 (48.09%), Postives = 298/445 (66.97%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDN 1401
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +   + + GE   +++++   +E + +NE++       IE+L   +DK    KL++++   AE Q+     ++A    +  +   +   K+LQ  M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L SK  +  K D+
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLRAEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEIEELERRKDKETGGKLKSLEDACAEAQRVNTKSQSAFDLKKKNLASEETKRKELQNSMAEDSKALAAKEKEVKKITDGLHGLQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMIACKNDISKAQTEAKQAQMKLKHAQ---QELKSKQAEVKKMDS 442          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc3 (structural maintenance of chromosomes 3 [Source:MGI Symbol;Acc:MGI:1339795])

HSP 1 Score: 195.282 bits (495), Expect = 5.466e-50
Identity = 316/1292 (24.46%), Postives = 565/1292 (43.73%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDX--XXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDN------ADGEYNR-LKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVES---DVNITLNTLNLRLVHTQSLLNQLASK---LGQTNKSDNS--------GELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELV-----YNRPRPDFDSRRI--------IGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAEL---FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNM--MDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKL--------LSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVD-----LRGMNVLGQTE-ERYSDL---------------MTKY----KKVLND-------KQVLQNVIDELDK--------------LKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT-------------PPEGKSLSD----------------GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++I GF+SY  +T +  F    N I G NGSGKSN   AI F+L     S +R      L+++     +  A V IIFDNS+ +  PI  E   E+++ R+++   K++Y ++  M   N V +L  S   + +NP++++ QG+I ++      + L LL E A T+ Y+ ++++++  +++ + K ++I++     EE    LE+ K E + Y ++ K+ R LEY    +   E   T+A +D         GE +R L++      + ++  E+Q    +  I  + EE++++  E+ + +K        Q   L+   K  +DE+    E  K+L K+ ++  E  ++ +  +A+ + +F+ +KEK E+       A Q   ++ +   Q + S  T    E   + +K E    D  I      +  +H + L +  A+K   L Q NK D           EL++K  ++  + ++L++  N +      W +   +Q A  +  R  L  +Q  +R      ++      N+    F  + I         G+V N     +P F   ++V  G RLF  I+D D V+ ++   F K  LP   TFLPLNK+  +         A  ++ K         ++Y+ R++ A   VFG  LI R+++++  +A        C+T +G+     G+L GG  +      E  +++   +  +  ++ +  EN  R  +  +N                E+ QL   M  ++ Q    KA  D   SE+K + E  +++EK +       +  + +L    S +E  + E  ++      QL L+++  K V+A    LN E    +QE +QLL                 R+  E II   E+        +N  + L ++E+++++ +++  E G  +  +   +  IN R+      SED +  I K          S  RW   E +H        D  N D KE    +EK+ + +  L +K +     +R +  L Q   E+Y  L               + KY    KK L+        K+ L    +ELD+               K E I+   +QV ++F ++F  L+PG +A L                EG   S+                G+  +++F     E   + +LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD  H + +  +I E   ++QFI  + +  +  +A+  +  KF + VS +
Sbjct:    6 VIIQGFRSYRDQTIVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLS-DEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSD-NRLPIDKE---EVSL-RRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEEEKEELAQYQKWDKMRRALEYT---IYNQELNETRAKLDELSAKRETSGEKSRQLRDAQQDARDKMEDIERQVRELKTKISAMKEEKEQLSAERQEQIK--------QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELAETEPKFNSVKEKEERGIARLAQATQERTDLYAK--QGRGSQFTSK--EERDKWIKKELKSLDQAINDKKRQIAAIH-KDLEDTEANKEKNLEQYNKLDQDLNEVKARVEELDRKYYEVKNKKDELQSERNYL------WREENAEQQALAAK-REDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRKGINQHVQNGYHGIVMNNFEC-EPAFYTCVEVTAGNRLFYHIVDSDEVSTKILMEFNKMNLPGEVTFLPLNKLDVRDTAYPETNDAIPMISK---------LRYNPRFDKAFKHVFGKTLICRSMEVSTQLA--RAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDVRKAEEELGELEAKLNENLRRNIERINN----------------EIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDL---LSQLSLEDQ--KRVDA----LNDEIRQLQQENRQLLNE---------------RIKLEGIITRVETYLN-----ENLRKRLDQVEQELNELRET--EGGTVLTATTSELEAINKRVKDTMARSEDLDNSIDKTEAGIKELQKSMERWKNMEKEHM-------DAINHDTKE----LEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLSLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQEELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDVEGSQSQDEGEGSGESERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIMELAVHAQFITTTFRPELLESADKFYGVKFRNKVSHI 1198          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Match: Smc4 (structural maintenance of chromosomes 4 [Source:MGI Symbol;Acc:MGI:1917349])

HSP 1 Score: 90.5077 bits (223), Expect = 9.278e-18
Identity = 161/692 (23.27%), Postives = 296/692 (42.77%), Query Frame = 1
Query: 1627 SRRIIGVVANLVSLP--DPQFSLSLQVGGGGRLFNVIIDHDSVAAEL--FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG-EQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELR-------------------------QLERNMMDD-------------------QYLNIKAKYDETESELKEITEAIRE--NEKLYRKACEETKLAKEN--LANSASIKEKAQ---KEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKL-LSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEG-KSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMF 3522
            S RI G+   L  L   D ++ +++       L  +++D    A E   F K       TF+ L+KM+         +K  +I   EN     ++++  ++    A  F     L+A  LD A  VA+    + R VT  G++ +  G++ GG  + +  R+     + ++++  +  M+ + + ++ +  QI++ + +H+EA  +LR    ++R                         +LE N++                     +Y  +  K  + E+E+K +   I +  N KL     ++ KL   N  L   AS   KAQ   K A+   KKAQD +   E+  KD E +   L  E  + E + ++++ N + AE                      S+   +KE  N   +LQE+  ++ Q  +  L+  K+     L++  I+  IS H    +  +++I K+ L      P E+        +    N +      +I  LE + R++  K +L  +    + E+ Y   + +  K+ +++   +   ++L K +          +     + +  L  G  A L   +     S+G+ F +      WK+  N LSGG+++L +L+L+ AL  +KP PLY +DE+DAALD  +   +   I EQ  N+QFII+SL++ MF
Sbjct:  582 SGRIPGIYGRLGDLGAIDEKYDIAISSCCHA-LDYIVVDSIDTAQECVNFLKKHNIGIATFIGLDKMTV------WAKKMSKIQTPENTPRLFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTLQGQIIEQSGTMSGGGSKVMRGRMGSSVIDEISVE-EVNKMESQLERHSKQAMQIQEQKVQHEEAVVKLRHSERDMRNTLEKFAASIQGLSEQEEYLCVQIKELEANVLTTAPDRKQQKLLEENVSVFKKEYDAVAEKAGKVEAEIKRLHNTIIDINNRKL---KAQQNKLDTINKQLDECASAITKAQVAIKTADRNLKKAQDSVCRTEKEIKDTEKEINDLKTELKNIEDKAEEVINNTKTAET---------------------SLPEIQKEHRN---LLQEL--KVIQENEHALQ--KDALSIKLKLEQIDGHISEHNSKIKYWQKEISKIKLHPVEDNPVETVAVLSQEELEAIKNPE--SITNEIALLEAQCREM--KPNLGAIAEYKKKEDLYLQRVAELDKITSERDNFRQAYEDLRKQRLNEFMAGFYVITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFN-LSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMF 1229          

HSP 2 Score: 65.855 bits (159), Expect = 3.741e-10
Identity = 45/156 (28.85%), Postives = 75/156 (48.08%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQ-AGINKATVCIIFDN-SEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPR 540
            IV   FKSYA    +  F   F+ I G NGSGKSN++D++ F+ G     ++R+  L  L++   +   I   TV + F    +K              ++R       + Y I+G       V +L RS  +++++  FLI+QG + ++  MKP+
Sbjct:   60 IVNQNFKSYAGEKVLGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY-RAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVLPNSNFYVSRTAYRDSTSVYHISGKKKTFKDVGNLLRSHGIDLDHNRFLILQGEVEQIAMMKPK 214          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|P50533|SMC2_XENLA (Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 495/1180 (41.95%), Postives = 737/1180 (62.46%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKK-LQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVE---SDVNITLNTLNLRLVHTQSLLNQLASKL----GQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+IDGFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NL+QVRASNLQ+LVYK GQAGI KATV I FDN +K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P + KLK ERSSYLEYQKI+R++E+L++  VAY++   +     +  E   +++ + + ++T+ +NE++       I +L + RD+     L++++   +E Q+ +  +++A+   +  +K  +E  +K L K M+EDA+     +  + KI      L+E  +K  + + SA Q    V++G     +SN  G  A L  + +  +   S          ++L H Q  L    +++    G   K + + E  +K K      E+L+  +  +NY     EQ    +     D+ R+    ++ + R P+ +  Y  P  ++DS R+ G+VA+L+S+ D   + +L+V  GGRL+NV++D +    +L EK  L  R T +PLNK+S + +    V  AK ++G +NV  AL ++ Y+   + A+ +VFG  L+  T+D AK V FD+RI  + VT  G+ FDP+G+L GG +  +  +  R +EL  + + + + +   +E       +++  +R+ +   Q   KS E   L+  +    Y   + + D  +  ++E  E ++  +++ +KA E+ K+ +  + N+ + +E+  KEA+ +   A+ +     +  K+ + + + L LE  + ++EQ   +Q +  ++ A K    + DS  ++SE +  +KE++   + EL  Q  ++   +K+I        +  +N +   L++ ++ H IS H+KDS DA  K+ K+L+   WI  E   F Q+   YDF   + KE  Q++ KL+++K KL R V++R MN+L Q EERY+DLM + + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A L PPEG+S+ DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIIIDGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLTQVRASNLQDLVYKNGQAGITKATVSITFDNYDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKIAAQKTIEKKEAKLKEIQTILEEEITPTIHKLKEERSSYLEYQKIMREIEHLSRLYVAYQFVCAEETKVRSAEELKEMQDSILKLQDTMAENERKVKELGKEIAELEKMRDQEVGGALRSLEEALSEAQRADTKVQSALDLKKQNMKAEREKKRKELVKSMEEDAKVLTAKEKEVKKITDGLSSLQEASQKDVEAFTSAQQHFNAVSAGL----SSNEDGEEATLAGQMMACKNETSKAETEAKQAQMKLKHAQQELKTKQAEVKKMDGGYKKDNEAFEAVKKSK------EKLEVEMKKLNYEDGREEQLLEKRRGLSRDVNRLREAYESLMARFPNLQFEYKDPEKNWDSDRVKGLVASLISIKDVSTATALEVVAGGRLYNVVVDTEVTGKKLLEKGELKRRFTIIPLNKISARCLGKDTVNVAKNLVGADNVNLALSLVGYESELQKAMEYVFGTTLVCDTMDNAKKVTFDKRIMTKTVTLGGDTFDPQGTLSGGARSQNASVLVRLQELKDVQDELKAKETELQEVEKELMTLKNTVERYRQLKQQWEMKSEEAELLQTKLQQSSYHKQQEELDSLKQTIEESEETLKNTKEVQKKAEEKFKVLEHKMKNAEAERERELKEAQQKLDTAKKKADASNKKMKEKQQEVDALVLELEELKREQTTYKQQIETVDEAMKAYQEQADS--MASE-VSKNKEAVKKAQDELAKQKEIIMGHDKEIKTKSSEAGKLRENNNDLQLKIKELEHNISKHKKDSADAAAKVAKMLNDYEWIASEKHLFGQANTAYDFKTNNPKEAGQRLHKLQEKKEKLGRNVNMRAMNMLTQAEERYNDLMKRKRIVENDKSKILTTIEELDQKKNEALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQSVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVAR 1171          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|O95347|SMC2_HUMAN (Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2 PE=1 SV=2)

HSP 1 Score: 795.038 bits (2052), Expect = 0.000e+0
Identity = 476/1178 (40.41%), Postives = 735/1178 (62.39%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNA--IKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQ---SALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +     +  E   +++++ + +E + +N+++     + IE+L + +DK     L++++   AE Q+     ++A  +K+     +E+K   K+L+K M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L +K  +  K D+    +Q+  +    + E+L+A +  +NY + + E     +     D+ R+    +  + R P+    Y  P  +++   + G+VA+L+S+ D   + +L++  G RL+NV++D +    +L E+  L  R T +PLNK+S + I    +R A+ ++G +NV  AL +++Y    + A+ FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +EL  + + +   +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ RKA E+ ++ +  + N+ + +E+  K+A+ +   A+ +     +  K+ + + E + LE  + ++E       +EA  + + +      V + ++  +KES++  ++E+  Q  V   I  Q +  K    E  K+ +Q   S L++ +++H IS H++++ED   K+ K+L    WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V++R MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLLAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLEDALAEAQRVNTKSQSAFDLKKKNLACEESKR--KELEKNMVEDSKTLAAKEKEVKKITDGLHALQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMMACKNDISKAQTEAKQAQMKLKHAQ---QELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLEKRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWEMKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKMKNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQLEAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEV---ITAQDTVIKAKYAEVAKHKEQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTNNPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q8CG48|SMC2_MOUSE (Structural maintenance of chromosomes protein 2 OS=Mus musculus OX=10090 GN=Smc2 PE=1 SV=2)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 479/1179 (40.63%), Postives = 736/1179 (62.43%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNI---DQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+++GFKSYA+RTE+ GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK GQAGI KA+V I FDNS+K  SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EILS++EEAA T+ YE K+    KTIEKK++KLKEI  IL EEI P ++KLK ERSSYLEYQK++R++E+L++  +AY++   +   + + GE   +++++   +E + +NE++       IE+L   +DK    KL++++   AE Q+     ++A    +  +   +   K+LQ  M ED+++    +  + KI      L+E   K  +   +A Q    V++G     +SN  G+ A L  + +  ++D++          ++L H Q    +L SK  +  K D+  + +Q   +   +  E+L+  +  +NY + + E+          D+  +    +  + + P+ +  Y  P  +++   + G+VA+L+++ D   + +L+V  G RL+NV++D +  A +L EK  L  R T +PLNK+S + I    +R A+ ++G +NV  AL ++ Y    +  + FVFG   +   +D AK VAFD+RI  R VT  G+VFDP G+L GG +     I  + +E+  + + + + +   +   +    +++  +++ +   Q   K+ E   L+  +    Y   + + D  +  ++E  E ++  +++ +KA E+ +  +  + N+ + +EK  K+A+ +   A+ +     +  K+ + + E + LE  + ++E    +Q L  +  A K    +I+  ++++E +  +KES++  + EL  Q ++   I  Q +  KD   E  K+    ++S L++ +++H IS H+++++DA  K+ K+LS   WI  E   F Q    YDF   + KE  Q+++KL++ K KL R V+LR MNVL + EERY+DLM K + V NDK  +   I++LD+ K++ +  A ++V++DF  IFSTLLPG+ A L PPEG+++ DGLEFK+A GN WKE+L ELSGGQRSLVALSLIL++L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQFI+VSLK+GMFNNANVLFKTKFVDGVSTV+R
Sbjct:    5 SIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIAAQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFLRAEDTKERSAGELKEMQDKIVNLQEVLSENEKKIKALNCEIEELERRKDKETGGKLKSLEDACAEAQRVNTKSQSAFDLKKKNLASEETKRKELQNSMAEDSKALAAKEKEVKKITDGLHGLQEASNKDAEALAAAQQHFNAVSAGL----SSNEDGAEATLAGQMIACKNDISKAQTEAKQAQMKLKHAQQ---ELKSKQAEVKKMDSGYKKDQDAFEAVKKAKEKLETEMKKLNYEENKEEKLLEKHRQLSRDINNLKGKHEALLAKFPNLQFAYKDPEKNWNRNSVKGLVASLINVKDNSTATALEVVAGERLYNVVVDTEVTAKKLLEKGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPDNVHVALSLVDYKPELQKGMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPHGTLSGGARSQAASILTKFQEVKDVQDELRTKENELRALEEELAGLKNVAEKYRQLKQQWEMKTEEGDLLQTKLQQSSYHKQQEELDALKKTIEESEETLKSTKEIQKKAEEKYEALENKMKNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHASNEQQLDAVNEAIKAYEGQIE--KMAAE-VAKNKESVNKAQDELMKQKQI---ITAQDNIIKDKCAEVAKHNLQNNESQLKIKELDHSISKHKREADDAAAKVSKMLSDYDWINAEKHLFGQPNSAYDFKTNNPKEAGQRLQKLQEVKEKLGRNVNLRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIEDLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFIVVSLKEGMFNNANVLFKTKFVDGVSTVAR 1170          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q90988|SMC2_CHICK (Structural maintenance of chromosomes protein 2 OS=Gallus gallus OX=9031 GN=SMC2 PE=2 SV=1)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 471/1192 (39.51%), Postives = 730/1192 (61.24%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKN-QLNQEE--ETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQ-KQLATEIEQLKANVNAINYSQPEWEQ--AQHDQLATG-SDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEK----AQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNTSRR-PMVE 3615
            SIV++GFKSYA+RTEI  FDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRAS+LQ+LVYK GQAG+NKATV I FDNS+K +SP+G+E  DEITITRQ++VGG+NKYLING+ A NNRVQDLF SV LNVNNPHFLIMQG+ITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKK+SKL EI +I+TEEI P LEKLK  R+SYLEYQK+ R++E L +  VA++Y   + I D +    N LK  Q N+++  E++ +NE++       IE+  ++ ++    KL +++  F+E+Q+ +A +++ +   +  +   +  +K+L K M+E+ ++    +  I KI+   + L+E+ +K  +   SA Q    V++G   + +   T SLA+ +       S          ++L + Q    +L +K  +  K D S + +Q+  + +    E+L+  +  + Y + E E   A+  QL++  S LR +    ++   ++P     Y  P  +++   + G+V  L+++ D   S +L+   GG+L+N+++D ++   ++ EK  L +R T +PL+K+S   I   ++  AK ++G   V  A+ +I Y+   + A+ +VFG  L+  ++D AK V FD+RI  + VT  G++FDP+G+L GG       I  + + +   ++ +     + +        +++  +++     Q   KS E   L+  +    Y   +      +  + E  E +++ E+  RKA EE K  +  + N+ + + K    AQ++  S  KKA D  +  +E  ++VEA    L LE    +QEQ       EAA++ + +  +       + +  +ES+   + EL ++  +++E  K I      + +  +  ++  L ++ + H I+ +++++ DA   + KLL   +WI  E + F Q+   YDF   + KE  QK++KL  +K KL + +++R MN+L + EERY+DLM K + V NDK  +   I+ELD+ K++ +  A E+V++DF  IFS LLPG++A L P + +++ DGLEF++  G++WKE+L ELSGGQRSL ALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG ++   F  SQF++VSLKDGMFNNANVL++TKFVDG+STVSRH    ++ P+ E
Sbjct:    5 SIVLEGFKSYAQRTEIRDFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASSLQDLVYKNGQAGVNKATVSITFDNSDKKNSPLGFENNDEITITRQVIVGGRNKYLINGMNASNNRVQDLFGSVGLNVNNPHFLIMQGQITKVLNMKPTEILAMIEEAAGTRMYECKKITAHKTIEKKESKLDEIRRIITEEISPTLEKLKEARASYLEYQKMTREVENLRRIYVAFQYVRAEEIKDRST---NALKEAQANKKKIFESMAENEKKVKELAQQIEETEKKNNEEFGAKLHSLEAAFSELQRVDAKVRSDLDHRKQNLNSEENRLKELIKIMQEEFKAFTSKEKEIKKIKEGLNGLQEESKKDAEALASAQQHFNAVSAGLSSNDSGQGT-SLADQMMTCKNEISKAATEAKQAQMKLKYAQ---QELKTKQAEVKKMDGSYKEDQEAFEAIRKTKEKLQDEMKKLKYEEAEQEAHLAKKKQLSSEISSLRELC---ESIEAKHPYLRFEYKNPEKNWNPNCVKGLVVTLITVKDISTSKALEAVAGGKLYNIVVDTEATGKKILEKGQLKHRYTIIPLSKISANSIGHEIISLAKNLIGHREVHIAISLIDYNSELQKAMEYVFGTTLVCSSMDNAKKVTFDKRIMRKTVTLQGDIFDPQGTLSGGASSHVTPILSKLKTMRDAEDELKIKTSQLEATEKELANLKNMAEKYQHLKQQWEMKSEEAELLQTKIQQSAYHKQQEDLLALKKTIAECEETLKKTEESQRKAEEEYKALENKMKNAEAERGKEIKNAQQKLNSAKKKADDSSRKMKEKQQEVEA----LVLELEQLKQEQASYKQQSEAAQQAIASLKEQVSALEAEAVKTRESLKNAENELSSEKGLMEERTKDIKAKSAKIEKYREQNNELQLSINALEHDINKYQQETADASSTLDKLLKEYKWIASEKELFGQADTTYDFEANNPKETGQKLQKLLTKKEKLEKSLNMRAMNLLSEAEERYNDLMKKKRMVENDKIKILATIEELDRKKNKALHIAWEKVNKDFGSIFSMLLPGAKAMLVPSKKQNILDGLEFRVGLGDIWKENLTELSGGQRSLAALSLILAILLFKPAPIYILDEVDAALDLSHTQNIGQMLHAHFKQSQFLVVSLKDGMFNNANVLYRTKFVDGISTVSRHCQLKKKQPLSE 1182          
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Match: sp|Q9C5Y4|SMC21_ARATH (Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana OX=3702 GN=SMC2-1 PE=2 SV=2)

HSP 1 Score: 707.983 bits (1826), Expect = 0.000e+0
Identity = 465/1195 (38.91%), Postives = 711/1195 (59.50%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERD-------KVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKK-------LQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTS-NATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRK---RHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQL---LANIEAAEKVVTNKIDSCRV---SSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVN 3591
            I ++GFKSYA RT ++GFDP FNAITGLNGSGKSNILD+ICF+LGITNL QVRA+NLQELVYK GQAGI KATV + FDNSE+  SP+GYE+  EIT+TRQIVVGG+NKYLING +A  ++VQ+LF SVQLNVNNPHFLIMQGRITKVLNMKP EILS+LEEAA T+ YE+K++  LKT+EKK +K+ EI+K+L  EI P LEKL+ E+S Y+++     +L+ L +F +A+EY   + I DNA      +K +L + +   +K +++   FE  I+ L + ++       K   EK+ ++     EM ++ + L N     ED +   KENV+K       L+K +KE A + K+++   A ++ +F +L   LE+ ++ +Q           G    K+S +    L + L +A          L  L  ++ H +  L +  S+L   +K + + E+E +      ++E +K  + +I Y++ + E  + D+ A    ++R+    +    +  +++  Y+ P  +FD  ++ GVVA L+ + D     +L+V  GG+L++V++D +    +L +   L  R T +PLNK+    +   V +    ++GK+N   AL ++ Y    ++A+ +VFG   + +T D+AK VAF+  I+   VT +G++F P G L GG ++      +R R+L  +  +   +Q  QK  AD  +QI++ +    +  +  AQL  K+++L    +    +++  +     + E EL+E    I+E E  Y+   +     + ++ +    +E   K+ E   K  + Q++   +  K  E + E L +E    +QEQ  L   L ++E     +T+++D  R    + +KI  H ES++    EL   +  ++E + QIS       +C + +    L    + + +     D +D   K+ KL+  + WI  E + F + G  YDF + D    ++K+EKL+ ++  L ++V+ + M +  + E+ Y+ L++K   + NDK  +  VI+ELD+ K E +K    +V++DF  IFSTLLPG+ A+L PPE  +  DGLE ++AFG VWK+SL+ELSGGQRSL+ALSLILALL FKPAPLYILDEVDAALD+SHTQNIG +I+  F +SQFI+VSLK+GMFNNANVLF+TKFVDGVSTV R V 
Sbjct:    6 ICLEGFKSYATRTVVSGFDPHFNAITGLNGSGKSNILDSICFVLGITNLQQVRAANLQELVYKQGQAGITKATVSVTFDNSERHRSPLGYEEHPEITVTRQIVVGGRNKYLINGKLAQPSQVQNLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYENKKEAALKTLEKKQTKVDEINKLLDHEILPALEKLRKEKSQYMQWANGNAELDRLRRFCIAFEYVQAEKIRDNAVLGVGEMKAKLGKIDAETEKTQEEIQEFEKQIKALTQAKEASMGGEVKTLSEKVDSLAQ---EMTRESSKLNN----KEDTLLGEKENVEKIVHSIEDLKKSVKERAAAVKKSEEGAADLKQRFQELSTTLEECEKEHQ-----------GVLAGKSSGDEEKCLEDQLRDAKIAVGTAGTELKQLKTKIEHCEKELKERKSQL--MSKLEEAIEVENELGARKNDVEHVKKALESIPYNEGQMEALEKDRGAELEVVQRLEDKVRGLSAQLANFQFTYSDPVRNFDRSKVKGVVAKLIKVKDRSSMTALEVTAGGKLYDVVVDSEDTGKQLLQNGALRRRVTIIPLNKIQSYVVQPRVQQATARLVGKDNAELALSLVGYSDELKNAMEYVFGSTFVCKTTDVAKEVAFNRDIRTPSVTLEGDIFQPSGLLTGGSRKGGG---DRLRKLHDLAEAESELQGHQKRLADVESQIKELQPLQMKFTDVYAQLELKTYDLSLFLKRAEQNEHHKLGEAVKKLEEELEEAKSQIKEKELAYKNCFDAVSKLENSIKDHDKNREGRLKDLEKNIKTIKAQMQAASKDLKSHENEKEKLVMEEEAMKQEQSSLESHLTSLETQISTLTSEVDEQRAKVDALQKI--HDESLA----ELKLIHAKMKECDTQISGFVTDQEKCLQKLSDMKLERKKLENEVVRMETDHKDCSVKVDKLVEKHTWIASEKQLFGKGGTDYDFESCDPYVAREKLEKLQSDQSGLEKRVNKKVMAMFEKAEDEYNALISKKNTIENDKSKITKVIEELDEKKKETLKVTWVKVNQDFGSIFSTLLPGTMAKLEPPEDGNFLDGLEVRVAFGKVWKQSLSELSGGQRSLLALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGRMIRAHFPHSQFIVVSLKEGMFNNANVLFRTKFVDGVSTVQRTVT 1171          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A3Q0KSX4 (Structural maintenance of chromosomes protein OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 541/1204 (44.93%), Postives = 762/1204 (63.29%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKE-DAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKV----ESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGEL------EQKQKQLATEIEQL-------KANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGE-----QELDHRIFE-RSRELLA--MDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNK-------IDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHV 3588
            S+VIDGFKSY +RTEI GFDP FNAITGLNGSGKSNILDAICFLLGITNLS VRA+NL ELVYKCGQAGINKATV  +FDN +KS SP GYEQFDE+TIT+QIVVGG+NKYLING  A   RV DLF SVQLNVNNPHFLIMQGRITK+LNMKP EILSLLEEAA+TK YE+K++  LKTIEKKDSKL+EID+ILTE+I P ++KL+ ERSSYLEYQK+VR++ +L KF+VAY+YT  +       G+   L+  LN+++  ++   + K   E+ I +LC++RD+     L+ +++  +  QK EAV K A +RA + ++ AK+ VK ++ Q  E D +   + K A A    ++  +  + E++K  +++A +RL  V SG      S+    +A  LAE V+V    +      L+ L +R  H Q   N+LA +     K+   G +      E KQK+L   I++L       +A+  A+       EQ    QL    + R +     T   + P     Y  P P+FD RR++G VA L  + D +++++L+V  G +L N+++D +     L E+  +  R T LPL ++   PI D V++ A+ ++G  NV +AL +I+YD   +  + +VFG  LI   +++AK +AF   I+ + VT +G+VFDP+G+L GG      + L  RIF+ R  E  A   + ++   +   K    R   I   R+  D A  QL     ++RQ +++        ++A    T+ ELK++ E++R  E+   +A  + KLA E   N+ + ++K Q EAE    +A+DQ++    A ++  +  E L LE  +  +E   L  ++E A + V +        ID+ R++ E +   +E++   +  +D   R L   EK+  Q   S       ++Q+  +V  ++H+I    K+SE+A+ K+ +LL TN WI +E + F    G+Y FT++D  E ++++  L++ + +LSR V++R MN+LG  E++YS+L+ + + VL DK  +Q VID+LDK K+EV+  AH +V+ +F  IF TLLPGS+ARL+PPEG S+ DGLE K+AFG+VWKESL ELSGGQRSL ALSLILALL FKPAPLYILDEVDAALD+SHTQNIG +IK  F +SQFI+VSLKDGMFNNANVLFKTKFVDGVSTVSRHV
Sbjct:    5 SLVIDGFKSYCQRTEIDGFDPQFNAITGLNGSGKSNILDAICFLLGITNLSHVRAANLHELVYKCGQAGINKATVSAVFDNVDKSQSPYGYEQFDELTITKQIVVGGRNKYLINGTNATTTRVHDLFHSVQLNVNNPHFLIMQGRITKILNMKPPEILSLLEEAASTKLYENKKEAALKTIEKKDSKLREIDRILTEDINPTIKKLREERSSYLEYQKVVREINHLEKFIVAYDYTCLEEAKKRTKGDLIALERSLNEQKMHMEGLRKSKEIMESRIAELCKQRDEHQGATLEELESTMSACQKTEAVAKGASQRASESLRAAKQRVKSMEAQCIELDEQLSSKHKAAEAAAGIEYQSVLAQSEEAKVKFEAAQKRLQAVKSGL-----SSGENGVAASLAEQVRVANGEKCSAQTELSQLKMRQKHLQ---NELAKQEAIVTKTFGHGSINGESKEEIKQKELTVHIDELTKKLTRAEADDRAVGSESVLSEQ----QLGLVKEARELRHQASTLSSQFPQLVFDYTDPEPNFDRRRVLGPVAKLFRVKDLKYAVALEVIAGNKLHNIVVDTEVTGKILLERGQIRRRVTMLPLTQIRGNPISDGVIKNAQSLVGASNVVTALSLIEYDNVLKPVMEYVFGSVLICPDMEVAKRIAFHPGIEKKTVTLEGDVFDPQGTLSGGSRGTASESLLSRIFKWRDLEDAAQKAEENVTRGEANVKAAQVRSQNISHLREALDNARHQLGLLETQMRQTDKH-------RLRADLAATKDELKQVEESLRNAEQRLTQASLKAKLAHEKATNAVAERKKEQLEAEKALSEAKDQVESTISALREKNSLKETLRLEAEELAKELNTLKLSLEEAIQGVEDAQAEEERCIDASRLAKEALTKAREAVIKQRGLIDETIRALAAAEKEAGQLVQS-------LNQTNSQVDKLSHQIEMQTKESEEADSKMERLLETNPWIHEEKQLFGIENGVYCFTSRDPIETRRRVHSLKERRDRLSRTVNMRAMNMLGNAEKQYSELIRRQEIVLADKHKIQTVIDDLDKRKEEVLLSAHNKVNEEFCNIFGTLLPGSKARLSPPEGMSVLDGLEIKVAFGDVWKESLGELSGGQRSLAALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGQLIKNHFKHSQFIVVSLKDGMFNNANVLFKTKFVDGVSTVSRHV 1182          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A0R3TUF4 (Structural maintenance of chromosomes protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11376 PE=3 SV=1)

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 517/1193 (43.34%), Postives = 750/1193 (62.87%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQG-QFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAE--LLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTN-KSDNSG-ELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGS------DLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG-----EQELDHRIFERSRELLAMDNSIMSMQ--QRQKENAD-RFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNTS 3597
            S+VIDGFKSY +RTEI  FD  FNAITGLNGSGKSNILDAICFLLGITNLS VRA+NLQELVYK GQ+GI KATV I+FDN++KS SP GYEQFDE+TITRQIVVGGKNKYLING  A N RVQDLF SVQLNVNNPHFLIMQG ITKV+NMKP EILSLLEEAA+TK YE+K++  LKTIEKKDSKL+EID++L E+I P + KL+ ERSSYLEYQKIVR++E+L++ ++AY++T  +     +  +  +L+N+L   +  ++  + +K + +  I +L EER  +    L+  +    E +K+EAV      RA + ++  ++ +  L+ Q KE ++  +  + A A   G +F  L+E  +++++    A   L    SG     +S   G LAE   +AE  +V   V   L  L +R  H    L+    KL     KS   G + E K+K L +++E+L + +  I   Q + +    +   T        ++R++        R+    +  Y  P P FD RR+ GVVA L  L DP+++ +++V  GG+L+N+++D ++    L E+  LP R T LPLN++    IP   ++KA+ ++GKENV  AL +I+Y       + FVFGG L+  TLD A+ V F   I+ R +T+DG++FDP+G+L GG     +  L  R+ +      A  +++   Q  QR +E A  R  +  D  +  D A  +L      LRQ + + +      +  + DE  + LKE    + E +K  ++A  + + A+E  A       KA +EAE+  K A++++   E+A +  +   E L LE  +  +E QQ+  ++E  +  + N   +   + +     KE++   K ++D Q R+       I   K    +  + I  ++ ++  + H +  H K++++A  K+  +L +N WI +E  +F  + G++DF  +D  E +Q++  L + + KLSR V++R MN+LG  EE+Y+DL+ + + VL DK+ +Q VID+LDK K++V+K A+E+V+ +F+ IFS+LLPG++A+L PPEG+++ DGL+F++AFG+ WKESL+ELSGGQRSLVAL+LILALL FKPAP+YILDEVDAALD+SHTQNIG +IK  F N+QFI+VSLKDGMFNNANVLFKTKFVDGVSTV+RH  T+
Sbjct:    5 SMVIDGFKSYCQRTEIRDFDLQFNAITGLNGSGKSNILDAICFLLGITNLSHVRAANLQELVYKSGQSGITKATVSIVFDNTDKSVSPYGYEQFDELTITRQIVVGGKNKYLINGTNATNTRVQDLFHSVQLNVNNPHFLIMQGSITKVVNMKPPEILSLLEEAASTKLYENKKEAALKTIEKKDSKLREIDRVLYEDITPTIRKLREERSSYLEYQKIVREIEHLSRLIIAYDFTRLEEAKQRSKDDLVKLENKLAYSKNELETLKSEKTDVDQKIVRLTEERQTLLGTSLEEAERVLVERRKEEAVASGVSTRAAEHLRVTRKQIHNLETQSKEISKQLEDKRYAAADAAGTEFKALEEATKQAQEALTEAQANLAATKSGLAGGNSSKQGGGLAEQARIAEGKRVA--VETELRQLEMREKHLTQELSTGQKKLSAMEAKSSGLGKDGETKRKHLLSQMEKLNSQLEEIR--QADVKAGGDEATVTNKYNELVREMRQLQAKSDELGRQFHQLQFDYTDPEPHFDRRRVFGVVAKLFDLVDPKYATAIEVAAGGKLYNIVVDTEATGKALLERGQLPRRVTMLPLNRIRGSSIPQETLKKAEALVGKENVAPALSLIRYPPHLAPVMEFVFGGLLVCPTLDHARKVTFHPGIERRTITYDGDMFDPQGTLSGGSRGGPQSNLLTRVAQWRAAESAAADAMKQCQEIQRAREAASLRAKKRADLSESLDRARHELAIIETTLRQSDTHRLRTDLERLGIELDEVRASLKEGAARLVEADKAVKEARWKVEHAQEAEA-------KALREAEAAVKSARERVDATEDALRTKQRLKETLRLEADEIAREFQQIQTSLEQTKTELQNAEVAVEKAKKDAEAAKEALKDAKAKVDEQQRLADAAAAAIQSAKSEADKLKEAISSTSCQIDKLTHDLDIHTKENKEAFVKLSSMLESNPWIAEERGNFGVANGVFDFKKRDPTEARQRVSTLSERREKLSRTVNMRAMNMLGTAEEQYADLLRRREIVLADKRKIQTVIDDLDKRKEQVLKSAYERVNEEFNNIFSSLLPGTRAQLVPPEGQTILDGLQFRVAFGDTWKESLSELSGGQRSLVALALILALLLFKPAPIYILDEVDAALDLSHTQNIGQLIKNHFKNAQFIVVSLKDGMFNNANVLFKTKFVDGVSTVTRHTPTT 1186          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A4S2MG76 (Structural maintenance of chromosomes protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000242 PE=3 SV=1)

HSP 1 Score: 867.07 bits (2239), Expect = 0.000e+0
Identity = 525/1197 (43.86%), Postives = 745/1197 (62.24%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQG--QFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQ----LASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVN---AINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGE-----QELDHRIFERSRELLAMDNSIMSMQQRQKENADRFT-QIEDNRKRHDEASAQLR----AKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLL-------ANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHV 3588
            S++IDGFKSY +RTEI GFDP FNAITGLNGSGKSNILDA+CFLLGITNLSQVRA+NLQELVYKCGQAGI KATV  +FDN +KS SP GYEQFDE+TITRQIVVGGKNKYLING  A N RV DLF SVQLNVNNPHFLIMQGRITK+LNMKP EILSLLEEAA+TK YE K++  LKTIEKKD KL+EID++L E+I P + KL+ ERSSYLEYQ IVR++ +L KF++AY++   +A    +  +   L+  L++ +E +K+  + K + E  I +L  +RD+     L+ +++  +  QK EAV K A  RA +  + A + +K L+ Q  E  E+Q   K   A+     +F  ++ + E +K    +A +RL   NSG   S       SLAE    A   +      L  L +R  H ++ L +    +    G+ + S +  + E +Q++L  EIE+L   +    A + +          Q A   + R       T     P     + +P P+FD  R+ G VA L+++ D +++ +L+V  G RL+N+++D D  +  L E+  L  R T LPLN++    IP  VVR+A+ ++G +NV +AL +I+Y    + A+ +VFG  L+   L+ A+ VAF   I+ R VT++G+VFDP+G+L GG      + L  R+F          N + S  Q+ ++   R    ++  RKR  E  AQLR    A   +L  LE  +       +KA    T  EL+ +  A+ + +    KAC + + A     N+A+ +EK + EAE+   +A+ +++    A +D  A  E L LE  +  +E   L        A+++AAE+ V+   +  + ++ ++   + +++  +  +D   R L   EK+++Q         +NI+Q+ +++  + H++    K+SE+A  KI +LL  + WI +E +HF    G Y FT +D  E +++I+ L++ + +LSR V++R MN+LG  EE+Y++L+ + + VL DK+ +Q VID+LDK K EV+  A+ +V+ +F  IF TLLPGS+ARL PPE  ++ DGLE K+AFG+VWK+SL+ELSGGQRSL ALSLILALL FKPAPLYILDEVDAALD+SHTQNIG +IK  F +SQF+IVSLKDGMFNNANVLFKTKF DGVSTV+RHV
Sbjct:    5 SLIIDGFKSYCQRTEINGFDPQFNAITGLNGSGKSNILDAVCFLLGITNLSQVRAANLQELVYKCGQAGITKATVSAVFDNLDKSQSPYGYEQFDELTITRQIVVGGKNKYLINGTNATNTRVHDLFHSVQLNVNNPHFLIMQGRITKILNMKPPEILSLLEEAASTKLYEHKKEMALKTIEKKDGKLREIDRVLREDINPTITKLREERSSYLEYQNIVREMTHLEKFIIAYDFYCLEAAKHRSKEDLVALERSLSELKEKVKQFIEGKTSVEQRIVELSAQRDEFQGSALEELESAMSGCQKTEAVAKGAASRANEAFRAANQRIKNLESQCTE-TETQLNAKHEAAEAAAGKEFKAIQAEAEDAKAKLDAAQRRLQAANSGL-SSGEDGVAASLAEQARMADGEKCAAQTELRQLEMRQKHLRAELTKQEAAVVKVFGRLSMSASKSKEEIEQQRLTEEIEKLTQRLTRAEADDRTLGSETALAERQFALAKEAREARHQANTASANFPQLVFEFTQPEPNFDRSRVYGPVAKLINVKDLKYATALEVAAGARLYNIVVDCDRTSKLLLERGQLRRRVTILPLNQIRGSSIPPAVVRQAESLVGAQNVATALSLIEYPSHLQPAMEYVFGNILVCPDLNTARRVAFHPGIERRTVTWEGDVFDPQGTLSGGSRAPVSESLLSRLFS--------CNQLESTAQKAEDELKRGDFNLQAARKRSQEI-AQLREALDAARHQLGILETELRQTDKHRLKADVIATREELERVASALEQAKDRLAKACAKAEQAHTKAVNAAAEREKEKHEAEAALTEAKTRVEATANALRDKTAVKETLRLEAEELTKELNVLKLTLREAEASLKAAEEEVSKCTEEVKKATRELQEARAAVTKQRNLIDETVRALAAAEKRVNQLV-------QNINQTNVQIEKLMHQLELQTKESEEAGCKIERLLMAHPWIAEERQHFGVENGAYCFTTRDPNEARRRIQTLKERRERLSRTVNMRAMNMLGSAEEQYAELIRRQEIVLADKRKIQAVIDDLDKRKKEVLMSAYNKVNEEFCNIFGTLLPGSKARLLPPENMTVLDGLEIKVAFGDVWKDSLSELSGGQRSLAALSLILALLLFKPAPLYILDEVDAALDLSHTQNIGQLIKNHFQHSQFLIVSLKDGMFNNANVLFKTKFQDGVSTVTRHV 1183          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A564Y261 (SMC hinge domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2123 PE=4 SV=1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 521/1195 (43.60%), Postives = 757/1195 (63.35%), Query Frame = 1
Query:   88 DGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQG-QFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAE--LLAEAVKVESDVNITLNTLNLRLVH-------TQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLAT-------GSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG-----EQELDHRIFERSRELLAMDNSIMSMQ--QRQKENAD-RFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNTS 3597
            DGFKSY +RTEI GFD  FNAITGLNGSGKSNILDAICFLLGITNLS VRA+NLQELVYK GQAGI KATV I+FDN++KS SP GYEQFDE+TI+RQ+VVGGKNKYLING  A N RVQDLF SVQLNVNNPHFLIMQGRITKVLNMKP EILSLLEEAA+TK YE+K++  LKTIEKKDSKL+EID++L E+I P + KL+ ERSSYLEYQKIVR++E+L++ ++AY++T  +     +  +  +L+N+L   +  ++  + QK   +  I +L EER  +    L+  +    E +K+EAV   A  RA + ++ A++ ++ L+ Q  E  +  +  + A A   G +F  L+E  +++++    A   L    SG    K+S  TG LAE   +AE  +V   V   L  L +R  H        Q  L+ + +K G   K       E K+K L +++E L A +  +  +    ++A  D+            +LR++        R+    +  Y  P P+FD RR+ GVVA L  L DP+++ +++V  GG+L+N+++D+++    L E+  LP R T LPLN++   PIP   ++KA+ ++GKENV  AL +I+Y       + FVFGG L+  TLD A+ VAF   ++ R +T++G++FDP+G+L GG     +  L  R+ +      A  +++   Q  QR +E A  R  Q  D  +  D A  +L      LRQ + + +      +  + +E  +  KE +  + + EK  R+A  + + A+E  A       KA +EAE+  K A++++ + EEA +  +   E L LE  +  +E QQ+  ++E A+  + N   +   + ++    KE++   K ++D Q R+       I   K       + I  ++ ++  + H +  H K+S++A  K+ ++L +N WI +E  +F  + G++DF  +D  E +Q++  L + + KLSR V++R MN+LG  EE+Y+DL+ + + VL DK+ +Q VID+LDK K++V++ A+E+V+ +F+ IFS+LLPG++A+L PPEG+++ DGL+F++AFG+ WKESL+ELSGGQRSLVAL+LILALL F+PAP+YILDEVDAALD+SHTQNIG +IK  F N+QFI+VSLKDGMFNNANVLFKTKFVDGVSTV+RH  T+
Sbjct:    1 DGFKSYCQRTEIPGFDVQFNAITGLNGSGKSNILDAICFLLGITNLSHVRAANLQELVYKSGQAGITKATVSIVFDNTDKSVSPYGYEQFDELTISRQVVVGGKNKYLINGTNATNTRVQDLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSLLEEAASTKLYENKKEAALKTIEKKDSKLREIDRVLYEDITPTIRKLREERSSYLEYQKIVREIEHLSRLIIAYDFTRLEEAKQRSKDDLVKLENKLTSNKNELETLKNQKTEVDQKIVQLNEERQTLLGTSLEEAERILVERRKEEAVASGASTRAIEHLRTARKQLRSLEIQSTEMVKQLEDKQRAAADAAGTEFKALEEAAKEAQEALTEAQANLAATKSGLGGGKSSKQTGGLAEQARIAEGQRVA--VETELRQLEMREKHLIQELSTGQKQLSAMEAKSGGLGKDGG----EAKRKLLLSQMENLNAQLEELRLAD---DKAGGDEATITNKYNERARELRQLQARSDELGRQFHQLQFDYTDPEPNFDRRRVFGVVAKLFDLVDPKYATAIEVAAGGKLYNIVVDNEATGKALLERGHLPRRVTMLPLNRIRGSPIPPDALKKAEAVVGKENVAPALSLIKYPPHLTPVMEFVFGGLLVCPTLDHARKVAFHPGVERRTITYEGDLFDPQGTLSGGSRGGPQTNLLTRVAQWRAAESAAADAMKECQKIQRVREAASARSKQRADLSESLDRARHELAIIETTLRQSDTHRLRTDLERLSKELEEVRASHKERSIRLADAEKAVREARWKVEHAQEAEA-------KALREAEAAVKSARERVDVTEEALRTKQCLKETLRLEAYELAREFQQMQTSLEQAKVEIQNAEVAVENAKKEAEAAKEALVDAKAKVDEQQRLADAAAAAIQSAKAEADMLKEAISSTSCQIDRLAHDLDIHTKESKEAAVKLAQMLESNPWIAEERSNFGVANGVFDFKKRDPTEARQRVAALSERREKLSRTVNMRAMNMLGTAEEQYADLLRRREIVLADKRKIQAVIDDLDKRKEQVLRAAYEKVNEEFNNIFSSLLPGTRAQLVPPEGQTILDGLQFRVAFGDTWKESLSELSGGQRSLVALALILALLLFRPAPIYILDEVDAALDLSHTQNIGQLIKNHFKNAQFIVVSLKDGMFNNANVLFKTKFVDGVSTVTRHTPTT 1179          
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Match: A0A158QG37 (Structural maintenance of chromosomes protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9920 PE=3 SV=1)

HSP 1 Score: 863.603 bits (2230), Expect = 0.000e+0
Identity = 525/1208 (43.46%), Postives = 762/1208 (63.08%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHV---------EKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQG-QFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAE--LLAEAVKVESDVNITLNTLNLRLVH-------TQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLAT-------GSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG-----EQELDHRIFERSRELLAMDNSIMSMQ--QRQKENAD-RFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNTS 3597
            S+VIDGFKSY +RTEI GFD  FNAITGLNGSGKSNILDAICFLLGITNLS VRA+NLQELVYK GQAGI KATV I+FDN++KS SP GYEQFDE+TI+RQ+VVGGKNKYLING  A N RVQDLF SVQLNVNNPHFLIMQGRITKVLNMKP EILSLLEEAA+TK YE+K++  LKTIEKKDSKL+EID++L E+I P + KL+ ERSSYLEYQKIVR++E+L++ ++AY++T  +     +  +  +L+N+L   +  ++  + QK   +  I +L EER  V +           L+  +    E +K+EAV   A  RA + ++ A++ ++ L+ Q  E  +  +  + A A   G +F  L+E  +++++    A   L    SG    K+S  TG LAE   +AE  +V   V   L  L +R  H        Q  L+ + +K G   K       E K+K L +++E L A +  +  +    ++A  D+            +LR++        R+    +  Y  P P+FD RR+ GVVA L  L DP+++ +++V  GG+L+N+++D+++    L E+  LP R T LPLN++   PIP   ++KA+ ++GKENV  AL +I+Y       + FVFGG L+  TLD A+ VAF   ++ R +T++G++FDP+G+L GG     +  L  R+ +      A  +++   Q  QR +E A  R  Q  D  +  D A  +L      LRQ + + +      +  + +E  +  KE +  + + EK  R+A  + + A+E  A       KA +EAE+  K A++++ + EEA +  +   E L LE  +  +E QQ+  ++E A+  + N   +   + ++    KE++   K ++D Q R+       I   K       + I  ++ ++  + H +  H K+S++A  K+ ++L +N WI +E  +F  + G++DF  +D  E +Q++  L + + KLSR V++R MN+LG  EE+Y+DL+ + + VL DK+ +Q VID+LDK K++V++ A+E+V+ +F+ IFS+LLPG++A+L PPEG+++ DGL+F++AFG+ WKESL+ELSGGQRSLVAL+LILALL F+PAP+YILDEVDAALD+SHTQNIG +IK  F N+QFI+VSLKDGMFNNANVLFKTKFVDGVSTV+RH  T+
Sbjct:    5 SMVIDGFKSYCQRTEIPGFDVQFNAITGLNGSGKSNILDAICFLLGITNLSHVRAANLQELVYKSGQAGITKATVSIVFDNTDKSVSPYGYEQFDELTISRQVVVGGKNKYLINGTNATNTRVQDLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSLLEEAASTKLYENKKEAALKTIEKKDSKLREIDRVLYEDITPTIRKLREERSSYLEYQKIVREIEHLSRLIIAYDFTRLEEAKQRSKDDLVKLENKLTSNKNELETLKNQKTEVDQKIVQLNEERQTVSLLFFLFVKFGTSLEEAERILVERRKEEAVASGASTRAIEHLRTARKQLRSLEIQSTEMVKQLEDKQRAAADAAGTEFKALEEAAKEAQEALTEAQANLAATKSGLGGGKSSKQTGGLAEQARIAEGQRVA--VETELRQLEMREKHLIQELSTGQKQLSAMEAKSGGLGKDGG----EAKRKLLLSQMENLNAQLEELRLAD---DKAGGDEATITNKYNERARELRQLQARSDELGRQFHQLQFDYTDPEPNFDRRRVFGVVAKLFDLVDPKYATAIEVAAGGKLYNIVVDNEATGKALLERGHLPRRVTMLPLNRIRGSPIPPDALKKAEAVVGKENVAPALSLIKYPPHLTPVMEFVFGGLLVCPTLDHARKVAFHPGVERRTITYEGDLFDPQGTLSGGSRGGPQTNLLTRVAQWRAAESAAADAMKECQKIQRVREAASARSKQRADLSESLDRARHELAIIETTLRQSDTHRLRTDLERLSKELEEVRASHKERSIRLADAEKAVREARWKVEHAQEAEA-------KALREAEAAVKSARERVDVTEEALRTKQCLKETLRLEAYELAREFQQMQTSLEQAKVEIQNAEVAVENAKKEAEAAKEALVDAKAKVDEQQRLADAAAAAIQSAKAEADMLKEAISSTSCQIDRLAHDLDIHTKESKEAAVKLAQMLESNPWIAEERSNFGVANGVFDFKKRDPTEARQRVAALSERREKLSRTVNMRAMNMLGTAEEQYADLLRRREIVLADKRKIQAVIDDLDKRKEQVLRAAYEKVNEEFNNIFSSLLPGTRAQLVPPEGQTILDGLQFRVAFGDTWKESLSELSGGQRSLVALALILALLLFRPAPIYILDEVDAALDLSHTQNIGQLIKNHFKNAQFIVVSLKDGMFNNANVLFKTKFVDGVSTVTRHTPTT 1196          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 744.577 bits (1921), Expect = 0.000e+0
Identity = 476/1191 (39.97%), Postives = 722/1191 (60.62%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVN---ITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEI-EQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGE--------------QELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNT 3594
            SIV++GFKSYA+RTEI+GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLSQVRASNLQ+LVYK G AGI KATV I+FDNS K  SP+G+E  DEITITRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    KTIEKKD+KLKEI  IL EEI P +EKLK ERSSYLEYQK++R++E+L++  +A+++   +     +  +  +++  + + +++++KN  +       I+ L  ER  V    L++++   AE Q+ +   ++A+   +  +K+  +  K+L K M+ED +     +  + K   +   ++E+ +K  +  ++A Q    V++G     ++N  G  A L  + +  ++D++          ++L H Q    +L +K  Q  K D+  + +Q       +  E+L++ +  +NY +    + Q  QL+   +  R   D  +F+ + P+    Y  P  +++  ++ G+VA+L ++ D  +S +L+V     L   I    +   ++ EK  L  R T +P+NK+S + I D VV+ AK ++G+ENV +AL ++ Y+      + FVFG  L+  TLD AK  AFD+R+  + VT  G+VFDP+G++ GG               +++   +  R  ELLA++  + S+    K  A+++ Q++           QL  K+ E + LE  +    +   + + +     ++E  E + + +++ +KA E+ ++ +  + N+ + +EK  K A+ +  +A+ +     +  K+ + + + + LE  + ++EQ      I+A        +D    + +  I H  +  A  K       V+   E++I    +      +  + + L++ ++ H IS HRKDS DA  ++ ++L+ N WI  E   F Q    YDF     KE  Q++++LE+ K KL R ++ R MN+L + EERY++L  K + V NDK  +   I ELD+ K+E +  A ++V++DF  IFSTLLPG+ ARL PPEG  + DGLEFK+A GN WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F +SQF++VSLKDGMF NANVLFKTKFVDGVSTV+R V +
Sbjct:    5 SIVLEGFKSYAERTEISGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRASNLQDLVYKNGLAGITKATVSIVFDNSNKKESPLGFETHDEITITRQVVIGGRNKYLINGVNANNMRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKLSAQKTIEKKDAKLKEIQTILEEEITPAMEKLKEERSSYLEYQKLMREIEHLSRLYIAWQFVCAEETKLKSAEDLQQMQASITELQQSMQKNTARIQELSEEIKAL--ERTGV----LKSLEETLAEAQRVDTKAQSALDLKKQNLKDETKKRKELVKNMEEDKKMMAAKEGEVGKALDRLKAVQEEGQKDAEALEAAQQHFKAVSAGL----SANEDGEEATLAGQMMTCKNDMSKAETEAKQAQMKLKHAQ---QELKTKQAQVKKMDSGYKKDQDAFDAVQKCREKLQSELQKLNYEEEHLIE-QKRQLSCKVNQLRETYD--SFMSQFPNLRFEYRDPEKNWERSKVKGLVASLFTVTDVCYSTALEVVVSSLLLISISLSVT-GKKILEKGELKRRYTIIPMNKISSRTINDNVVQTAKNLVGEENVHTALSLVGYESELRKVMEFVFGTTLVCDTLDNAKKAAFDKRVHTKTVTLGGDVFDPQGTVTGGASARSASVLSKLAEVKDVQDNLRAREAELLAVETELGSL----KGTAEKYRQLKQ----------QLDLKTEEAQILETKLQQSSFHKQQEELENLRKTIEESEETLTKTKEVQKKAEEKFRVLENKMKNAEAEREKELKAAQQKLNQAKSKADAYNKKLKERQQEADAVALELEELKREQAGYEQQIQA--------VDDAMKAIQDQISHMTTEVAANKVTVLLIEVILGQEREIKGKSEEANRLREQNNDAQLKIKELEHNISKHRKDSADAAARVARMLAENDWISSERSLFGQPNTAYDFKTNSPKEAGQRLKRLEENKDKLERNINRRAMNMLSEAEERYNELKKKKRIVENDKAKILETIKELDQKKNEALNVAWQKVNKDFGSIFSTLLPGANARLAPPEGCGVLDGLEFKVALGNTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQFVVVSLKDGMFTNANVLFKTKFVDGVSTVTRTVQS 1156          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:103034304])

HSP 1 Score: 182.57 bits (462), Expect = 3.912e-46
Identity = 308/1293 (23.82%), Postives = 553/1293 (42.77%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDT---LKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNAD------GEYNR-LKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESD--VNITLNTLNLRLVHTQSLLNQLASKLGQT--NKSDN---SGELEQKQKQLATEIEQLKANVNAINYSQPE--------WEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELV-----YNRPRPDFDSRRI--------IGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAEL---FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNM--MDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKA---QDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIY----DFTNKDWKEYKQKIEKLEDEKRKLSRKVD-----LRGMNVLGQTE-ERYSDL---------------MTKY----KKVLND-------KQVLQNVIDELDK--------------LKDEVIKKAHEQVDRDFDKIFSTLLPGSQARL-----------TPPEGKSLSD------------------GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++I GF+SY  +T +  F    N I G NGSGKSN   AI F+L     S +R      L+++     +  A V IIFDNS+ +  PI  E   E+++ R+++   K++Y ++  M   N V +L  S   + +NP++++ QG+I ++      + L LL E A T+ Y+ +++++   +K  E K  K+ E+     EE    LE  K E + Y ++ K+ R LEY    +   E   T+A +D         G+ +R L++      + +++ E+     +  I  + EE++++  E+ + +K        Q   L+   K  +DE+    E  K+L K+ ++  E  ++ +  + + + +F+ +KEK E+       A Q   ++ +   Q + S  T           K E D  +   L +L+  +   +  +  +   L  T  NK  N     +L+Q   ++ T +E+L      +   + E        W +   +Q A  +  R  L  +Q  +R      ++      N+    F  + I         G+V N     +P F   ++V  G RLF  I++ D V+ ++   F K  LP   TFLPL+K+  +         A  ++ K         ++Y   ++ A   VFG  LI R+++++  +A        C+T +G+     G+L GG  +      E  +++   +  +  ++ +  EN  R  +  +N                E+ QL   M  ++ Q    KA  D   SE+K + E  +++EK +       +  + +L    S +E  + E  ++       +DQ ++D+            LN E    +Q+ +QLL                 R+  E I+   E+        +N  + L ++E+++++ +++  E G  +  +   +  IN RI      SED +  I K   T   I D  K   +   I     D  N D KE    +EK+ + +  L +K +     +R +  L Q   E+Y  L               + KY    KK L+        K+ L    DELD+               K E I+   +QV ++F ++F  L+PG +A L           +  EG+  +D                  G+  +++F     E   + +LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD  H + +  +I E  G++QFI  + +  +  +A+  +  KF + VS +
Sbjct:    6 VIIQGFRSYRDQTVVDPFSSKHNVIVGRNGSGKSNFFYAIQFVLS-DEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSD-NRLPIDKE---EVSL-RRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINEL-LKYIEERLHTLEDEKEELAQYQKWDKMRRALEYT---IYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKARISAMKEEKEQLSAERQEQIK--------QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNTVKEKEERGIARLAQATQERTDLYAK--QGRGSQFTS----------KEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNRKDELQSERNYLWREENAEQQALAAK-REDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRKGINQHVINGYHGIVMNNFEC-EPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISK---------LRYSPNFDKAFKHVFGKTLICRSMEVSTQLA--RAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELSELEAKLNENLRRNIERINN----------------EIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDD------------LNDEIRQLQQDNRQLLNE---------------RIKLEGIMTRVETYLN-----ENLRKRLDQVEQELNELRET--EGGTVLTATTSELDGINKRIKDTMARSEDLDSLIDK---TEIEIKDHIKSMERWKNIEKEQNDAINHDTKE----LEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGGQSQDEGEGGADSEKGSASQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIVELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHI 1198          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:103045898])

HSP 1 Score: 117.087 bits (292), Expect = 5.014e-26
Identity = 283/1259 (22.48%), Postives = 499/1259 (39.63%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQ-AGINKATVCI----IFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEK--KDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVD---NA-DGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGF-------------FQSKTSNATGSLAELLAEAV-KVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATG------SDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLP--DPQFSLSLQVGGGGRLFNVIIDHDSVAAE--LFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG------------------------------------------EQELDHRIFERSRELLAMDN-------SIMSMQQRQKENADRFTQIEDN--RKRHDEASAQLRAKSF------------ELRQLERNMMDDQYLNIKA---KYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEG-KSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLF 3543
            IV   FKSYA    +  F   F+ I G NGSGKSN++D++ F+ G     ++R+  L  L++   +   I   TV +    I D        I   +F    ++R       + Y ING  A    V  + RS  +++++  FLI+QG +         E +++++    T+H E      L+ +E      +LKE                            + R +E LN+     E      +V+   NA +GE N+    L  E +  KK  Q           LC+     +V  LQ    E  E +KQ+          +++ K   E   +L ++MK   E       A+  ++ +  KL + +E  K+ +   D + + V                  Q             L++AV +  S +++  + L++ L    + ++QL              + ++  +  A  + + +A +  +    P+ EQ       TG      SDLR+ + + ++ +  N S   V +       S +I G+   L  L   D ++ +++     G L N+++D    A +  +F K+      TF+ L+KM          +    I   EN+    ++++  D+    A  F     L+A+ L+ A  VAF +  + R VT  G++ +  G++ GG                                          +Q+L+ ++ ++ REL  M N       SI S+++++     +   +E N      D+A  +   K+F            E+++L   ++D     +KA   K D+   EL E + AI        KA    K A  NL  S  I E+ + E +   K  ++ +    E  K +E Q   +   C D E+     L  ++   + V  +I + +          E   A +KE  N    +++I+  IS+C+       K+ D+ A        +I  H  D + AE ++ KL       P++         +    N D    K +I  LED  R    K +L  +    + EE Y   + +  ++   +   +   ++L K +          +     + +  L  G  A L   +     S+G+ F +      WK+  N LSGG+++L +L+L+ AL  FKP PLY +DE+DAALD  +   +   I EQ  N+QFII+SL++ MF  A+ L 
Sbjct:   15 IVNRNFKSYAGEQILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY-RAQKIRSKKLSVLIHSSDEHKDIQSCTVEVHFQKIVDKEGDDYDVIPNSKFH---VSRTAGKDNSSAYHINGKKATFKDVGTVLRSHGIDLDHNRFLILQGEV---------EQIAMMKPKGQTEHDEG----MLEYLEDIIGSCRLKE------------------------PINTLCRRVELLNE--QRGEKLNRVKMVEKDKNALEGEKNKAVEFLTLENDMFKKRSQ-----------LCQ----FYVHDLQQRVAE-KEAEKQQI---------QEDTKGLTEKSNQLTEEMKGKNE-------ALKNVEKKLGKLTKFIENQKEKFTQLDLQDVEVREKLKHTKTKTKKLHKQLQKDKEKQKEKELLELSKAVNETRSQMDVAQSELDIYLSQHNTAVSQL-------------NQAKETLQGTADTLRERRAAIKDLQVKIPKCEQELKKVNLTGFFLSLVSDLRQKVEEAKSSLSSNRSRGKVLDALMQQKQSGKIPGIFGRLGDLGAIDERYDVAIS-SSCGSLDNILVDTIDTAQKCVVFLKSQNIGVATFIGLDKMKVWE------KNMVAISTPENIPRLFDMVKVKDESVRPAFYFALRDTLVAKDLEQATRVAFQKDKRWRVVTLQGQIIEQSGTMTGGGGRVMKGRMGSSIGTEVTQEQLDRMESALNEKVVQLQGWQQRKQQLEEKVHKQRRELRDMKNTLEKYTASIQSLEEQEMLMKSQMKGLEANVLAAAPDKAKQKQMEKNFEAASNKAGKVEAEVKRLHTLIVDINSHKLKAQQDKLDKVNKELDECSSAI-------TKAQVAIKTAGRNLKKSEEIVERLETETKENEKLMEELM----EQLKKLEEQAGEIMKTCQDAEEA----LPEVQEEHRGVLQEIKAVQ----------EKEHALQKESLNIRLKVEQIDTAISECQSK----SKHWDKEAT-------KIVLHSIDDKPAE-ELPKL------TPED---------LAAIKNPDV--IKNEIALLED--RCARMKPNLGAIAEFKKKEELYLQRVAELDEITTQRDDFKRGCEDLRKQRLNEFMAGFNIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIYN-LSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEMADRLI 1121          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc4 (structural maintenance of chromosomes 4 [Source:NCBI gene;Acc:103045898])

HSP 1 Score: 87.8113 bits (216), Expect = 5.316e-17
Identity = 208/914 (22.76%), Postives = 370/914 (40.48%), Query Frame = 1
Query: 1072 QMKEDAESQKQTKLAIA---KIQGQFDKLKEKLEKSK-QNYQSADQRL--LNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQL-ASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQ-AQHDQLATG--SDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLP--DPQFSLSLQVGGGGRLFNVIIDHDSVAAE--LFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG------------------------------------------EQELDHRIFERSRELLAMDN-------SIMSMQQRQKENADRFTQIEDN---------------------RKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKA---KYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEG-KSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLF 3543
            Q+++D E  ++ +   A   KI  +    KE+LEK K +  +S  Q +  L   +   Q++       L EL     +  S +++  + L++ L    + ++QL  +K      +D   E     K L  +I + +     +   + E EQ +  D  A G  SDLR+ + + ++ +  N S   V +       S +I G+   L  L   D ++ +++     G L N+++D    A +  +F K+      TF+ L+KM          +    I   EN+    ++++  D+    A  F     L+A+ L+ A  VAF +  + R VT  G++ +  G++ GG                                          +Q+L+ ++ ++ REL  M N       SI S+++++     +   +E N                     +K  + AS +      E+++L   ++D     +KA   K D+   EL E + AI        KA    K A  NL  S  I E+ + E +   K  ++ +    E  K +E Q   +   C D E    + L  ++   + V  +I + +          E   A +KE  N    +++I+  IS+C+       K+ D+ A        +I  H  D + AE          +  P++         +    N D    K +I  LED  R    K +L  +    + EE Y   + +  ++   +   +   ++L K +          +     + +  L  G  A L   +     S+G+ F +      WK+  N LSGG+++L +L+L+ AL  FKP PLY +DE+DAALD  +   +   I EQ  N+QFII+SL++ MF  A+ L 
Sbjct:  424 QLQKDKEKLEEVRNVPASSEKIITEASAQKEELEKQKVKEEESLAQVMESLKEETSGLQNEKEQKEKELLELSKAVNETRSQMDVAQSELDIYLSQHNTAVSQLNQAKETLQGTADTLRERRAAIKDLQVKIPKCE---QELKKDEQELEQISGQDGEARGVVSDLRQKVEEAKSSLSSNRSRGKVLDALMQQKQSGKIPGIFGRLGDLGAIDERYDVAIS-SSCGSLDNILVDTIDTAQKCVVFLKSQNIGVATFIGLDKMKVWE------KNMVAISTPENIPRLFDMVKVKDESVRPAFYFALRDTLVAKDLEQATRVAFQKDKRWRVVTLQGQIIEQSGTMTGGGGRVMKGRMGSSIGTEVTQEQLDRMESALNEKVVQLQGWQQRKQQLEEKVHKQRRELRDMKNTLEKYTASIQSLEEQEMLMKSQMKGLEANVLAAAPDKAKQKQMEKSLDAFKKNFEAASNKAGKVEAEVKRLHTLIVDINSHKLKAQQDKLDKVNKELDECSSAI-------TKAQVAIKTAGRNLKKSEEIVERLETETKENEKLMEELM----EQLKKLEEQAGEIMKTCQDAE----EALPEVQEEHRGVLQEIKAVQ----------EKEHALQKESLNIRLKVEQIDTAISECQSK----SKHWDKEAT-------KIVLHSIDDKPAE-------ELPKLTPED---------LAAIKNPDV--IKNEIALLED--RCARMKPNLGAIAEFKKKEELYLQRVAELDEITTQRDDFKRGCEDLRKQRLNEFMAGFNIITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIYN-LSGGEKTLSSLALVFALHHFKPTPLYFMDEIDAALDFKNVSIVACYIYEQTKNAQFIIISLRNNMFEMADRLI 1270          

HSP 2 Score: 69.3218 bits (168), Expect = 2.744e-11
Identity = 48/159 (30.19%), Postives = 77/159 (48.43%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQ-AGINKATVCI----IFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPR 540
            IV   FKSYA    +  F   F+ I G NGSGKSN++D++ F+ G     ++R+  L  L++   +   I   TV +    I D        I   +F    ++R       + Y ING  A    V  + RS  +++++  FLI+QG + ++  MKP+
Sbjct:   94 IVNRNFKSYAGEQILGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY-RAQKIRSKKLSVLIHSSDEHKDIQSCTVEVHFQKIVDKEGDDYDVIPNSKFH---VSRTAGKDNSSAYHINGKKATFKDVGTVLRSHGIDLDHNRFLILQGEVEQIAMMKPK 248          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Match: smc1b (structural maintenance of chromosomes 1B [Source:ZFIN;Acc:ZDB-GENE-091217-1])

HSP 1 Score: 80.8777 bits (198), Expect = 6.495e-15
Identity = 171/763 (22.41%), Postives = 327/763 (42.86%), Query Frame = 1
Query: 1573 RRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDP---QFSLSLQVGGGGRLFNVIIDHDSVAAEL--FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFG------------------GEQELDHRIFERSRELLAMDN----------SIMSMQQRQKENADRFTQIEDNRKRHDEAS-AQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKL-YRKACEETKLAK------ENLANSASIKEK------------AQKEAESE-YKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANI--------EAAEKVVTNKIDSCRVSSE---KIIGHKESMSAFKKELDNQNRVLQEIEKQISQ---CKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKE-----YKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQA----RLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFG-NSQFIIVSLKDGMFNNANVLFK--TKFVDGVSTVSRHVNTSRRPMVERN 3621
            +RN  ++ ++ R  PD        V   LV L  P   ++ L++    G  +  +++    VA +   F K       TFLP+  +   P+ +    + +E+ G + V   ++  Q   + +  + FV G  L+  TL  A+T+AF    + + V  DG +F   G + G                  G +E   ++    REL+ +             ++ +Q R K      +++E  RK++  A   ++  +  EL  LE  +M  Q  N++      ESE+  I E + + E + + + C E  +A       + L     +++K            AQ E E E   K Q  +   E++ + VE   +IL ++     +E+++LLA +        E  E++V  K       SE   K+ GH+E  S    +L  Q + L   E  + Q   CK ++L   K   Q+   +S     IS  + DSE        +      I  + K       +   T ++  E      ++K+  L D+  ++S+  +L+ +  + +  E + ++++ ++      +      +++   +  +  K  E V    ++I+  L     A        P+   L DG+ +          +++ LSGG++S+ AL+L+ A+  F+PAP ++LDEVDAALD ++   + + I+EQ   N Q I++SLK+  ++ ++ L    ++F D + +    V+ +  P+ + N
Sbjct:  430 KRNEVFDSLH-RLYPDV-------VYGRLVDLCQPIHKKYQLAVTKVFGRYMNAIVVSSAKVARDCIQFIKEERAEPETFLPIEYLDVNPLNE----RLREVRGAKLVVDVVQCSQNAPQLKRVVQFVCGNALVCETLKDARTIAFGGPERRKTVALDGTLFSKSGVISGGSVYLRSKARRWEDKEMSGLKERKEQLTTELRELMKLRRKEADLKQITAQVLGIQTRLKYTK---SELEIIRKKNIPACHTEISRQESELSNLESQIMM-QTENVQV----IESEMMAIQEQVNQMEDMVFLEFCAEIGVANIREYELDYLRQQEELEQKRLQFETQRTRLTAQLEYEQEQLDKQQKNMSKMEDSVRKVED--DILAMK-----EEEERLLAVVDETQSKLSELNEQLVEQKSCVNDAKSELDIKVKGHREKSS----DLVKQQKELISAETALEQQRLCKHNLLLACKIEGQNLTLLSGTLDDISDVQLDSESQSTCTLDIYEREAQIVFDYKQLGDR--LMSLTTEEEVEEQLATMREKVSSL-DKLIQVSKTPNLKALEKMREVRESFHEVLSAFESSTIISKKCNQEFEQVKAKRFHLFSKCFEHVSVAVNQIYKQLCRNDSALAILSAENPDEPYL-DGISYNCVAPGKRFMAMDNLSGGEKSIAALALVFAIHSFRPAPFFVLDEVDAALDNTNIGKVTSYIREQSRENLQIIVISLKEEFYSRSDALLGVYSEFDDCMYSRLLSVDLTPYPLNDEN 1157          

HSP 2 Score: 56.225 bits (134), Expect = 2.621e-7
Identity = 46/166 (27.71%), Postives = 78/166 (46.99%), Query Frame = 1
Query:   85 IDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKC--GQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT 576
            I+ FKS+  + +I G    FN I G NGSGKSNI+DA+ F++G   +S +R    ++L++    G+     A+V + F       S  G    +E + +R I  G  + Y +N       +       + + V   + L+ QG +  +  M  +E   L E  +N+
Sbjct:    9 IENFKSWRGK-QIIGPFKRFNCIIGTNGSGKSNIMDALGFVMG-ERVSSLRVKYTKDLIHGANIGRPVSATASVTMRF------CSDTG----EETSFSRTI-SGESSDYRVNDRQVTLAKYTGQLEKIGIVVKARNCLVFQGAVESLAMMNAKERTKLFEHISNS 161          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: smc2 (structural maintenance of chromosomes 2 [Source:ZFIN;Acc:ZDB-GENE-030131-105])

HSP 1 Score: 370.548 bits (950), Expect = 2.859e-109
Identity = 244/659 (37.03%), Postives = 368/659 (55.84%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNS-----GELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGE 2037
            SIV+DGFKSYA+RTEI+ +DP FNAITGLNGSGKSNILDA+CF+LGI+NLS+VRA++LQELVYK GQAG+ KATV I FDN ++  SP+G+E   EIT+TRQ+V+GG+NKYLING+ A   RVQDLFRSV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YESK+    KTIEKK++KLKEI+ +L EEI P LEKLK ER+SYLEY K+ R+L+ L + ++A+++ T     ++A     +L+    +  E +++ E+++   E  + ++  ERDK     L  ++      Q+  A  ++ +    + +   + +  +L   M+EDA ++   +  +  ++          +++ +  Q A  R    + G  +        +LAE + +  +  S          ++L H Q  L Q  ++ G+T ++          L+ + + L  ++  L    N  +  + E  Q +  +LA      R   DR   I   P  +  Y  P   +D  R+ G+VA+L+ + DP  + +L+V  GG+L+NV+ D +     L E+ CL  R T +P   +  + +     R  +    ++ +W  L ++     Y    ++V G                     C CV   GE
Sbjct:    5 SIVVDGFKSYAQRTEISDWDPLFNAITGLNGSGKSNILDAVCFVLGISNLSRVRAASLQELVYKNGQAGVTKATVSITFDNRDRKQSPLGFEGHAEITVTRQVVIGGRNKYLINGVNATTARVQDLFRSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYESKKLAAQKTIEKKEAKLKEINDVLDEEISPTLEKLKQERTSYLEYSKLCRELDSLRRLVIAHQFCTASQGQESAALHLQKLRADEQEAREEVERLEKEEKKREGELREMERERDKEAGGDLARVEEALTHAQRAHAKAQSTLDIRTEALATERAHRDQLLANMREDASARDAKRSQVVALEAALASASACSQEAARGLQEAQARFAAASVGLSEDGQGGHAATLAEQILKCRQEASQAQTEAAQAQMKLSHVQRELQQRKAEEGRTTEAYTRDQQALSRLKARAQGLLRDMAALGYTGNTGDGGEVESVQKKMKELAAEESAMREKVDRA--IASMPQLQFDYRDPEQGWDRGRVRGLVASLLRVEDPAAATALEVVAGGKLYNVVTDTELTGKLLLERGCLRRRVTVIPRRSIRERCVCTRSPRLTQGRTDEDRIWVILFLMCSKYVYCVIWSWVSG---------------------CACVCGSGE 640          

HSP 2 Score: 276.944 bits (707), Expect = 5.714e-77
Identity = 151/280 (53.93%), Postives = 198/280 (70.71%), Query Frame = 1
Query: 2788 SALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKS-----LSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVN--TSRRP 3606
            +AL +++  H +  H++D+ D +R    LL  N WI  E   F +    YDF   D  +  +++ +LE  ++++   V+ R MN+L Q+EE+Y DLM K + V NDK  + + + ELD  K+E +  A  QV+ DF  IFSTLLPGSQARLTP E  S     L  GLEF++A G+VWKE+L+ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F  SQF++VSLKDGMFNNANVLFKT+FV+GVSTV+RH N  T+ RP
Sbjct:  909 AALTLTERGHAVGRHQRDALDVDR----LLKENAWISTERALFGRPNTAYDFAASDPSDAARRLSRLEQTRQRMVHTVNERAMNLLAQSEEKYVDLMKKKRIVENDKTKIFSAMQELDLKKNEALNLAWRQVNGDFSSIFSTLLPGSQARLTPVESSSSSTSSLLQGLEFRVALGSVWKENLSELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGHMLRTHFLTSQFVVVSLKDGMFNNANVLFKTRFVEGVSTVTRHTNASTTSRP 1184          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008608.1 (pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 gene:ENSPMAG00000007778.1 transcript:ENSPMAT00000008608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 3.930e-16
Identity = 151/666 (22.67%), Postives = 284/666 (42.64%), Query Frame = 1
Query: 1711 GRLFNVIID--HDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFG-GEQELDHRI------------FERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKR-----------------HDEASAQLRAKSFE------------LRQLERNM--MDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYK------QKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEG-KSLSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLF 3543
            G L N+++D    + A   + K       TF+ L+KM    + +  ++K+  + G E V    ++++  D+   +A  F     L+A  L+ A  VAF  + + R VT  G+V +  G++ G G + +  R+             ER    L  +++ M   Q+Q+   +   Q      R                   E S +L+ K  E            L++LE+ +     +Y  + ++  + E+E+K I   I E  +   KA ++ K+ K N         +   E  S+  KAQ  LK  +   K  E        E  +N Q   +L   +++ E+     +  C  + E+     + +S  ++EL  + + L E E+Q  Q ++  L     ++Q   ++S++N  +    K+          L      + DE     ++  +    N++ +E +       KI  LE+  + L  K +L  ++   + EE Y   +++   +   +   ++  ++L K + +        +     + +  L  G  A L   +     S+G+ F +      WK+  N LSGG+++L +L+L+ AL  +KP PLY +DE+DAALD  +   +   + EQ  N+QFII+SL++ MF  ++ L 
Sbjct:  646 GALDNIVVDTMDTAQACVTYLKKHNIGSATFIGLDKMR---VWEGTMKKS--VQGPEGVLRLFDLVRVGDEAVRTAFYFTLRDTLVANNLEQASRVAFQHQRRWRVVTLQGQVIETSGTMSGGGTRVMKGRMGSSVVSEVPQEEVERMEHKLQEESAKMEQYQQQRSQLEERVQTLQTSLRDMKYNLQKLSAGVKVQVEQEVSLKLQVKELEANVVAAAPDKNQLKKLEKTLEGFKKEYEKVSSRTGKIEAEVKRIHGLIMEITQGRLKA-QQDKVDKIN---------QQIDECVSDITKAQVALKTADRNLKKAEEALAKTEREQEENRQAIVRLNEELKSLEEAAAEIMKECTHAQER----GKEVSELQRELMGELKALSE-EEQGYQKEE--LAVRLKVEQFDTKISELNSMLKHFNKE----------LSKFKLHVLDEE---GEAPVLPTLGNRELEELEDPVALANKIAILEE--KTLQMKPNLGAISDYKKKEEIYLQRVSELDAITAQRDEFRHSYEDLRKSRLQEFMAGFNVITNKLKENYQMLTQGGDAELELVDSLDPFSEGIVFSVRPPKKSWKKIFN-LSGGEKTLSSLALVFALHHYKPTPLYFMDEIDAALDFKNVSIVALYVYEQTKNAQFIIISLRNNMFEMSDRLI 1273          

HSP 2 Score: 72.0182 bits (175), Expect = 6.893e-13
Identity = 45/156 (28.85%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKC-GQAGINKATVCIIFDN-SEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPR 540
            IV + FKSYA +  +  F   F+ I G NGSGKSN++D++ F+ G     ++R+  L  L++       +   TV + F    +K           E  ++R       + Y ++G  A    V  L RS  +++++  FLI+QG + ++  MKP+
Sbjct:   94 IVNENFKSYAGKQVLGPFHKRFSCIIGPNGSGKSNVIDSMLFVFGY-RAQKIRSKKLSVLIHNSEAHPDLYSCTVEVHFQKIVDKEGDDFDVIPSSEFYVSRSATKDSVSSYTVSGHKATFRDVGQLLRSHGIDLDHNRFLILQGEVEQIALMKPK 248          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002584.1 (pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gene:ENSPMAG00000002354.1 transcript:ENSPMAT00000002584.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.017e-15
Identity = 58/189 (30.69%), Postives = 91/189 (48.15%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY--KCGQAGINKATVCIIF--DNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT----KHYESKRDDTLKTIE 621
            I ++ FKSY K  +I G    F AI G NGSGKSN++DAI F+LG    S +R   L++L++    G+   NKA V +++  DN E            E   TR I +G  ++Y IN  +            + + +   +FL+ QG +  +    P+E   L EE + +      YE ++ + +K  E
Sbjct:    7 IELENFKSY-KGKQIIGPFKRFAAIIGPNGSGKSNLMDAISFVLG-EKTSNLRVKTLKDLIHGAPVGKPAANKAYVSMVYAEDNGE------------EKVFTRYI-IGSSSEYRINSKVVQLQEYSSELEKLGILIKARNFLVFQGAVESIAMKNPKERTQLFEEISRSGELATEYERRKREMMKAEE 180          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000346.1 (pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 gene:ENSPMAG00000000296.1 transcript:ENSPMAT00000000346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.452e-10
Identity = 51/170 (30.00%), Postives = 88/170 (51.76%), Query Frame = 1
Query: 3118 QNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLP--GSQARLTPPEGK-SLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQ-FGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSRHVNT---SRRP 3606
            Q   +++ +L+ +      E +    D I+  L     +QA L P   +    DG+ +         + ++ LSGG++++ AL+L+ A+  ++P+P ++LDE+DAALD ++   +   IKEQ   N Q I++SLK+ +F  A+ L       G   +S HV T   SR P
Sbjct: 1048 QMAFNKVQRLRFDRFNGCLEHLSIAIDDIYKKLAQNNSAQAFLGPENAEEPYLDGINYNCVAPGKRYQPMDNLSGGEKTVAALALLFAIHSYRPSPFFVLDEIDAALDNTNIGKVANYIKEQSVENFQVIVISLKEELFARADALIGVYPEQGDCLIS-HVVTMDLSRFP 1216          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Match: SMC1A (structural maintenance of chromosomes 1A [Source:HGNC Symbol;Acc:HGNC:11111])

HSP 1 Score: 51.6026 bits (122), Expect = 1.211e-6
Identity = 40/142 (28.17%), Postives = 77/142 (54.23%), Query Frame = 1
Query: 3022 DLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLL--PGSQARLTP--PEGKSLSDGLEFK-IAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALD 3432
            ++R M  L    +++ +   +++      +  +   +++ K + +      E V  + D+I+  L     +QA L P  PE   L DG+ +  +A G  ++  ++ LSGG++++ AL+L+ A   +KPAP ++LDE+DAALD
Sbjct:  655 NMRAMEKLESVRDKFQETADEFEAARKRAKKSKQAFEQIKKERFDRFNACFEAVSTNIDEIYKALSRNASAQAFLGPENPEEPYL-DGINYNCVAPGKRFR-PMDNLSGGEKTVAALALLFATHSYKPAPFFVLDEIDAALD 794          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC2 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; essential SMC chromosomal ATPase family member that forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for clustering of tRNA genes at the nucleolus [Source:SGD;Acc:S000001927])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 422/1194 (35.34%), Postives = 682/1194 (57.12%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTK----AIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTE--FAEMQKQEAVLKNAIKRAEDEVKEAKENV-------KKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQ-KQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDP--QFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEIL-GKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDE-------EAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFN---QSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVS 3579
            ++IDGFKSYA RT IT +DP FNAITGLNGSGKSNILDAICF+LGI ++S VRAS+LQ+L+YK GQAG+ KA+V I+FDN++KS+SPIG+    +I++TRQ+V+GG +KYLING  AP   V  LF+SVQLN+NNP+FLIMQG+ITKVLNMKP EILSL+EEAA TK +E +R+   +T+ KK++KL+E   +LTEEI+PKLEKL+ E+  +LE+Q    DLE   + +V+YEY   K    +I +  +    R+K  LN   E +KK  ++       I+ L E+ +++ ++K + +  E   ++++ +E  L N I R +  +    EN+       K L+ ++   +    + K A A  +  +  ++E+L K +  Y+  ++ +  + +G   S T  A G     LA+A    ++V++ +   ++++   +  L  +  KL +  K DN  EL  K  KQ     ++L+A +    +     +  +  +    S   +   + +   RR  + E  Y +P P+F++  + GVV  L  + +   +++ +LQ   GGRLFNV++     A +L E+  L  R T +PL+K+  +PI   V+  AK+I  GK  V  A+ +I++D+    A+ F+FG  LI    + AK + F  +I+ R +T  G+V+DPEG+L GG +     +    ++   +   I ++Q       +         ++     + L     +L   +RN+  +    I A+ +E   ++ E    I+  +   +K  EE    ++++    S K     E + E K    +L+  E       + F+++E + E L+ E   N+      L +IE+       K+++  +   KI G ++ +   + EL+ + + L +I+ ++++ +  + +       S L +  + H ++ ++ ++ + E+ I  L   + ++ D     N   Q+ GI      D   Y+++ ++L ++ ++L +KV+   MN++   E++ + L T  K +  DK  +Q  I +L++ K E + K  E+V  DF  IF+ LLP S A+L P EGK ++ GLE K+  GN+WKESL ELSGGQRSL+ALSLI+ALL+F+PAP+YILDEVDAALD+SHTQNIG +IK +F  SQFI+VSLK+GMF NAN +F+T+F DG S VS
Sbjct:    6 LIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSLQDLIYKRGQAGVTKASVTIVFDNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFEDRREKAERTMSKKETKLQENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDLEKTERIVVSYEYYNIKHKHTSIRETLENGETRMK-MLN---EFVKKTSEE-------IDSLNEDVEEIKLQKEKELHKEGTISKLENKENGLLNEISRLKTSLSIKVENLNDTTEKSKALESEIASSSAKLIEKKSAYANTEKDYKMVQEQLSKQRDLYKRKEELVSTLTTGI--SSTGAADGGYNAQLAKAKTELNEVSLAIKKSSMKMELLKKELLTIEPKLKEATK-DN--ELNVKHVKQCQETCDKLRARLVEYGFDPSRIKDLKQREDKLKSHYYQTCKNSEYLKRRVTNLEFNYTKPYPNFEASFVHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDKIYTRPISSQVLDLAKKIAPGK--VELAINLIRFDESITKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLLVDIQKYNQIQKQIETIQADLNHVTEELQTQYATSQKTKTIQSDLNLSLHKLDLAKRNLDANPSSQIIARNEEILRDIGECENEIKTKQMSLKKCQEEVSTIEKDMKEYDSDKGSKLNELKKELKLLAKELEEQESESERKYDLFQNLELETEQLSSELDSNKTLLHNHLKSIESL------KLENSDLEG-KIRGVEDDLVTVQTELNEEKKRLMDIDDELNELETLIKKKQDEKKSSELELQKLVHDLNKYKSNTNNMEKIIEDLRQKHEFLEDFDLVRNIVKQNEGI------DLDTYRERSKQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKDVTQGLEVKVKLGNIWKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFANANRVFRTRFQDGTSVVS 1168          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC3 (Subunit of the multiprotein cohesin complex; required for sister chromatid cohesion in mitotic cells; also required, with Rec8p, for cohesion and recombination during meiosis; phylogenetically conserved SMC chromosomal ATPase family member [Source:SGD;Acc:S000003610])

HSP 1 Score: 132.494 bits (332), Expect = 1.409e-31
Identity = 171/713 (23.98%), Postives = 323/713 (45.30%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKS---SSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYN-------RLKNQLNQEEETIKKNEQQKLNFENNIE-------KLCEERDKVHVEKLQNMKTEFAEMQKQ------EAVLKNA-IKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQ----------GQFDKLKEKLEKSK------QNYQSADQRLLNVNSGFFQSKTS-----NATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAA----ELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG 2070
            ++I GFK+Y   T I  F P  N I G NGSGKSN   AI F+L   + S ++    Q L+++     +  A+V I+F + + S    S +     DE+TI R + +  K+ Y +N        +  +  +   ++NNP+ ++ QG+I  + N K +E L LLE+    K +E K   +LK +E+ + K  +I+     E+  KL +++ ER    +Y ++ R+ +     L   E       ++  DG+YN       +   +L++ E+ I +  ++  + E +++       +  + R+    +KL N+  +  ++Q+Q      +  L +A +K  +  +++ K+ + K+  + +E  + +   KL +A +Q          G++ + K K E+        +  +S+ Q L  + S     +TS     +A     E L +++    D    L   +  L+H       L  KL ++   D   EL +K+++L T +E L ++VN    +Q    +     LA G     I+  ++   +   S E V+             G +  L+ + D ++    +V GG  LF++++D +  A     EL+       R TF+PLN++S      F      +I         ++ I+Y+ R+E A+  VFG  ++ +  D+ + +   ++ K   +T DG+  D  G L GG
Sbjct:    6 VIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLS-DDYSNLKREERQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSRGDDEVTIRRTVGLK-KDDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKLKASLKKMEETEQKKIQIN-KEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDRELNEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQAKLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRYQELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNELESQLQMDRTSLRKQYSAIDEEIEELIDSIN-GPDTKGQLEDFDSELIH-------LKQKLSES--LDTRKELWRKEQKLQTVLETLLSDVNQ---NQRNVNETMSRSLANG-----IINVKEITEKLKISPESVF-------------GTLGELIKVND-KYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKG--GRVTFIPLNRLSLDSDVKFPSNTTTQI----QFTPLIKKIKYEPRFEKAVKHVFGKTIVVK--DLGQGLKLAKKHKLNAITLDGDRADKRGVLTGG 675          

HSP 2 Score: 73.1738 bits (178), Expect = 2.031e-13
Identity = 62/234 (26.50%), Postives = 113/234 (48.29%), Query Frame = 1
Query: 2971 QKIEKLEDEKRKLS--RKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT-------------------------PPEGKS---LSDGLEFKIAFGNVWKESLN--ELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            Q +++L D   ++S  + V+ R      +  ER  DL  +  ++   K  +Q++I +L + K   +    ++V  +F+ +F  L+P   A+L                             GK    +  G+   ++F +   E L+  +LSGGQ+++ A++LILA+    PA  Y+ DE+DAALD  +   + T++KE   N+QFI  + +  M   A+  F+ K+ + +STV
Sbjct:  976 QLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASELDESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDHDESIDVDMDAESNESQNGKDSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYENKISTV 1209          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC4 (Subunit of the condensin complex; condensin reorganizes chromosomes during both mitosis and meiosis; forms a subcomplex with Smc2p that has ATP-hydrolyzing and DNA-binding activity, but other condensin subunits are required for chromatin binding; required for tRNA gene clustering at the nucleolus; potential Cdc28p substrate [Source:SGD;Acc:S000004076])

HSP 1 Score: 86.6557 bits (213), Expect = 1.646e-17
Identity = 55/193 (28.50%), Postives = 100/193 (51.81%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKC-GQAGINKATVCIIFDNSEKSSSPIGYEQFDE----ITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPRE-------ILSLLEEAANTKHYESKRDDTLKTIE 621
            +V++ FKSYA +  +  F  +F+A+ G NGSGKSN++D++ F+ G    +++R   L +L++K      +   +V + F      SS  G  + DE    + ITR+      +KY IN   +    V  L ++  +++++  FLI+QG +  +  MKP+        +L  LE+   T +Y+   ++ +  IE
Sbjct:  159 LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGF-RANKMRQDRLSDLIHKSEAFPSLQSCSVAVHFQYVIDESS--GTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIE 348          

HSP 2 Score: 70.4774 bits (171), Expect = 1.363e-12
Identity = 37/93 (39.78%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 3262 LSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVL 3540
             S+G+ F +        ++  LSGG+++L +L+L+ AL ++KP PLY++DE+DAALD  +   +   IKE+  N+QFI++SL++ MF  A  L
Sbjct: 1302 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQL 1394          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Match: SMC1 (Subunit of the multiprotein cohesin complex; essential protein involved in chromosome segregation and in double-strand DNA break repair; SMC chromosomal ATPase family member, binds DNA with a preference for DNA with secondary structure [Source:SGD;Acc:S000001886])

HSP 1 Score: 64.6994 bits (156), Expect = 7.942e-11
Identity = 46/172 (26.74%), Postives = 86/172 (50.00%), Query Frame = 1
Query:   85 IDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDN-SEKSSSPIG------YEQFDEIT-ITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT 576
            +  FKSY   T++   +  F +I G NGSGKSN++DAI F+LG+ + + +R++ L++L+Y+    G+        +DN    SS+P        Y++ +++  + R I   G   Y I+G             +  + +   +FL+ QG + ++    P E+  + EE + +
Sbjct:    9 LSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRS-NHLRSNILKDLIYR----GVLNDENSDDYDNEGAASSNPQSAYVKAFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSGS 175          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO40646 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7S6N1])

HSP 1 Score: 111.309 bits (277), Expect = 1.360e-24
Identity = 180/786 (22.90%), Postives = 342/786 (43.51%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY-KCGQAGINKATVCIIFD------NSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREI-------LSLLEEAANTKHYESKRDDTLKTI----EKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIK-KNEQQKLNFENNIEKL--CEERDKVHVEKLQNMKTEFAEMQKQ--------EAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELE---QKQKQLATEIEQLKANV----NAINYSQPEWEQAQHDQLATGSDLRRI---LTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLP--DPQFSLSLQVGGGGRLFNVIIDHDSVA---AELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRK--AKEILGKENVWSALEVIQY-DKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFEL-RQLERNMMDDQYLN 2292
            IV + FKSYA   E+  F  +F++I G NGSGKSN++DA+ F+ G  +   +R   + +L++       +   TV + F       N E    P          ++R       + Y +NG   P   V  L R V +++++  FLI+QG + ++  MKP+ +       L  LE+   +  Y+   ++  K +    E +  KL  +  +  E+ + +  K +               +EY+N             I    +  + R   + +Q EE  + K ++ K  F+   ++L  C +R K   ++ + M  E  +++K          A  ++ +K  ED  K  K N KKLQK ++++ E     K A  K Q Q ++L++K+++ +      + +L  V +G  +S+T        E   + ++   DVN T + +++     +   +Q   K  QT   +    LE   QKQ Q  +EI+ ++  +    N +  ++ + E+A   +  +  +LR I   + + ++ ++ + S   V         + +I G+   L  L   D ++ +++    G  L +++ D    A    +  +KN +    TF+ L+K+        V RK  + +I    NV    ++++  D +  +A  F     L+A  L+ A  +AF    + R VT  G + D  G++ GG   +       S         + SM+Q+ ++      +  + +K+ +EA  + + K   L  QLE+N M+ Q L+
Sbjct:   19 IVNENFKSYAGVQELGPFHKSFSSIVGPNGSGKSNVIDAMLFVFGYRS-KMIRTKKVSQLIHNSSAHPNVASCTVSVHFQRIIDLVNDEFEVVPDS-----NFVVSRTARKDNSSDYHVNGRKMPFKEVAKLLRDVGIDLDHNRFLILQGEVEQISMMKPKALTEHEDGMLEYLEDIIGSSRYKEPIEELAKEVEVLNEARGEKLNRVKAVEKEKDELEGSKDEA--------------VEYIN---------MENGITRKRNTLFQRYIYECSQNEEKAQSKRDEVKTGFDELHKQLADCSDRKKTKGKEYKGMTKECDKLRKVAEETKENFAAYERDDLKLRED-FKHGKVNGKKLQKSLEKEKEKLASLKDAPEKNQKQVEELEKKIQQLESQKIKEEDKLAEVMAG-LKSETEGLQNEKEEKEKQLMEKNKDVNETKSKMDVAKSELEIYNSQ--HKNAQTQLREAHANLESVIQKQTQRKSEIKSIEKELPDLKNNLKKAEADLEKAVQGEAKSSQELRSIRSKVEEARSSLQASRSRGNVLEALMKQKAAGKIPGLYGRLGDLGAIDDKYDIAISTACGA-LDHIVCDTMETAQTCVQYLKKNNI-GAATFIGLDKVE-------VWRKDASSKIQTPSNVPRLYDLVRVKDAKVSTAFYFALRNTLVADELEQATRIAFQGNKRWRVVTLQGSLIDQSGTMSGGGTRVAKGRMCSSFVSDVSPQQLKSMEQKLEQEEKATEEYREQKKQLEEAVDEQKKKVSNLEHQLEKNRMEVQALS 762          

HSP 2 Score: 73.1738 bits (178), Expect = 5.669e-13
Identity = 41/95 (43.16%), Postives = 64/95 (67.37%), Query Frame = 1
Query: 3262 LSDGLEFKI-AFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLF 3543
             S+G+ F +      WK +++ LSGG+++L +L+L+ AL  FKP PLY++DE+DAALD  +   +   IKE+  N+QFII+SL++ MF  A+ L 
Sbjct: 1105 FSEGIVFSVRPPKKSWK-NISNLSGGEKTLSSLALVFALHHFKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIIISLRNNMFELADRLI 1198          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO34136 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ80])

HSP 1 Score: 73.559 bits (179), Expect = 4.604e-13
Identity = 42/148 (28.38%), Postives = 69/148 (46.62%), Query Frame = 1
Query: 1642 GVVANLVS--LPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFE---KNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGG 2070
            GV   L+     + +F  +++V  G RLF++I+D D  A+ +     +  +P   TF+PLNK+  KP               ++V   +  + +D     A+   FG  LI R LD+A   +  E +   C+T DG+     G+L GG
Sbjct:  512 GVYGPLIENFTCNEKFFTAVEVTAGNRLFHIIVDTDKTASLILSTMNRQKMPGEVTFMPLNKVKIKPT---------NFPKSDDVMPMISKLNFDDTLRPAMELAFGKTLICRDLDVATQYSKSENLD--CITLDGDQVSRRGALTGG 648          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO34135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ79])

HSP 1 Score: 53.1434 bits (126), Expect = 1.405e-8
Identity = 33/87 (37.93%), Postives = 54/87 (62.07%), Query Frame = 1
Query: 3316 LNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            +N+LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD    + +  +I+     +QFI  + +  +  +A+  +  KF + VS +
Sbjct:    1 MNQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDPQFRKAVAEMIRNLAVKAQFITTTFRPELLESADKFYGVKFRNKVSHI 87          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Match: EDO49596 (Structural maintenance of chromosomes protein [Source:UniProtKB/TrEMBL;Acc:A7RFF3])

HSP 1 Score: 57.7658 bits (138), Expect = 2.858e-8
Identity = 43/133 (32.33%), Postives = 74/133 (55.64%), Query Frame = 1
Query: 3169 AHEQVDRDFDKIFSTLL--PGSQARLTPPEGK-SLSDGLEFK-IAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTII----KEQFGNSQFIIVSLKDGMFNNANVLF 3543
            A E V    D I+  L   P +QA L P + +     G+ +  +A G  ++  ++ LSGG++++ AL+L+ ++  ++PAP ++LDE+DAALD ++   +   I    KE F   Q I++SLK+  +  A  L 
Sbjct: 1063 AFEHVSTKIDDIYKELANNPSAQAFLGPEDAEEPYLGGINYNCVAPGKRFR-PMDNLSGGEKTVAALALLFSIHSYQPAPFFVLDEIDAALDNTNINKVARHIINQTKEYF---QCIVISLKEEFYTRAEALI 1191          

HSP 2 Score: 57.3806 bits (137), Expect = 4.438e-8
Identity = 39/116 (33.62%), Postives = 55/116 (47.41%), Query Frame = 1
Query:   85 IDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAP 432
            ++ FKSY     I  F   F AI G NG GKSN++DAI F+ G    S +R   +++L        I+ A V     +S K ++    E   EI  TR+IV  G    + N +  P
Sbjct:    9 LENFKSYKGNHTIGPF-YRFTAIIGPNGCGKSNLMDAISFVFG-ERTSSLRVKTVKDL--------IHGAPVGKPVASSAKVTAVYAEEDGTEIRFTRKIVGSGTESRIDNKVFTP 114          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc2 (structural maintenance of chromosomes 2 [Source:NCBI gene;Acc:101160532])

HSP 1 Score: 777.319 bits (2006), Expect = 0.000e+0
Identity = 482/1197 (40.27%), Postives = 741/1197 (61.90%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVE---SDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQ-KQLATEIEQLKANVNAINYSQPEWEQ--AQHDQLATGSDLRRILTDRQTFIR---RNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQL----ERNMMDDQYLNIK---AKYDETESELKEITEAIRENE-------KLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDS--CRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+I+GFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLS VRASNLQ+LVYK GQ GI KATV I FDNS KS SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP EIL+++EEAA T+ YE K+    +TIEKK++KL+EI  IL EEI P ++KL+ ERSSYLEYQK++R++++L++  VA+ +   +     +      ++  + + +  + +NE +       I++L ++ D+    +L+ ++   A +Q+++A  ++++   +  +K+  +  K+L K M+ED +     +  ++K+  Q   L+ + +K+    ++A+Q    V++G     ++N  G  A L  + +  +   S  +       + L H Q+   +L +K  +  K D+  + +Q   K + +  E+L+A +  +NY   + E    +  QL+     R +   ++TF R   R PS    Y  P   +D  ++ G++ANL+S+ D  ++ +L+V  GGRL+N+++D +    +L EK  L  R T +PLNK+S K + D V+  AK ++G++NV +AL ++ Y+     A+ +VFG  L+  TLD AK VAFD+++  + VT  G++FDP+G+L GG +     I    +E+  + +S+          +D+  +++D  ++     + L+  + + RQL    E  + ++Q L  K   + + + + EL+ + +AI E+E       +L ++A E+ K+ +  + N+ + +EK  K A+ +  KA+ +     +  K  + + E + LE  +  +EQ   +Q +  ++ A K    +IDS  C V+      +KE++   ++EL     V+   +K+I        +  +  ++  L++ +  H IS H KDS+DA  K+ ++L  + WI  E   F Q    YDF   + +E  Q+++KLE+   KL R V+ R MN+L + EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A+L P +G  + DGLEFK+A G+ WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F  SQF++VSLKDGMF NANVLFKTKFVDG+STV+R
Sbjct:    5 SIIIEGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSHVRASNLQDLVYKNGQGGITKATVSITFDNSNKSQSPLGFETHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILAMIEEAAGTRMYECKKISAQRTIEKKEAKLREIQTILDEEITPTMQKLQEERSSYLEYQKLMREIQHLSRLYVAWLFVCAEETKVKSAENLKVMQGNIVKMQAKVSENESKIQELSAQIQELQKKNDQEVNGELKTLEMSLASVQREDAKAQSSLDLKKQNLKDETKKRKELVKSMEEDKKVLVVKEKEVSKLSEQLQALQVEGQKNTAELEAAEQHFKAVSAGL----STNEDGEEATLAGQMMACKNEMSKADTEAKQAQMTLKHAQA---ELKTKQAEMKKMDSGYKKDQDTFKAVKSSREKLEAELAKLNYEDGKEESLMEKRRQLS-----REVAQLKETFDRLMSRFPSLRFEYKDPERGWDRSKVKGLLANLISVSDVSYATALEVVAGGRLYNIVVDTEVTGKKLLEKGELQRRYTIIPLNKISAKTLNDKVIHTAKRLVGEDNVHTALSLVGYESDLRKAMEYVFGSTLVCDTLDNAKKVAFDKQVMTKTVTLGGDIFDPQGTLSGGARSQSASILSSLQEVKDVQDSL----------SDKEAKLQDTERQM----SSLKGTAEKYRQLKQQHELKVEEEQILQTKLQQSSFHQQQEELERLQKAIDESEATLRLTKELQKRAEEKYKVLENKMKNAEAEREKELKAAQEKLNKAKAKADAFNKTLKQKQQESEAVALELEELRREQATYEQQIQAVDEAMKAFQEQIDSMACTVTQ-----NKEAVRKAQEELTKLKEVIMAQDKEIKGKNSEANKIREQNNEVQLKIKEQEHNISKHHKDSQDAADKVARMLEEHDWIQSERHFFGQPNSSYDFKVNNPREAGQRLKKLEETTSKLERNVNKRAMNMLNEAEERYNDLMKKKRIVENDKAKILQTIEELDQKKNEALNLAWQKVNKDFGSIFSTLLPGATAKLAPQQGCGVLDGLEFKVALGDTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRRSQFVVVSLKDGMFTNANVLFKTKFVDGMSTVTR 1170          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc2 (structural maintenance of chromosomes 2 [Source:NCBI gene;Acc:101160532])

HSP 1 Score: 722.62 bits (1864), Expect = 0.000e+0
Identity = 465/1197 (38.85%), Postives = 718/1197 (59.98%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVE---SDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQ-KQLATEIEQLKANVNAINYSQPEWEQ--AQHDQLATGSDLRRILTDRQTFIR---RNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQL----ERNMMDDQYLNIK---AKYDETESELKEITEAIRENE-------KLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQ---QQLLANIEAAEKVVTNKIDS--CRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTVSR 3582
            SI+I+GFKSYA+RTEI GFDP FNAITGLNGSGKSNILD+ICFLLGI+NLS VRASNLQ+LVYK GQ GI KATV I FDNS KS SP+G+E  DEIT+TRQ+V+GG+NKYLING+ A N RVQDLF SV LNVNNPHFLIMQGRITKVLNMKP E+ +L +E                    K S ++ +  IL EEI P ++KL+ ERSSYLEYQK++R++++L++  VA+ +   +     +      ++  + + +  + +NE +       I++L ++ D+    +L+ ++   A +Q+++A  ++++   +  +K+  +  K+L K M+ED +     +  ++K+  Q   L+ + +K+    ++A+Q    V++G     ++N  G  A L  + +  +   S  +       + L H Q+   +L +K  +  K D+  + +Q   K + +  E+L+A +  +NY   + E    +  QL+     R +   ++TF R   R PS    Y  P   +D  ++ G++ANL+S+ D  ++ +L+V  GGRL+N+++D +    +L EK  L  R T +PLNK+S K + D V        G++NV +AL ++ Y+     A+ +VFG  L+  TLD AK VAFD+++  + VT  G++FDP+G+L GG +     I    +E+  + +S+          +D+  +++D  ++     + L+  + + RQL    E  + ++Q L  K   + + + + EL+ + +AI E+E       +L ++A E+ K+ +  + N+ + +EK  K A+ +  KA+ +     +  K  + + E + LE  +  +EQ   +Q +  ++ A K    +IDS  C V+      +KE++   ++EL     V+   +K+I        +  +  ++  L++ +  H IS H KDS+DA  K+ ++L  + WI  E   F Q    YDF   + +E  Q+++KLE+   KL R V+ R MN+L + EERY+DLM K + V NDK  +   I+ELD+ K+E +  A ++V++DF  IFSTLLPG+ A+L P +G  + DGLEFK+A G+ WKE+L ELSGGQRSLVALSLILA+L FKPAP+YILDEVDAALD+SHTQNIG +++  F  SQF++VSLKDGMF NANVLFKTKFVDG+STV+R
Sbjct:    5 SIIIEGFKSYAQRTEINGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSHVRASNLQDLVYKNGQGGITKATVSITFDNSNKSQSPLGFETHDEITVTRQVVIGGRNKYLINGVNANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEVCTLFDE--------------------KKSIIETLLLILDEEITPTMQKLQEERSSYLEYQKLMREIQHLSRLYVAWLFVCAEETKVKSAENLKVMQGNIVKMQAKVSENESKIQELSAQIQELQKKNDQEVNGELKTLEMSLASVQREDAKAQSSLDLKKQNLKDETKKRKELVKSMEEDKKVLVVKEKEVSKLSEQLQALQVEGQKNTAELEAAEQHFKAVSAGL----STNEDGEEATLAGQMMACKNEMSKADTEAKQAQMTLKHAQA---ELKTKQAEMKKMDSGYKKDQDTFKAVKSSREKLEAELAKLNYEDGKEESLMEKRRQLS-----REVAQLKETFDRLMSRFPSLRFEYKDPERGWDRSKVKGLLANLISVSDVSYATALEVVAGGRLYNIVVDTEVTGKKLLEKGELQRRYTIIPLNKISAKTLNDKV--------GEDNVHTALSLVGYESDLRKAMEYVFGSTLVCDTLDNAKKVAFDKQVMTKTVTLGGDIFDPQGTLSGGARSQSASILSSLQEVKDVQDSL----------SDKEAKLQDTERQM----SSLKGTAEKYRQLKQQHELKVEEEQILQTKLQQSSFHQQQEELERLQKAIDESEATLRLTKELQKRAEEKYKVLENKMKNAEAEREKELKAAQEKLNKAKAKADAFNKTLKQKQQESEAVALELEELRREQATYEQQIQAVDEAMKAFQEQIDSMACTVTQ-----NKEAVRKAQEELTKLKEVIMAQDKEIKGKNSEANKIREQNNEVQLKIKEQEHNISKHHKDSQDAADKVARMLEEHDWIQSERHFFGQPNSSYDFKVNNPREAGQRLKKLEETTSKLERNVNKRAMNMLNEAEERYNDLMKKKRIVENDKAKILQTIEELDQKKNEALNLAWQKVNKDFGSIFSTLLPGATAKLAPQQGCGVLDGLEFKVALGDTWKENLTELSGGQRSLVALSLILAMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFRRSQFVVVSLKDGMFTNANVLFKTKFVDGMSTVTR 1142          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:100049276])

HSP 1 Score: 187.963 bits (476), Expect = 6.681e-48
Identity = 307/1291 (23.78%), Postives = 557/1291 (43.14%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXX--XXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNAD------GEYNR-LKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESD--VNITLNTLNLRLVHTQSLLNQLASKLGQT--NKSDN---SGELEQKQKQLATEIEQLKANVNAINYSQPE--------WEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELV-----YNRPRPDFDSRRI--------IGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAEL---FEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNM--MDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKA---QDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIY----DFTNKDWKEYKQKIEKLEDEKRKLSRKVD-----LRGMNVLGQTE-ERYSDL---------------MTKY----KKVLND-------KQVLQNVIDELDK--------------LKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT----PPEGKSLSD------------------------GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            ++I GF+SY  +T +  F P  N I G NGSGKSN   AI F+L     S +R      L+++     +  A V IIFDNS+ +  PI  E   E+++ R+++   K++Y ++  M   N V +L  S   + +NP++++ QG+I ++      + L LL E A T+ Y+ ++++++  +++ + K ++I+++L   EE    LE  K E + Y ++ K+ R LEY    +   E   T+A +D         G+ +R L++      + +++ E+     ++ I  + EER+++  E+ + +K        Q   L+   K  +DE+    E  K+L K+ ++  E  ++ +  + + + +F+ +KEK E+       A Q   ++ +   Q + S  T           K E D  +   L +L+  +   +  +  +   L  T  NK  N     +L+Q   ++ T +E+L      +   + E        W +   +Q A  +  R  L  +Q  +R      ++      N+    F  + I         G+V N     +P F   ++V  G RLF  I++ D V+ ++   F K  LP   TFLPL+K+  +         A  ++ K         ++Y   ++ A   VFG  LI R+++++  +A        C+T +G+     G+L GG  +      E  +++   +  +  ++ +  EN  R  +  +N                E+ QL   M  ++ Q    KA  D   SE+K + E  +++EK +       +  + +L    S +E  + E  ++       +DQ ++D+            LN E    +Q+ +QLL                 R+  E I+   E+        +N  + L ++E+++++ +++  E G  +  +   +  IN R+      SED +  I K   T   I D  K   +   I     D  N D KE    +EK+ + +  L +K +     +R +  L Q   E+Y  L               + KY    KK L+        K+ L    DELD+               K E I+   +QV ++F ++F  L+PG +A L       EG    D                        G+  +++F     E   + +LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD  H + +  +I E  G++QFI  + +  +  +A+  +  KF + VS +
Sbjct:    6 VIIQGFRSYRDQTVVDPFSPKHNVIVGRNGSGKSNFFYAIQFVLS-DEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSD-NRLPIDKE---EVSL-RRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYT---IYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSKISAMKEEREQLSAERQEQIK--------QRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNMVKEKEERGISRLAQATQERTDLYAK--QGRGSQFTS----------KEERDKWIKKELKSLDQAINDKKRQIAAIHKDLEDTEANKEKNLEQYNKLDQDLNEVKTRVEELDKKYYEVKNKKDELQSERNYLWREENAEQQALAAK-REDLEKKQQLLRAATGKAILNGIDSINKVLEHFRRKGINQHVINGYHGIVMNNFEC-EPAFYTCVEVTAGTRLFYHIVETDEVSTKILMEFNKMNLPGEVTFLPLSKLDVRDTAYPETNDAIPMISK---------LRYSPNFDKAFKHVFGKTLICRSMEVSTQLA--RAFTMDCITLEGDQVSHRGALTGGYYDTRKSRLELQKDMRKAEEELTELEAKLNENLRRNIERINN----------------EIDQLMNQMQQIETQQRKFKASRDSILSEMKMLKEKRQQSEKTFMPKQRSLQSLEASLHAMESTRESLKAELGTDLLSQLSLEDQRRVDD------------LNDEIRQLQQDNRQLLNE---------------RIKLEGIMTRVETYLN-----ENLRKRLDQVEQELNELRET--EGGTVLTATTSELDGINKRVKETLSRSEDLDSLIDK---TEGEIKDHIKSMERWKNIEKEQNDAINHDTKE----LEKMTNRQGMLLKKKEECMKKIRELGSLPQEAFEKYQTLTLKQLFRKLEQCNTELKKYSHVNKKALDQFVNFSEQKEKLIKRQDELDRGYKSIMELMNVLELRKYEAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGSQSQDEEGGADSERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSDMIVELAGHAQFITTTFRPELLESADKFYGVKFRNKVSHI 1197          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc3 (structural maintenance of chromosomes 3 [Source:NCBI gene;Acc:100049276])

HSP 1 Score: 105.145 bits (261), Expect = 2.263e-22
Identity = 101/373 (27.08%), Postives = 194/373 (52.01%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXX--XXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNAD------GEYNR-LKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKS 1170
            ++I GF+SY  +T +  F P  N I G NGSGKSN   AI F+L     S +R      L+++     +  A V IIFDNS+ +  PI  E   E+++ R+++   K++Y ++  M   N V +L  S   + +NP++++ QG+I ++      + L LL E A T+ Y+ ++++++  +++ + K ++I+++L   EE    LE  K E + Y ++ K+ R LEY    +   E   T+A +D         G+ +R L++      + +++ E+     ++ I  + EER+++  E+ + +        KQ   L+   K  +DE+    E  K+L K+ ++  E  ++ +  + + + +F+ +KEK E+ 
Sbjct:    6 VIIQGFRSYRDQTVVDPFSPKHNVIVGRNGSGKSNFFYAIQFVLS-DEFSHLRPEQRLALLHEGTGPRVISAFVEIIFDNSD-NRLPIDKE---EVSL-RRVIGAKKDQYFLDKKMVTKNDVMNLLESAGFSRSNPYYIVKQGKINQMATAPDSQRLKLLREVAGTRVYDERKEESISLMKETEGKREKINELLKYIEERLHTLEDEKEELAQYQKWDKMRRALEYT---IYNQELNETRAKLDELSSKRETCGDKSRQLRDAQQDARDKVEETERVVRELKSKISAMKEEREQLSAERQEQI--------KQRTKLELKAKDLQDELAGNSEQRKRLLKERQKLLEKIEEKQKELQETEPKFNMVKEKEERG 361          

HSP 2 Score: 52.373 bits (124), Expect = 3.515e-6
Identity = 54/173 (31.21%), Postives = 82/173 (47.40%), Query Frame = 1
Query: 3061 RYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLT----PPEGKSLSD------------------------GLEFKIAFGNVWKE--SLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIG---TIIKEQFG 3480
            R  +L   YK ++     L NV+ EL K   E I+   +QV ++F ++F  L+PG +A L       EG    D                        G+  +++F     E   + +LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+D ALD  H + +      I ++FG
Sbjct:  964 RQDELDRGYKSIME----LMNVL-ELRKY--EAIQLTFKQVSKNFSEVFQKLVPGGKATLVMKKGDAEGSQSQDEEGGADSERGSGSQSSVPSVDQFTGVGIRVSFTGKQGEMREMQQLSGGQKSLVALALIFAIQKCDPAPFYLFDEIDQALDAQHRKAVSGKKRRITDEFG 1129          
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Match: smc1al (structural maintenance of chromosomes 1A [Source:NCBI gene;Acc:100049244])

HSP 1 Score: 79.337 bits (194), Expect = 2.275e-14
Identity = 56/189 (29.63%), Postives = 95/189 (50.26%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVY--KCGQAGINKATVCIIF--DNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT----KHYESKRDDTLKTIE 621
            I I+ FKSY  R +I G    F AI G NGSGKSN++DAI F+L     S +R   L++L++    G+   N+A V +++  DN E            E T TR +++G  ++Y IN  +       +    + + +   +FL+ QG +  +    P+E  +L EE + +    + Y+ ++ + +K  E
Sbjct:    7 IEIENFKSYKGR-QIIGPFHKFTAIIGPNGSGKSNLMDAISFVLA-EKTSNLRVKTLKDLIHGAPVGKPAANRAFVSMVYQEDNGE------------ERTFTR-VIIGSSSEYRINSKVVGLPDYSEELEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDRRKKEMVKAEE 180          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000059543.1 (SMESG000059543.1)

HSP 1 Score: 2134.38 bits (5529), Expect = 0.000e+0
Identity = 1071/1078 (99.35%), Postives = 1075/1078 (99.72%), Query Frame = 1
Query:   76 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVVTNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSDGLEFKIAFGNVWK 3309
            SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDKILTEEIKPKLEKLKLERSSYLEYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQK+LATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNP YELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKE+LGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQL+ANIEAAEKVVTNKIDSCRVSSEKIIGHKE MSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLS+GLEFKIAFGNV K
Sbjct:    5 SIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDKILTEEIKPKLEKLKLERSSYLEYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMKTEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKLAIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGELEQKQKKLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQTFIRRNPRYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGGRLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEMLGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKENADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDETESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESEYKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLIANIEAAEKVVTNKIDSCRVSSEKIIGHKEIMSAFKKELDNQNRVLQEIEKQISQCKDSVLECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKHFNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSEGLEFKIAFGNVGK 1082          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017172.1 (SMESG000017172.1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.589e-22
Identity = 58/191 (30.37%), Postives = 103/191 (53.93%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDEITIT-RQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEI 648
            ++I GF+SY  +T    FDP  N I G NGSGKSN   AI F+L     S +       L+++     +  A V IIFDNS+          FD+  ++ R+I+   K++Y ++  M     V +L  S   + +NP++++ QG+IT++      + L LL E A T+ Y+ +++++ +  ++ ++K+ +I
Sbjct:    6 VIIQGFRSYRDQTCPGEFDPHHNIIVGRNGSGKSNFFQAIQFVLS-DEYSHLSPQERINLLHEGTGPRVVSAYVEIIFDNSDNRIP------FDKTEVSLRRIIGNKKDQYFLDKKMVTKTDVMNLLESAGFSRSNPYYIVKQGKITQLATAPDNQRLKLLREVAGTRVYDERKEESKQIFKESEAKMDQI 189          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000022017.1 (SMESG000022017.1)

HSP 1 Score: 100.138 bits (248), Expect = 6.738e-21
Identity = 163/725 (22.48%), Postives = 302/725 (41.66%), Query Frame = 1
Query:   79 IVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLGITNLSQVRASNLQELVYKC--GQAGINKATVCIIFDNSEKSSSPIGYEQFDEITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRITKVLNMKPREILSLLEEAANT----KHYESKRDDTLKTIEKKDSKLKEIDXXXXXXXXXXXXXXXXXXXXXXXYQKIVRDLEYLNKFLVAYEYTTTKAIVDNADGEYNRLKNQLNQEE----------ETIKKNEQQKLNFENNIEKLCEERDKVHV-EKLQNMKTEFAEMQKQEAVLKNAIKRAEDEV-KEAKENVK---KL------QKQMKEDAESQKQTKLA----IAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLAELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSD--NSGELEQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATG---------------SDLRRILTDRQTFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDP---QFSLSLQVGGGGRLFNVIIDHDSVAAELFE--KNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEILGKENVWSALEVIQYDKR-YESAINFVFGGFLIARTLDMAKTVAFDERIKCRCVTFDGEVFDPEGSLFGGEQELDHR 2091
            I ID FKSY  +  I  F   F AI G NGSGKSN++DAI F+LG  +   +R   L +L++    GQ     A+V  I++  +   S              +I+    ++Y IN      +          + +   +FL+ QG +  +     +E   + EE + +      YE  +++  K  E+    L +                                     K +VA E    K  +D A  +Y +LK +LN +             ++ NE QK + +   E L  E  +  + E++++ + +  +  ++++ ++  IK+ E ++ K+  E++K   KL      QK+ K+  ES +Q  LA    +A++Q Q D    ++E+ K  Y+   Q  ++V  G      +N      +L  +  +  S ++  L+ L+      + + + L  +  +   S      EL + +K+L    E + ++  AIN  Q E E+    ++ +                S+L     ++    R     EL+ N  R         GV   L+ +  P   ++ +++    G  +  ++ D    A +  +  K+      TFLPL+ +  +PI +    K ++I    NV   L+VIQ++    + A+ F  G  L+  T++ A+TVAF+   + + V+ +G +F   G + GG  +L  R
Sbjct:   13 IEIDNFKSYKGKQTIGPF-SQFTAIIGPNGSGKSNLMDAISFVLG-ESTKNLRVKRLNDLIHGANFGQPVAKTASVTAIYEIDQNQQSRFS-----------RIIHNNTSEYKINDKSVKIDEYAYQLEQFNILMKAKNFLVFQGTVESIAMKNAKERCQMFEEISKSIEFKAEYERSKEEVRKLEEEATLNLNK------------------------------------KKNIVA-ERKEAKIEIDEA-AKYKKLKTELNTKRIELHLLKLFYNEVETNEIQKEHVKKKEELLSHENKRNEIDEQIKSHRKKVTKFNREQSGIEQEIKKCEQDISKKRPEHIKVHQKLKHLMDKQKESKKAYESARQQHLANQEELAQLQSQMD----RIEQLKSEYE-LKQSQISVEKGRNLELETNQLQEYHKLKQKVAEKTSHLSAVLDALSREYNEQKDIYDALERRRNEIASSQKRKESELNESRKRLQKLREYIDSSNRAIN-EQKEAEETIRVEVESATKRIEEINKELELVVSNLGEARVEKHESSRAAKKQELIENLKRL------FPGVHGRLLEMCQPAHRKYQVAITKVLGKYMDAIVCDTQKTAKDCIQYMKDQRIEPETFLPLDFLDVRPIDE----KLRDIREPPNVHLVLDVIQFEPAIIKKALQFACGNALVCDTVEHARTVAFNTGERKKTVSLEGTLFQRSGVISGGASDLKAR 670          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.620e-14
Identity = 65/233 (27.90%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 2941 FTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSD---------------------GLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            F +K  K+  + ++K   E ++ S  V+ + ++      E    L+ + +++    Q + +++  LD  K E I    +QV   F +IF  L+P  +A L   +GK                         G+E     G+   + +N+LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+DAALD  + + +  +IK    ++QFI  + +  M   A   +  KF + VS +
Sbjct:  664 FNDKTMKQLYKLLDKANREIKRYSH-VNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 895          
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Match: SMESG000017173.1 (SMESG000017173.1)

HSP 1 Score: 77.411 bits (189), Expect = 5.147e-14
Identity = 65/233 (27.90%), Postives = 112/233 (48.07%), Query Frame = 1
Query: 2941 FTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEERYSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFSTLLPGSQARLTPPEGKSLSD---------------------GLEFKIAFGNVWKESLNELSGGQRXXXXXXXXXXXXRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKDGMFNNANVLFKTKFVDGVSTV 3576
            F +K  K+  + ++K   E ++ S  V+ + ++      E    L+ + +++    Q + +++  LD  K E I    +QV   F +IF  L+P  +A L   +GK                         G+E     G+   + +N+LSGGQ+SLVAL+LI A+ +  PAP Y+ DE+DAALD  + + +  +IK    ++QFI  + +  M   A   +  KF + VS +
Sbjct:  674 FNDKTMKQLYKLLDKANREIKRYSH-VNKKALDQFVSYNEEKEKLLKRKEELDKGHQAIIDLMKALDHQKYEAIVLTFKQVSHYFQEIFKKLVPDGRAELIIRKGKHDDTLLDDEEDPSSSIPEVERFTGVGIEVSFTGGDAQMKDMNQLSGGQKSLVALTLIFAIQKCDPAPFYLFDEIDAALDPQYRKAVADMIKGLSKDAQFITTTFRPEMLEAAERFYGVKFRNKVSHI 905          
The following BLAST results are available for this feature:
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMC20.000e+040.41structural maintenance of chromosomes 2 [Source:HG... [more]
SMC20.000e+040.41structural maintenance of chromosomes 2 [Source:HG... [more]
SMC20.000e+040.41structural maintenance of chromosomes 2 [Source:HG... [more]
SMC39.223e-5024.46structural maintenance of chromosomes 3 [Source:HG... [more]
SMC27.524e-4550.99structural maintenance of chromosomes 2 [Source:HG... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mix-14.477e-8332.33Mitotic chromosome and X-chromosome-associated pro... [more]
smc-31.753e-2233.51Structural maintenance of chromosomes protein 3 [... [more]
smc-31.755e-2233.51Structural maintenance of chromosomes protein 3 [... [more]
smc-42.621e-1933.55Structural maintenance of chromosomes protein 4 [... [more]
smc-42.621e-1933.55Structural maintenance of chromosomes protein 4 [... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SMC20.000e+036.76gene:FBgn0027783 transcript:FBtr0087461[more]
SMC31.952e-2624.64gene:FBgn0015615 transcript:FBtr0074290[more]
SMC12.153e-1228.57gene:FBgn0040283 transcript:FBtr0084541[more]
glu5.578e-1228.09gene:FBgn0015391 transcript:FBtr0080935[more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc20.000e+040.76structural maintenance of chromosomes 2 [Source:ZF... [more]
smc20.000e+040.76structural maintenance of chromosomes 2 [Source:ZF... [more]
smc47.126e-1622.28structural maintenance of chromosomes 4 [Source:ZF... [more]
smc1a2.380e-1430.16structural maintenance of chromosomes 1A [Source:Z... [more]
smc1al2.597e-1329.17structural maintenance of chromosomes 1A, like [So... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnih10.000e+041.65cornichon family AMPA receptor auxiliary protein 1... [more]
cnih10.000e+041.65cornichon family AMPA receptor auxiliary protein 1... [more]
cnih10.000e+041.65cornichon family AMPA receptor auxiliary protein 1... [more]
cnih10.000e+041.65cornichon family AMPA receptor auxiliary protein 1... [more]
cnih10.000e+041.65cornichon family AMPA receptor auxiliary protein 1... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smc20.000e+040.63structural maintenance of chromosomes 2 [Source:MG... [more]
Smc20.000e+040.63structural maintenance of chromosomes 2 [Source:MG... [more]
Smc25.780e-11148.09structural maintenance of chromosomes 2 [Source:MG... [more]
Smc35.466e-5024.46structural maintenance of chromosomes 3 [Source:MG... [more]
Smc49.278e-1823.27structural maintenance of chromosomes 4 [Source:MG... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50533|SMC2_XENLA0.000e+041.95Structural maintenance of chromosomes protein 2 OS... [more]
sp|O95347|SMC2_HUMAN0.000e+040.41Structural maintenance of chromosomes protein 2 OS... [more]
sp|Q8CG48|SMC2_MOUSE0.000e+040.63Structural maintenance of chromosomes protein 2 OS... [more]
sp|Q90988|SMC2_CHICK0.000e+039.51Structural maintenance of chromosomes protein 2 OS... [more]
sp|Q9C5Y4|SMC21_ARATH0.000e+038.91Structural maintenance of chromosomes protein 2-1 ... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0KSX40.000e+044.93Structural maintenance of chromosomes protein OS=S... [more]
A0A0R3TUF40.000e+043.34Structural maintenance of chromosomes protein OS=R... [more]
A0A4S2MG760.000e+043.86Structural maintenance of chromosomes protein OS=O... [more]
A0A564Y2610.000e+043.60SMC hinge domain-containing protein (Fragment) OS=... [more]
A0A158QG370.000e+043.46Structural maintenance of chromosomes protein OS=H... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc20.000e+039.97structural maintenance of chromosomes 2 [Source:ZF... [more]
smc33.912e-4623.82structural maintenance of chromosomes 3 [Source:NC... [more]
smc45.014e-2622.48structural maintenance of chromosomes 4 [Source:NC... [more]
smc45.316e-1722.76structural maintenance of chromosomes 4 [Source:NC... [more]
smc1b6.495e-1522.41structural maintenance of chromosomes 1B [Source:Z... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc22.859e-10937.03structural maintenance of chromosomes 2 [Source:ZF... [more]
ENSPMAT00000008608.13.930e-1622.67pep scaffold:Pmarinus_7.0:GL477381:37203:71735:-1 ... [more]
ENSPMAT00000002584.13.017e-1530.69pep scaffold:Pmarinus_7.0:GL477247:652:6382:-1 gen... [more]
ENSPMAT00000000346.13.452e-1030.00pep scaffold:Pmarinus_7.0:GL477118:44770:74561:-1 ... [more]
SMC1A1.211e-628.17structural maintenance of chromosomes 1A [Source:H... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
SMC20.000e+035.34Subunit of the condensin complex; condensin reorga... [more]
SMC31.409e-3123.98Subunit of the multiprotein cohesin complex; requi... [more]
SMC41.646e-1728.50Subunit of the condensin complex; condensin reorga... [more]
SMC17.942e-1126.74Subunit of the multiprotein cohesin complex; essen... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO406461.360e-2422.90Structural maintenance of chromosomes protein [So... [more]
EDO341364.604e-1328.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341351.405e-837.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495962.858e-832.33Structural maintenance of chromosomes protein [So... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smc20.000e+040.27structural maintenance of chromosomes 2 [Source:NC... [more]
smc20.000e+038.85structural maintenance of chromosomes 2 [Source:NC... [more]
smc36.681e-4823.78structural maintenance of chromosomes 3 [Source:NC... [more]
smc32.263e-2227.08structural maintenance of chromosomes 3 [Source:NC... [more]
smc1al2.275e-1429.63structural maintenance of chromosomes 1A [Source:N... [more]
back to top
BLAST of Structural maintenance of chromosomes protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059543.10.000e+099.35SMESG000059543.1[more]
SMESG000017172.17.589e-2230.37SMESG000017172.1[more]
SMESG000022017.16.738e-2122.48SMESG000022017.1[more]
SMESG000017173.14.620e-1427.90SMESG000017173.1[more]
SMESG000017173.15.147e-1427.90SMESG000017173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010906 ID=SMED30010906|Name=Structural maintenance of chromosomes protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3666bp
AAATAATCCTATCAAAAATTTGAAAATCAGTTTTTACTTTAGACATTTTA
ATTAAAACTTAAAATGTTTATTAAATCTATTGTTATTGATGGTTTTAAAT
CATATGCAAAAAGAACCGAAATCACAGGTTTCGATCCTGCATTCAATGCT
ATTACAGGCCTAAATGGGTCGGGAAAATCTAATATATTGGATGCAATTTG
TTTTTTATTAGGAATTACTAATTTATCACAAGTTCGTGCATCGAATCTTC
AAGAATTGGTGTACAAATGTGGCCAAGCTGGTATTAATAAAGCCACAGTT
TGTATAATTTTTGACAATTCGGAAAAATCGAGCTCACCAATAGGATATGA
GCAGTTTGATGAAATTACAATCACAAGACAGATAGTTGTCGGTGGCAAAA
ACAAGTACCTAATTAATGGTATAATGGCTCCTAACAATCGAGTGCAAGAT
CTTTTTCGATCTGTTCAACTAAATGTGAACAACCCTCATTTTTTGATAAT
GCAAGGACGAATCACAAAAGTTCTTAATATGAAGCCCCGAGAAATTTTAT
CATTGCTGGAAGAAGCTGCAAATACTAAGCATTATGAATCAAAACGTGAC
GACACTTTAAAAACAATCGAAAAAAAAGACAGTAAATTAAAAGAAATTGA
CAAAATTCTTACTGAAGAAATCAAGCCGAAATTGGAAAAGTTGAAACTTG
AAAGAAGCTCGTATTTAGAATATCAGAAAATTGTGAGAGATTTGGAATAT
TTAAATAAATTTCTCGTGGCCTATGAATACACGACTACCAAAGCGATCGT
CGATAATGCCGATGGGGAATATAATCGGCTGAAAAATCAACTCAATCAAG
AAGAGGAGACCATTAAGAAAAATGAACAACAAAAATTGAATTTTGAGAAC
AATATCGAGAAATTGTGCGAGGAACGAGACAAAGTTCACGTGGAAAAATT
ACAAAATATGAAAACGGAATTTGCCGAAATGCAGAAGCAGGAAGCCGTGT
TGAAGAACGCAATCAAACGAGCTGAAGATGAGGTGAAAGAAGCGAAAGAG
AACGTGAAAAAACTCCAGAAACAGATGAAAGAAGATGCCGAATCTCAGAA
GCAGACAAAATTGGCAATTGCAAAAATCCAAGGCCAATTCGACAAGTTGA
AAGAAAAGCTGGAGAAATCGAAACAAAATTATCAATCTGCCGATCAGCGA
CTGCTAAACGTTAACAGTGGATTTTTCCAATCGAAAACCAGCAACGCAAC
CGGATCGCTGGCGGAACTGTTAGCAGAAGCGGTCAAAGTCGAATCGGACG
TGAATATCACATTGAACACGCTGAACTTGAGATTGGTTCACACGCAATCT
TTGCTCAATCAGCTGGCATCGAAACTCGGCCAGACAAACAAATCCGACAA
TTCCGGCGAATTGGAACAGAAACAGAAACAATTGGCCACTGAAATCGAGC
AATTGAAAGCGAATGTCAATGCGATCAATTACTCGCAACCCGAATGGGAG
CAAGCCCAACACGATCAATTGGCCACCGGATCGGATTTACGGAGGATACT
TACCGATCGACAGACATTCATTCGGCGCAATCCTAGCTACGAGCTCGTGT
ACAACCGGCCGCGTCCTGATTTCGATTCTCGGCGGATTATCGGGGTAGTT
GCCAATCTCGTCAGCTTGCCAGATCCGCAATTCAGTCTCAGCTTGCAAGT
GGGCGGCGGAGGCCGGCTGTTTAATGTGATTATCGATCACGATTCTGTCG
CTGCCGAACTGTTCGAAAAGAATTGTCTACCGAATCGGACGACATTTCTA
CCGCTTAATAAAATGAGCTTCAAGCCGATTCCGGATTTCGTTGTCAGAAA
AGCAAAGGAAATCTTAGGCAAGGAAAACGTCTGGTCCGCGTTAGAGGTGA
TTCAGTATGACAAAAGGTATGAGAGCGCAATCAATTTTGTTTTCGGGGGA
TTTCTAATCGCTCGAACTCTCGATATGGCAAAAACTGTCGCGTTTGATGA
GAGAATCAAATGTCGATGTGTGACGTTCGATGGAGAGGTGTTCGATCCTG
AGGGATCTCTCTTCGGAGGAGAGCAGGAACTGGATCATCGGATATTTGAG
CGTTCGCGTGAGCTGTTGGCAATGGACAATTCGATTATGTCAATGCAACA
GCGACAGAAAGAAAATGCCGATCGTTTCACCCAGATTGAGGACAACCGTA
AACGACATGACGAAGCCAGCGCTCAGTTGCGAGCGAAATCCTTTGAGTTG
CGCCAGCTAGAACGCAACATGATGGATGATCAATACCTGAATATCAAAGC
CAAATATGACGAAACCGAGTCGGAATTGAAGGAAATCACTGAGGCGATTC
GAGAGAACGAGAAGCTCTATAGAAAGGCATGCGAGGAAACGAAATTGGCG
AAAGAAAATCTTGCCAATAGCGCATCTATCAAGGAAAAAGCCCAGAAAGA
AGCGGAATCGGAATATAAGAAAGCCCAGGATCAATTGAAACTCGACGAGG
AAGCCTTCAAAGATGTCGAGGCCCAATATGAAATCTTGAATCTAGAATGC
ACCGACAATGAACAGGAACAGCAACAGTTGCTAGCGAATATTGAGGCGGC
CGAAAAGGTCGTGACAAACAAGATCGATAGTTGCCGAGTGAGTAGCGAGA
AAATTATCGGCCATAAAGAGAGTATGAGCGCGTTCAAAAAGGAATTGGAT
AATCAGAATCGAGTTCTGCAGGAAATCGAAAAACAGATTTCCCAGTGCAA
GGACAGCGTACTGGAATGTGGGAAAAATATCGACCAATCAGCACTCAGAG
TCAGCGATATTAATCACAGGATATCCACCCACAGAAAGGACAGTGAGGAT
GCAGAACGAAAGATCGGGAAATTGCTGTCGACCAATCGGTGGATACCGGA
CGAAAGCAAACATTTCAATCAGTCTGGCGGCATTTATGATTTCACTAATA
AAGATTGGAAAGAATATAAACAGAAAATCGAGAAGCTGGAAGATGAGAAG
CGGAAATTAAGTCGAAAAGTTGATCTGCGAGGAATGAATGTCCTCGGGCA
GACCGAAGAACGATATAGCGATTTAATGACGAAATATAAAAAGGTTTTAA
ACGATAAGCAAGTCCTTCAGAATGTAATCGATGAGCTGGATAAACTGAAA
GATGAAGTAATCAAAAAGGCTCACGAGCAGGTGGATCGGGATTTCGATAA
AATATTTTCAACACTTCTGCCGGGATCGCAAGCTCGATTGACTCCACCGG
AAGGGAAATCTTTATCAGACGGGCTGGAGTTTAAAATTGCATTTGGAAAC
GTTTGGAAAGAATCACTGAATGAACTGAGCGGTGGCCAGAGGTCATTGGT
GGCCTTGTCATTGATTTTAGCGCTTCTGAGATTCAAACCGGCACCGCTCT
ATATCCTGGACGAGGTGGACGCGGCGCTAGACATTTCCCACACGCAGAAC
ATTGGCACAATCATCAAGGAGCAGTTTGGGAATTCACAATTCATCATTGT
CTCCCTGAAGGATGGAATGTTCAACAATGCCAATGTGCTTTTCAAAACGA
AATTTGTCGATGGAGTGTCGACAGTGAGTCGCCATGTTAACACCAGCCGA
CGCCCGATGGTAGAGAGAAACTTGTAACCCGATTTTATTCTATGTGACTC
TGTTGTATATTTGATT
back to top

protein sequence of SMED30010906-orf-1

>SMED30010906-orf-1 ID=SMED30010906-orf-1|Name=SMED30010906-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1188bp
MFIKSIVIDGFKSYAKRTEITGFDPAFNAITGLNGSGKSNILDAICFLLG
ITNLSQVRASNLQELVYKCGQAGINKATVCIIFDNSEKSSSPIGYEQFDE
ITITRQIVVGGKNKYLINGIMAPNNRVQDLFRSVQLNVNNPHFLIMQGRI
TKVLNMKPREILSLLEEAANTKHYESKRDDTLKTIEKKDSKLKEIDKILT
EEIKPKLEKLKLERSSYLEYQKIVRDLEYLNKFLVAYEYTTTKAIVDNAD
GEYNRLKNQLNQEEETIKKNEQQKLNFENNIEKLCEERDKVHVEKLQNMK
TEFAEMQKQEAVLKNAIKRAEDEVKEAKENVKKLQKQMKEDAESQKQTKL
AIAKIQGQFDKLKEKLEKSKQNYQSADQRLLNVNSGFFQSKTSNATGSLA
ELLAEAVKVESDVNITLNTLNLRLVHTQSLLNQLASKLGQTNKSDNSGEL
EQKQKQLATEIEQLKANVNAINYSQPEWEQAQHDQLATGSDLRRILTDRQ
TFIRRNPSYELVYNRPRPDFDSRRIIGVVANLVSLPDPQFSLSLQVGGGG
RLFNVIIDHDSVAAELFEKNCLPNRTTFLPLNKMSFKPIPDFVVRKAKEI
LGKENVWSALEVIQYDKRYESAINFVFGGFLIARTLDMAKTVAFDERIKC
RCVTFDGEVFDPEGSLFGGEQELDHRIFERSRELLAMDNSIMSMQQRQKE
NADRFTQIEDNRKRHDEASAQLRAKSFELRQLERNMMDDQYLNIKAKYDE
TESELKEITEAIRENEKLYRKACEETKLAKENLANSASIKEKAQKEAESE
YKKAQDQLKLDEEAFKDVEAQYEILNLECTDNEQEQQQLLANIEAAEKVV
TNKIDSCRVSSEKIIGHKESMSAFKKELDNQNRVLQEIEKQISQCKDSVL
ECGKNIDQSALRVSDINHRISTHRKDSEDAERKIGKLLSTNRWIPDESKH
FNQSGGIYDFTNKDWKEYKQKIEKLEDEKRKLSRKVDLRGMNVLGQTEER
YSDLMTKYKKVLNDKQVLQNVIDELDKLKDEVIKKAHEQVDRDFDKIFST
LLPGSQARLTPPEGKSLSDGLEFKIAFGNVWKESLNELSGGQRSLVALSL
ILALLRFKPAPLYILDEVDAALDISHTQNIGTIIKEQFGNSQFIIVSLKD
GMFNNANVLFKTKFVDGVSTVSRHVNTSRRPMVERNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR010935SMC_hinge
IPR003395RecF/RecN/SMC_N
IPR027417P-loop_NTPase
IPR024704SMC
Vocabulary: cellular component
TermDefinition
GO:0005694chromosome
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0051276chromosome organization
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0030261chromosome condensation
GO:0051301cell division