Protein furry-like protein

Overview
NameProtein furry-like protein
Smed IDSMED30010898
Length (bp)13143
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein furry-like protein (SMED30010898) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein furry-like protein (SMED30010898) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein furry-like protein (SMED30010898) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein furry-like protein (SMED30010898) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30010898 SmedASXL_072848SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30010898SMESG000041949.1 SMESG000041948.1 Contig6461uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010898SMESG000041949.1 SMESG000041948.1 Contig6461newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30010898SMESG000041948.1 dd_Smed_v4_4962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010898SMESG000041948.1 dd_Smed_v4_4962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010898SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010898SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein furry-like protein vs. Ensembl Human
Match: FRYL (FRY like transcription coactivator [Source:HGNC Symbol;Acc:HGNC:29127])

HSP 1 Score: 887.486 bits (2292), Expect = 0.000e+0
Identity = 589/1672 (35.23%), Postives = 899/1672 (53.77%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSK-----------ALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     + + +  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D +++ VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SLQQK+GE   P    +    PS                       +  R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++L+ELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK    A     NQ ++            L+++    +   VEGF LV+LC  R + RRL+V VL+E+++L   +               E P  ++       IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + I+ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I             + KK  T+   D  + LW+NY+   C  A    S S G+V     + L S   SG +IDS  I                   P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S D+K   L  E +TLLL+ N +    +   +D CY  S       F +I   F N  DY CD V ++ L L   ++    I E A QLLQ+L  + F                       +  +    T   +S +S    L ++S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  D     +  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G EL+ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLS--RSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------NGTEDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSLQQKDGE---PPMPTTGVILPS----------------------GNTLRVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQA--AQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL---------------EIPKGDD----ELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPI----SHQF-DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQ----LLSPQVDI---------NSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDSGYSIDSKIIG-----------------IPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHFLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSLDKKVHQLGCEAVTLLLELNPDQSNLMYWAVDRCYTGSGRVAAGCFKAIANVFQNR-DYQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMF---------------------RYAHKLEVQRTDGVLSQLSPLPHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHDEDEDDSLK-DRELMVTS------RRWLRGEGWGSPQATAMVLNNLMYMTAKYGDELAWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRI 1467          
BLAST of Protein furry-like protein vs. Ensembl Human
Match: FRYL (FRY like transcription coactivator [Source:HGNC Symbol;Acc:HGNC:29127])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 585/1672 (34.99%), Postives = 895/1672 (53.53%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSK-----------ALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     + + +  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D +++ VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++L+ELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK    A     NQ ++            L+++    +   VEGF LV+LC  R + RRL+V VL+E+++L   +               E P  ++       IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + I+ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I             + KK  T+   D  + LW+NY+   C  A    S S G+V     + L S   SG +IDS  I                   P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S D+K   L  E +TLLL+ N +    +   +D CY  S       F +I   F N  DY CD V ++ L L   ++    I E A QLLQ+L  + F                       +  +    T   +S +S    L ++S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  D     +  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G EL+ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLS--RSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------NGTEDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQA--AQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL---------------EIPKGDD----ELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPI----SHQF-DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQ----LLSPQVDI---------NSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDSGYSIDSKIIG-----------------IPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHFLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSLDKKVHQLGCEAVTLLLELNPDQSNLMYWAVDRCYTGSGRVAAGCFKAIANVFQNR-DYQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMF---------------------RYAHKLEVQRTDGVLSQLSPLPHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHDEDEDDSLK-DRELMVTS------RRWLRGEGWGSPQATAMVLNNLMYMTAKYGDELAWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRI 1467          

HSP 2 Score: 196.823 bits (499), Expect = 6.187e-49
Identity = 182/636 (28.62%), Postives = 296/636 (46.54%), Query Frame = 3
Query: 8892 NSCIIENIETP--NEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKW----AQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY---------RSTPNLKNSF----SSPKIGYHKDISRQ--RGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL-----------ELPGRILEYQFDV 10694
            NS  I ++ T   NE D+ +        ++  V+ L++ I++ +  P+W +EDV+                         K P+         I S   L T +K + S+     +  I      +++AL T ++C+ RHYA RS QIFRAL      T LS + SRL++T+GD  ED Q +V+EL LTLES I  L  + M    L    S T   D           +ST  L  S     SS  +GY+ +      R + +G        SN        I  ++S  +         KG + D +ST        E T+L+  IFW+A  L+ES+ E+E+   LR L+ L+  L     + R K+E +     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L L   L+  FD  TQ  +  A  IA +        L NL  +M LYS  T+++D + W   V +YL+D++S+ +  L+ ++  +L +  S M  ++LQ++ + + +I+++ +A   Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+           +P     +  +P +           ELPG+ L++ FD+
Sbjct: 1725 NSAAISHLHTTILNEVDISV-------EQDGKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNPS---------IKSAEQLTTFLKHVVSVFKQSSSEGIHLEHHLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTATTLSDVLSRLVETVGDPGEDAQGFVIELLLTLESAIDTL-AETMKHYDLLSALSQTSYHDPIMGNKYAANRKSTGQLNLSTSPINSSSYLGYNSNARSNSLRLSLIGDRRGDRRRSNTLDIMDGRINHSSSLARTRSLSSLREKG-MYDVQSTT-------EPTNLMATIFWIAASLLESDYEYEYLLALRLLNKLLIHLPLDKSESREKIENVQSKLKWTN-FPGLQQLFLKGFTSASTQEMTVHLLSKLISVSKHTLVDPSQLSGFPLNILCLLPHLIQHFDSPTQFCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDCSNWINVVCRYLHDSFSDTTFNLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLS-AAPAKQFNLEIIKIIGKYVQSPYWKEALNILKLVVSRSASLVVPSD----------IPKTYGGDTGSPEISFTKIFNNVSKELPGKTLDFHFDI 2299          
BLAST of Protein furry-like protein vs. Ensembl Human
Match: FRY (FRY microtubule binding protein [Source:HGNC Symbol;Acc:HGNC:20367])

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 606/1884 (32.17%), Postives = 951/1884 (50.48%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD------------------SSPLQLENNMKILYHLINAWKNT-LIASTKENN-QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ V+++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE N    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W +F+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I+ +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  ++          +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                     L ++   K+ Y   N  +N+ LIA+   +  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L I +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L +  N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  I   +TS             T+   D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I  T     +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+    +EN W  L N    ++N+ + + +LI +  ++ ++  L Y K++ ++L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G +  P A         L+ S++  S +I       + Y  S+ G+             DEDK   +          +    + IT+TK        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   11 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDVINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQNPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHIFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITIITTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRVKK---------TYLSKTLTEEEAKMIGMSLYYSQVRKAVDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKV-YEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFIALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPLTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPINAKKTS-------------TAGSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIA-TVCGSRNYPFDIVTLLNLVLFKASDTNREIYEISMQLMQILEAKLFVYSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGDVTASHGLRGNGWGSPEATSLVLNNLMYMTAKYGDEVPGPEMENAWNALANNEKWSNNLRITLQFLISLCGVSSDTVLLPYIKKVAIYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQENFPDAEENKI----LKESDERFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLTITETK-----QPQPLPMPCTGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1610          

HSP 2 Score: 164.851 bits (416), Expect = 2.839e-39
Identity = 158/591 (26.73%), Postives = 276/591 (46.70%), Query Frame = 3
Query: 8973 NKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVI--KWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANS----------LDDNCSDTDEDDLYRSTP--NLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++   +LI+ ++T    P+W +ED+T                         K  NS+  ++L         N +  ++    D+     +  + +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+  +   NS            D  S +      +ST   N+    +S      +    QR  +V   F +++ S+   R SA ++   +  Q           +LKD+ +  S     +  T+L+  IFW+   LMES+ E E+   LR LS L+  +     + R KLEK+     W   F G   LL+KG  S +   ++ QL S +      S+VD +  +GFP  VL L   L+  F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    +   +LQV+ + + Y++++    V Q N  +    + ++ +V W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1739 DEKANKLIEFLTTRAFGPLWCHEDIT------------------------PKNQNSKSAEQLT--------NFLRHVVSVFKDSKSGFHLEHQLSEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLS--DCLKNSDLLTVLSRSSSPDLSSSSKLTASRKSTGQLNMNPGTTSGNTATAERSRHQRSFSVPKKFGVIDRSSDPPR-SATLDRIQACTQQGLSSKTRSSSSLKDSLTDPS---HINHPTNLLATIFWVTVALMESDFEFEYLMALRLLSRLLAHMPLDKAENREKLEKLQAQLKWAD-FSGLQQLLLKGFTSLTTTDLTLQLFSLLTPVSKISMVDASHAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSVQQPLLQVIYSLLSYMDLS-VVPVKQFNVEVLKTIEKYVQSVHWREALNILKLVVSRSASLVLPSYQHSDLSKIEIHRVWTSASK-----ELPGKTLDFHFDI 2284          
BLAST of Protein furry-like protein vs. Ensembl Human
Match: FRY (FRY microtubule binding protein [Source:HGNC Symbol;Acc:HGNC:20367])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 606/1884 (32.17%), Postives = 951/1884 (50.48%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD------------------SSPLQLENNMKILYHLINAWKNT-LIASTKENN-QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ V+++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE N    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W +F+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I+ +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  ++          +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                     L ++   K+ Y   N  +N+ LIA+   +  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L I +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L +  N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  I   +TS             T+   D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I  T     +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+    +EN W  L N    ++N+ + + +LI +  ++ ++  L Y K++ ++L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G +  P A         L+ S++  S +I       + Y  S+ G+             DEDK   +          +    + IT+TK        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   61 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDVINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQNPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHIFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITIITTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRVKK---------TYLSKTLTEEEAKMIGMSLYYSQVRKAVDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKV-YEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFIALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPLTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPINAKKTS-------------TAGSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIA-TVCGSRNYPFDIVTLLNLVLFKASDTNREIYEISMQLMQILEAKLFVYSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGDVTASHGLRGNGWGSPEATSLVLNNLMYMTAKYGDEVPGPEMENAWNALANNEKWSNNLRITLQFLISLCGVSSDTVLLPYIKKVAIYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQENFPDAEENKI----LKESDERFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLTITETK-----QPQPLPMPCTGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1660          

HSP 2 Score: 165.236 bits (417), Expect = 2.184e-39
Identity = 158/591 (26.73%), Postives = 276/591 (46.70%), Query Frame = 3
Query: 8973 NKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVI--KWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANS----------LDDNCSDTDEDDLYRSTP--NLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++   +LI+ ++T    P+W +ED+T                         K  NS+  ++L         N +  ++    D+     +  + +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+  +   NS            D  S +      +ST   N+    +S      +    QR  +V   F +++ S+   R SA ++   +  Q           +LKD+ +  S     +  T+L+  IFW+   LMES+ E E+   LR LS L+  +     + R KLEK+     W   F G   LL+KG  S +   ++ QL S +      S+VD +  +GFP  VL L   L+  F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    +   +LQV+ + + Y++++    V Q N  +    + ++ +V W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1789 DEKANKLIEFLTTRAFGPLWCHEDIT------------------------PKNQNSKSAEQLT--------NFLRHVVSVFKDSKSGFHLEHQLSEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLS--DCLKNSDLLTVLSRSSSPDLSSSSKLTASRKSTGQLNMNPGTTSGNTATAERSRHQRSFSVPKKFGVIDRSSDPPR-SATLDRIQACTQQGLSSKTRSSSSLKDSLTDPS---HINHPTNLLATIFWVTVALMESDFEFEYLMALRLLSRLLAHMPLDKAENREKLEKLQAQLKWAD-FSGLQQLLLKGFTSLTTTDLTLQLFSLLTPVSKISMVDASHAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSVQQPLLQVIYSLLSYMDLS-VVPVKQFNVEVLKTIEKYVQSVHWREALNILKLVVSRSASLVLPSYQHSDLSKIEIHRVWTSASK-----ELPGKTLDFHFDI 2334          
BLAST of Protein furry-like protein vs. Ensembl Human
Match: FRY (FRY microtubule binding protein [Source:HGNC Symbol;Acc:HGNC:20367])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 605/1882 (32.15%), Postives = 950/1882 (50.48%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD------------------SSPLQLENNMKILYHLINAWKNT-LIASTKENN-QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ V+++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE N    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W +F+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I+ +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  ++          +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                     L ++   K+ Y   N  +N+ LIA+   +  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L I +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L +  N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  I   +TS             T+   D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I  T     +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+    +EN W  L N    ++N+ + + +LI +  ++ ++  L Y K++ ++L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G +  P A         L+ S++  S +I       + Y  S+ G+             DEDK   +          +    + IT+TK        PLP+P  GG  APL  +L E   P     ++ +I ++F  ++V   + R  W
Sbjct:  106 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDVINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQNPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHIFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITIITTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRVKK---------TYLSKTLTEEEAKMIGMSLYYSQVRKAVDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKV-YEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFIALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPLTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPINAKKTS-------------TAGSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIA-TVCGSRNYPFDIVTLLNLVLFKASDTNREIYEISMQLMQILEAKLFVYSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGDVTASHGLRGNGWGSPEATSLVLNNLMYMTAKYGDEVPGPEMENAWNALANNEKWSNNLRITLQFLISLCGVSSDTVLLPYIKKVAIYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQENFPDAEENKI----LKESDERFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLTITETK-----QPQPLPMPCTGGCWAPLVDYLPETITPRGPL-HRCNIAVIFMTEMVVDHSVREDW 1705          

HSP 2 Score: 165.236 bits (417), Expect = 2.121e-39
Identity = 159/591 (26.90%), Postives = 277/591 (46.87%), Query Frame = 3
Query: 8973 NKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVI--KWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANS----------LDDNCSDTDEDDLYRSTP--NLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++   +LI+ ++T    P+W +ED+T            NQ              NS+  ++L         N +  ++    D+     +  + +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+  +   NS            D  S +      +ST   N+    +S      +    QR  +V   F +++ S+   R SA ++   +  Q           +LKD+ +  S     +  T+L+  IFW+   LMES+ E E+   LR LS L+  +     + R KLEK+     W   F G   LL+KG  S +   ++ QL S +      S+VD +  +GFP  VL L   L+  F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    +   +LQV+ + + Y++++    V Q N  +    + ++ +V W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1834 DEKANKLIEFLTTRAFGPLWCHEDITPK----------NQ--------------NSKSAEQLT--------NFLRHVVSVFKDSKSGFHLEHQLSEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLS--DCLKNSDLLTVLSRSSSPDLSSSSKLTASRKSTGQLNMNPGTTSGNTATAERSRHQRSFSVPKKFGVIDRSSDPPR-SATLDRIQACTQQGLSSKTRSSSSLKDSLTDPS---HINHPTNLLATIFWVTVALMESDFEFEYLMALRLLSRLLAHMPLDKAENREKLEKLQAQLKWAD-FSGLQQLLLKGFTSLTTTDLTLQLFSLLTPVSKISMVDASHAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSVQQPLLQVIYSLLSYMDLS-VVPVKQFNVEVLKTIEKYVQSVHWREALNILKLVVSRSASLVLPSYQHSDLSKIEIHRVWTSASK-----ELPGKTLDFHFDI 2379          
BLAST of Protein furry-like protein vs. Ensembl Celegans
Match: sax-2 (Sensory AXon guidance [Source:UniProtKB/TrEMBL;Acc:Q5DX48])

HSP 1 Score: 451.825 bits (1161), Expect = 1.092e-126
Identity = 246/621 (39.61%), Postives = 368/621 (59.26%), Query Frame = 3
Query: 3414 GVDYIFCQSIISVLKQLSLH-PGHDEMLNVVLSMAFQHFKYRDDLMAN---PNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGA-NRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK 5261
             V+Y+FC  +I +L Q+  H P  D ++  VL + F++ +YR+         NHL++   A+ Y EVVGVL+ + F  +   F + +  L+ K+ + +  Q I++L+M MKF R+    +EDF +   FL +L +  +EV DK +KHA+ GL VE+LLPVAA +K E NIP L + V+ LY T +DM SKK+H +A  PL+TCLL + QK FFL NW  F+ +CLS LKN+DP +ARVALESL+RLLWVY++R   + +  T+S+L SI  SLFPKG++++VPRDA +NIFVKIIHFI+Q+KLDFA KEIIFDL+   NR+ + +  ERMN+G+ A ++IA  LQQK+  P MP+     S  PS                      ASG      +++K                    KRK  Y    L +  + S+GI  +    RK+FD++LRLLD Q+ + ++++  +N  KE D++++G +                      KPK++L +TCI+AIPRLLP  MS  +L++LL+RL++H+DEELR MS   L  II E P+WR +   +++  ++  I D  P  L+++++++   +  WK  + A  K   +K
Sbjct:  154 AVNYLFCLVLIEILPQVEFHLPQCDPLIKKVLEICFKNVQYREPSAVGINKTNHLVV---AETYGEVVGVLSSTYFTHIHRIFMTHITELK-KDVSQTAAQQIVALIMSMKFLRINSSQVEDFENGLKFLDDLGSLLLEVKDKDVKHAVMGLLVEILLPVAAQIKRETNIPALISLVQKLYTTTNDMISKKQHKLAAFPLITCLLCVSQKHFFLANWVQFLNSCLSHLKNKDPQVARVALESLYRLLWVYMIRNNADGNAATRSRLDSICGSLFPKGNRYIVPRDAPLNIFVKIIHFISQQKLDFAFKEIIFDLLCVNNRTQRSLYAERMNVGIRALMVIADGLQQKDDPPAMPK-----SMGPS----------------------ASG------TVHK-------------------TKRK-QYITRPLTNEISKSIGIDQFYPQCRKAFDSILRLLDTQIGKPLMMSSIQNRGKEPDELISGDA----------------------KPKLDLFRTCIAAIPRLLPDPMSHVDLIDLLTRLTVHLDEELRNMSGITLQTIIGEFPDWREQVFISHISLIQSHIYDFFPQILDDSLRLMLQSLTTWKTAITAEKKREAEK 695          

HSP 2 Score: 217.238 bits (552), Expect = 1.365e-55
Identity = 222/902 (24.61%), Postives = 398/902 (44.12%), Query Frame = 3
Query: 5280 TLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNER---DHCMLLWKNYITAACCVAPLY--ISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEV------SDLRNSVIEAMGHFNPSSLRDLMDELQI--ILRESVDKKQE-NVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLIT---VIDWLELLRPYLIQGDSGVNLSAD--ISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDD------LCYAAITAMCSLICCGPIFDP-QALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLA---LAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIAN-NGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTV-DGINYSVERTQSLPFYR 7892
            ++L  +EG  +V LCQ RS+ R ++V +LKE++ +   + +++           ++P          VIDV+D A   ++++ +  +P  E+    M  N+DF ++ ++ + I      T +  +N + G+     +   + W   ++       L+  C +AV  AW  L  R+N +   +DP+    E+R SSLLRG  S        E+   + C+ LW+ Y+   C +AP    +SQ   +    +  P     ++ +S                      T        +    C +      +D+R+SV+  +G  NP +   +++EL+   ILRE+ +KK E N+RRRKRKD LRL I++++E+  + G+        S  I    V+D+++ +R         VNL +D    ++++ + RLHF +LI  ++   P   R  L ++  +   F +  +W    +                    +AD+K  D      +   ++ AM  ++CCGPIF+P +++ EDGY+  WL  +I S +    A  EE +  +L+ N E+   LD ++  CY    +     F ++VR F+   D+PC++VS+  L    LA  S  D  +       +  +  + F+++S         N+   S     +PI      +  ++ I     +  + Q ++   L+   P LT++IFSE++ R+ T + + +  LL+ L PW+ N+EL+D                    +  ++ +  P           GWGS++AT LVLNNL YLTV    +  K L                               S L + K+I V +S+    ++   L   L TV D    +++R++  P+YR
Sbjct:  794 SVLHQMEGLAIVYLCQTRSNPRAIAVKILKEIQLIYDLLGIEMI----------DTP----------VIDVLDQATPYVVKKYIEHVPIKER----MSWNMDFSSVCDKISTI-----ETDNTLVNSDRGN----EYFQWDPWGCALSGYAEIKHLLTKCPSAVAAAWPILFSRLNAVSGYVDPNNPQNESR-SSLLRGSKSKGTSSILGEQLGQEACLALWQKYLIMCCALAPAPYNLSQRSFSPTNSMDGPVDVFRSVSAS-----------------LRSSRTPVPNSLSQLISKVCMILRWENLTDIRDSVVLGVGSINPLAFDMMLEELKSNGILREATEKKAETNLRRRKRKDLLRLQIIRVIEVAIFRGLLLVHSAGSSDFILHPHVVDFIDSMR---------VNLESDHDRDITVVTKLRLHFAKLIHLIIDSTPHLSRHTLFSDERRHKLFYLFINWCSRAI--------------------AADRKFRDKEVGSYVEQKSVLAMSRILCCGPIFEPAKSIGEDGYLYGWLEKLIISTNPTMQAEVEEMLAWMLELN-ESGVLLDWLMMQCYTQPPTVACRCFRALVRVFSRR-DFPCEFVSLFVLCQSMLAVNSVTDCALH------MIEILRKQFLETS---------NIHATSPAQQVTPIVQMRNQADVLTNIYNGCHILPIEQHDVCTRLANSYPHLTVTIFSEVSYRLETESCSNKSQLLALLQPWISNLELVD-------------------QNVVEEAAEGP----------RGWGSEEATQLVLNNLLYLTVTLSNDHEKELAE----------------------------ESLLPFTKRICVMMSQVVGTRISSILLEWLSTVHDSSKITLDRSEIPPYYR 1541          

HSP 3 Score: 87.0409 bits (214), Expect = 3.925e-16
Identity = 109/466 (23.39%), Postives = 201/466 (43.13%), Query Frame = 3
Query: 9189 TIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLV-DPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLG--------NLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAE-LLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSK 10556
            T+  ++  LI+    + + W QLA+   ++ ++RH A R  QI  AL     G  + +L SRL++T G+ +++ Q YV +L L L      ++P  M A  +    S T      RST +   +F    + Y                R+  S   + R S ++    S    SP      K     +   + S    +E T    +I  +A  +MES +E+EF   L  L+ +++   S      +K +K+V    W + F G I L+ +G    + +  S Q + ++   ++  +V  P     F    L  L + FD         A  IA+        + G        +L  +M+ Y+  TF KD  Q+ +CV++Y+ D    ++ E L+  +  M     + ++ ++L +L   + + + + S ++    ++I S+S+ F+    W +V  I + +V K
Sbjct: 1764 TVHHIVRLLINKMPMIEVIWTQLAMKMALSTSNRHLAGRCFQIVSALEQP-PGPWIPSLMSRLVETAGEQHDETQSYVTDLMLCLTDCSPYISPTIMEAIEMRQVISPTH----MRST-SYTPAFVRQSVIYS---------------RVQQSDKKNARLSLLVADQESWASKSPDALVRSK-----SAEQLQSENDVNEETMSRMQILAIAVSMMESGIENEFLLALNLLNKVLDVPTSQKVQCLAKYDKMVGQLEWKN-FNGIISLITRGAIIPTAYESSIQAMIQLSDVLSEEVVGGPNGIAIFVTHTLPYLATNFDAPNSLCINVANAIAAFCDESIKTQSGAPADHPFVHLSTIMRQYAMRTFMKDAQQFMKCVLQYICDGCIALNVETLMCLLAEMTERGITGLNGSVLHMLFLLLQHNHHSISPLLIN-AQVIRSVSR-FLQGNNWPDVSKIYKTIVEK 2200          
BLAST of Protein furry-like protein vs. Ensembl Fly
Match: fry (gene:FBgn0016081 transcript:FBtr0333858)

HSP 1 Score: 590.882 bits (1522), Expect = 9.619e-169
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  274 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 918          

HSP 2 Score: 306.99 bits (785), Expect = 1.385e-82
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1295 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 1998          

HSP 3 Score: 222.246 bits (565), Expect = 6.721e-57
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2186 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2745          

HSP 4 Score: 124.02 bits (310), Expect = 3.276e-27
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1003 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1244          
BLAST of Protein furry-like protein vs. Ensembl Fly
Match: fry (gene:FBgn0016081 transcript:FBtr0306241)

HSP 1 Score: 590.882 bits (1522), Expect = 9.726e-169
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  279 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 923          

HSP 2 Score: 307.375 bits (786), Expect = 1.155e-82
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1300 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 2003          

HSP 3 Score: 222.631 bits (566), Expect = 5.415e-57
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2191 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2750          

HSP 4 Score: 124.02 bits (310), Expect = 3.171e-27
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1008 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1249          
BLAST of Protein furry-like protein vs. Ensembl Fly
Match: fry (gene:FBgn0016081 transcript:FBtr0306242)

HSP 1 Score: 590.497 bits (1521), Expect = 1.126e-168
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  279 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 923          

HSP 2 Score: 306.99 bits (785), Expect = 1.477e-82
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1348 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 2051          

HSP 3 Score: 222.246 bits (565), Expect = 6.721e-57
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2239 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2798          

HSP 4 Score: 124.02 bits (310), Expect = 3.288e-27
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1008 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1249          
BLAST of Protein furry-like protein vs. Ensembl Fly
Match: fry (gene:FBgn0016081 transcript:FBtr0301435)

HSP 1 Score: 590.497 bits (1521), Expect = 1.173e-168
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  279 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 923          

HSP 2 Score: 306.99 bits (785), Expect = 1.448e-82
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1348 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 2051          

HSP 3 Score: 222.246 bits (565), Expect = 6.065e-57
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2239 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2798          

HSP 4 Score: 124.02 bits (310), Expect = 3.313e-27
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1008 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1249          
BLAST of Protein furry-like protein vs. Ensembl Fly
Match: fry (gene:FBgn0016081 transcript:FBtr0076417)

HSP 1 Score: 590.497 bits (1521), Expect = 1.186e-168
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  279 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 923          

HSP 2 Score: 306.99 bits (785), Expect = 1.546e-82
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1300 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 2003          

HSP 3 Score: 222.631 bits (566), Expect = 5.014e-57
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2191 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2750          

HSP 4 Score: 124.02 bits (310), Expect = 3.475e-27
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1008 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1249          
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Match: fryl (furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-040914-58])

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 565/1673 (33.77%), Postives = 889/1673 (53.14%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDK-------------TLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQS-GSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGI--------FDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGE+VI++L   F  ++  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D++FC   + VLKQ+ LHP  D ++  VL++AF+HFK+++   + PN   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRL+P  MS+ +L+ELL++L++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LI+ W+  + +S + ++ + +  +K             T+L  VEG  LV+LC  R + RRL+V+VLKEV+SL            +++ +++              IDV+D  +  +LE  +     ++ + L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C +A++ AW     R+     ++ P V I     +S +     N    +S+     + LW+NY+   C  A    S S  +     G    SP ++  ST DS    +    +            P+   L K ++ +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA +G+         D     L+   T++++++L R  L++ ++      D     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D K   L  E + LLL+ N +    +   +D CY  +       F +I   F+N  DY  D V ++ L L   ++    I E A QLLQ+L  + F           +  +E+     V SP             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+DF  +       S +  +      +    +    ++  L G GWGS  AT ++LNNL ++T ++G E + S +EN+W  L +    N+ +I+H+LI ++ + +  S L Y K+++V+L ++K  +LLE L   L+  D ++ +V    + P+YRI
Sbjct:   67 KPGEFVIKSLFAEFAVLAEKKIEVVMAEPLEKLLS--RSLQRGEDAQFDQLISSMSSIAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLVERRDLAIDFMFCLVSVEVLKQIPLHPVPDTLVQEVLNLAFKHFKHKEG-YSGPNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFITELKELRLKEQSPHVVQSIISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTTTQSRLLSIVTALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDNILRHLDKEVGRSMSMTNVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLIPDGMSRQDLIELLAKLTIHMDEELRGLAFTTLQALMVDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLLQLISQWRQAVQSSNRCHDSQVQTYNKCSPSLPLERSPLWTVLHVVEGLALVVLCSCRPATRRLAVNVLKEVRSL-----------HTALGIAK--------GDEELAIDVMDRLSASVLESFIHLTGADQTSLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISLSSYLRQENLPKHCPSALSYAWVFASTRL----QLLSPQVDI-----NSPINAKKVNSMSSSSDSY---VGLWRNYLILCCSSATSSSSSSSSSSSSAPGSVRCSPPETLASTPDSGYCYDSKIISI-----------PSPSSLFKHVVPMMRSESMDITESLVLGLGRTNPVAFRELLEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADSGVISQTVSGGLDGESHSLNS--TLLEYVDLTR-QLLEAEN------DKDSDTLRDIRSHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDRKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGTRRVAAGCFRAIANVFHNR-DYQFDTVVLLNLILFKAADSSRDIYEVAMQLLQILEPKLF---------RYAHKLEIQRTDGVLSP------------ASPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDFKPSVRRQEEPSSAEEEEDAHERELMMVN----SRRWLKGEGWGSPHATTMILNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLKIILHFLISMSGVNSEPSLLPYVKRVVVYLGRDKTMQLLEELMYELELTDPVSSAVTHMDNPPYYRI 1534          

HSP 2 Score: 210.305 bits (534), Expect = 3.476e-53
Identity = 172/612 (28.10%), Postives = 288/612 (47.06%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL---------KGNLKDNKSTVSSN-------------------LSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            +++ V+ LI+ IS+ +  P+W +EDV+                         K PN +  D+L +     V   + K   S    +  L    +++AL T ++C+ RHYA RS QIFRAL      + LS + SRL++T+GD  E+ Q +V+EL LTLE+GI  L  + M +  L    S    D L+               G     +R+    +  G   L++   H R++++  S    +    RR  +L          GNL   +S  S                     +   + T+L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R KLE++     W + FPG + L +KG  S +   ++  LLSK++     +L+DP+   GFP  +L L   L+  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL+DA++EI+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P     E     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1809 QDEKVKNLIEFISSRKRGPLWNHEDVS------------------------PKNPNIKSADQLSVFLRHVV--NVFKQTPSGFQLEQEL----SEIALQTALSCSSRHYAGRSFQIFRALKQPMTASTLSDMLSRLVETVGDPGEEAQGFVIELLLTLEAGIDTLA-ETMKSYDLLTAISQASHDPLH---------------GTKFANNRKSTGQLNLGSSFLHAHYSHARSNSLRASLMGERMGDRRRSNTLDIADRLGGSHGNLARTRSLSSLREGGVRGDGGGGTGGGSGEVVPQTDPTNLMATVFWIATSLLESDYEFEYLLALRLLNRLLAQMPLEKADSREKLERVQGKLKWYN-FPGLLTLFLKGFTSAATQELTIHLLSKLITVSRHTLIDPSQLAGFPLNILCLLPHLIQHFDNPTGFCKETADRIAKVCAEEKSATLANLAHMMSLYSTHSYSRDSTNWINVVCRYLHDAFAEITFNLVTYLAELLEKGLNSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPYWKEAQNILKLVVSRSASLVVPD----EVQRSYSTESTGSPEIAFTRIFNNSSKELPGKTLDFHFDI 2368          
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Match: frya (furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060510-4])

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 570/1685 (33.83%), Postives = 890/1685 (52.82%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENN----------QKSKA--------LDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESH---LSTNL---WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVA------PLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQY---SSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLV-NYR-TDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            +PGEYV+++L  +F  IS  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+     +G+  +    R                                P + +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D ++  V+ +AF+HFKY++     PN   ++ +ADLYAEV+GVL+Q++F  V+ +FTSELK LR KE +    QS ISL+MG+KFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  D+ S+KKH +AL P+VTCLL + QKQFFL  W VF+  CLS LK++DP +ARVALESL+RLLWVY++RIK E +T TQ +L+SIV +LFPKGS+ VVP+D  +NIFVKII FIAQE+LDFAMKE+IFDL+   +  K   + PERMNIGL AFL+IA  LQQK+GEPPMP   N+ +  PS                         G   R+              ++  SKP             L++  A  +G+  Y   VRK+ D +LR LD++V R M+L+  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  MSKSEL++LL+RL++H+D+ELR+++Q +L +++ +  +WR + +  +  F+ +E+ D+    L++++K+L  L+  WK  L+++ K  +          Q S             T+L  VEG  LV+LC  ++  RRL+V +L+EV+ + I I               E P          +IDV+D  +  +LE     +   + A L   Q+ D   L E            ++ ++  +H  + S S    L+ +L   W+ C+ ++  + +L K C  A++ AW     R+  L  +++PS  +   +TSS    GS+          D  + LW+NY+     VA      P ++  S   +     SPD S S+ D+  +                   P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ +S      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM S++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  +D CY  S       F +I  T     +Y  D V+++ L L   S+ + +I E A QL+Q+L  +  + S  +  + +   +               GT   +        L +LS  ++S+ L+ M P+LTL +FSE++QR  T +PN + ++L+ L+PW+ NIEL+D          S+ S   S V   K Y   SSSP       L G GWGS QA+ LVLNNL ++T ++G ++  + +EN W  LV N R T+N+  ++ +LI +  ++ + S L + K+++++L +    + +E L   LQ  D +N  V    + PFYR 
Sbjct:   58 RPGEYVLKSLFANFTTISERKIRIVMAEPLEKPLVKSLQRGEDLQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ--NGVDDESHEYR--------------------------------PRSNTKSKNDEQQKD--YLLERRDLAIDFIFSLVLIEVLKQMPLHPVVDGLVQEVIHLAFKHFKYKEGYHG-PNTANMHIVADLYAEVIGVLSQAKFPAVKKRFTSELKELRQKEQSPYVVQSTISLIMGVKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLDLSSRKKHSLALYPMVTCLLCVSQKQFFLNRWHVFLNNCLSNLKSKDPKMARVALESLYRLLWVYMIRIKCESNTATQGRLNSIVTNLFPKGSRSVVPKDMPLNIFVKIIQFIAQERLDFAMKEVIFDLLFVGKPAKAFSLNPERMNIGLRAFLVIADKLQQKDGEPPMP---NTGATLPS-------------------------GNTLRV-------------KKTFLSKP-------------LSEDEAKVIGMSLYYPHVRKALDNILRHLDKEVGRCMMLSNAQMLNKEPEDMITG----------------------ERKPKIDLFRTCMAAIPRILPDGMSKSELIDLLARLTIHMDDELRLIAQNSLQSLLVDFSDWREEVLLGFCSFLLREVQDTHQTLLDSSLKLLLQLLTQWKLALLSTNKSPDTSKICSAELLQSSSGSRLPAEWTSHSTVLHAVEGLALVLLCSCQTGTRRLAVSILREVRQIFIIIGQ---------TEEDERP----------MIDVLDQLSPMVLES-FAHVAVADSASLPAGQHADLQWLVE------------WNGSLVGSHYDVRSPSRVWILAQSLKEPWALCLFSLLRQEYLPKHCPTALSYAWPYAFTRLQLLMPLLEPSNPVNAKKTSS---AGSA----------DTYVSLWRNYLILCFGVAKPSIMSPGHLRASTPEI--ITPSPD-SNSSYDNKILGT-----------------PSVAWLLKQLVPLMRSESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAES------DKDMEILKDIRAHFSAMVANLIQSVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSSVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQMNLFNWAVDRCYTGSCQLASGCFKAIA-TVCGSRNYSSDIVTLLNLVLFKASDTNREIYEIAMQLMQILEAKLSVYSKRIVEQKSGAIL--------------YGTHRPLP------PLYSLSVTQLSKQLARMYPELTLPLFSEVSQRFPTTHPNGRQVMLAYLLPWLSNIELVD------GGLLSTVSGPSSCVDNRKGYTHNSSSP-----HLLRGTGWGSLQASSLVLNNLMFMTAKYGDDVPGAEMENAWNALVSNERWTNNLRTVLQFLISLCGVSSDTSLLPHIKKVVIYLCRNNTMQTMEELLYELQQTDPVNPVVVHCDNPPFYRF 1515          

HSP 2 Score: 170.629 bits (431), Expect = 3.533e-41
Identity = 161/625 (25.76%), Postives = 284/625 (45.44%), Query Frame = 3
Query: 8904 IENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLID---ADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY----RSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTV-----------------SSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQL-NKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +EN+E+  E D             +   +LI+ ++T    P+W +ED+T                         K P S+  ++L            ++ + S+     +D  L  + +++AL   +  + RHYA RS Q+FRAL        +S L SRL++ +G+  E+VQ YV+EL LTLES + NL      A  L +N       D +     S+P+L    SS K+  ++  + Q     G      +    HQR+ +V +     ++ S    ++    +  ++S +                 +   + +   +L+  IFW    LMES+ E E+   LR L  L+  ++    + + KLEKI     W   F G   LL+KG  S +   ++ +L S++       +VD +  +GFP  VL L   LV  FD  +Q  +  A+ I+ I       +L NL  VM LY   ++ +D   W   V +YL++A+S+ +  ++ ++  +L +    M   +LQ++ + + ++++  S I  +L N  + +  + F+    WKE   IL+L+VS+++SL  P+S    SS +    +      +TP   LPG+ L++ FD+
Sbjct: 1775 MENMESSTEDD-------------EKSSKLIEFLTTRPFGPLWSHEDIT------------------------PKNPQSKSTEQL---------TNFLRHVVSVFKESKSDIRLEQQLSEVALQMALCSSSRHYAGRSFQVFRALRQPLSALAVSDLLSRLVEVVGEHGEEVQGYVMELLLTLESVVDNL------AECLKNN-------DFFVILRASSPDLP---SSGKLTLNRKSTSQLELIPGSA--TASERIRHQRSYSVPKRFGEAERSSDVPRSATLDRIHHHQSNISKLRSLSSSSSRDNVVSTDPTNANHPHNLLATIFWAVVSLMESDFEFEYQMSLRLLGKLLGHISLDKQEYKEKLEKIQLQLKWKD-FTGLQKLLLKGFTSANTTELTLELFSQLTPVSRLPVVDTSQAIGFPLNVLCLIPHLVLHFDSPSQFCKDVAERISQICLEEKNSKLSNLAHVMTLYKTHSYTRDCFSWVNVVCRYLHEAFSDSTLSMVTYMTELLEKGLPSMQQTLLQIIYSLLSHMDL--SGIQAKLFNMEVLTTIEKFVQTTHWKEALNILKLVVSRSASLVSPSSPQSNSSSVDVRRVW-----DTPSKALPGKTLDFHFDI 2327          
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Match: frya (furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060510-4])

HSP 1 Score: 795.808 bits (2054), Expect = 0.000e+0
Identity = 564/1667 (33.83%), Postives = 881/1667 (52.85%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESH---LSTNL---WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVA------PLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQY---SSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLV-NYR-TDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            +PGEYV+++L  +F  IS  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+                                    +   ++ Y    P + +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D ++  V+ +AF+HFKY++     PN   ++ +ADLYAEV+GVL+Q++F  V+ +FTSELK LR KE +    QS ISL+MG+KFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  D+ S+KKH +AL P+VTCLL + QKQFFL  W VF+  CLS LK++DP +ARVALESL+RLLWVY++RIK E +T TQ +L+SIV +LFPKGS+ VVP+D  +NIFVKII FIAQE+LDFAMKE+IFDL+   +  K   + PERMNIGL AFL+IA  LQQK+GEPPMP   N+ +  PS                         G   R+              ++  SKP             L++  A  +G+  Y   VRK+ D +LR LD++V R M+L+  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  MSKSEL++LL+RL++H+D+ELR+++Q +L +++ +  +WR + +  +  F+ +E+ D+    L++++K+L  L+  WK  L +S+            T+L  VEG  LV+LC  ++  RRL+V +L+EV+ + I I               E P          +IDV+D  +  +LE     +   + A L   Q+ D   L E            ++ ++  +H  + S S    L+ +L   W+ C+ ++  + +L K C  A++ AW     R+  L  ++D  V               + KK  ++   D  + LW+NY+     VA      P ++  S   +     SPD S S+ D+  +                   P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ +S      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM S++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  +D CY  S       F +I  T     +Y  D V+++ L L   S+ + +I E A QL+Q+L  +  + S  +  + +   +               GT   +        L +LS  ++S+ L+ M P+LTL +FSE++QR  T +PN + ++L+ L+PW+ NIEL+D          S+ S   S V   K Y   SSSP       L G GWGS QA+ LVLNNL ++T ++G ++  + +EN W  LV N R T+N+  ++ +LI +  ++ + S L + K+++++L +    + +E L   LQ  D +N  V    + PFYR 
Sbjct:   49 RPGEYVLKSLFANFTTISERKIRIVMAEPLEKPLVKSLQRGEDLQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ-------------------------------NGVDDESHEY---RPRSNTKSKNDEQQKD--YLLERRDLAIDFIFSLVLIEVLKQMPLHPVVDGLVQEVIHLAFKHFKYKEGYHG-PNTANMHIVADLYAEVIGVLSQAKFPAVKKRFTSELKELRQKEQSPYVVQSTISLIMGVKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLDLSSRKKHSLALYPMVTCLLCVSQKQFFLNRWHVFLNNCLSNLKSKDPKMARVALESLYRLLWVYMIRIKCESNTATQGRLNSIVTNLFPKGSRSVVPKDMPLNIFVKIIQFIAQERLDFAMKEVIFDLLFVGKPAKAFSLNPERMNIGLRAFLVIADKLQQKDGEPPMP---NTGATLPS-------------------------GNTLRV-------------KKTFLSKP-------------LSEDEAKVIGMSLYYPHVRKALDNILRHLDKEVGRCMMLSNAQMLNKEPEDMITG----------------------ERKPKIDLFRTCMAAIPRILPDGMSKSELIDLLARLTIHMDDELRLIAQNSLQSLLVDFSDWREEVLLGFCSFLLREVQDTHQTLLDSSLKLLLQLLTQWKLLLQSSSGSRLPAEWTSHSTVLHAVEGLALVLLCSCQTGTRRLAVSILREVRQIFIIIGQ---------TEEDERP----------MIDVLDQLSPMVLE-SFAHVAVADSASLPAGQHADLQWLVE------------WNGSLVGSHYDVRSPSRVWILAQSLKEPWALCLFSLLRQEYLPKHCPTALSYAWPYAFTRLQLLMPLLDNPV---------------NAKKTSSAGSADTYVSLWRNYLILCFGVAKPSIMSPGHLRASTPEI--ITPSPD-SNSSYDNKILGT-----------------PSVAWLLKQLVPLMRSESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAES------DKDMEILKDIRAHFSAMVANLIQSVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSSVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQMNLFNWAVDRCYTGSCQLASGCFKAIA-TVCGSRNYSSDIVTLLNLVLFKASDTNREIYEIAMQLMQILEAKLSVYSKRIVEQKSGAIL--------------YGTHRPLP------PLYSLSVTQLSKQLARMYPELTLPLFSEVSQRFPTTHPNGRQVMLAYLLPWLSNIELVD------GGLLSTVSGPSSCVDNRKGYTHNSSSP-----HLLRGTGWGSLQASSLVLNNLMFMTAKYGDDVPGAEMENAWNALVSNERWTNNLRTVLQFLISLCGVSSDTSLLPHIKKVVIYLCRNNTMQTMEELLYELQQTDPVNPVVVHCDNPPFYRF 1486          

HSP 2 Score: 170.629 bits (431), Expect = 3.438e-41
Identity = 161/625 (25.76%), Postives = 284/625 (45.44%), Query Frame = 3
Query: 8904 IENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLID---ADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY----RSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTV-----------------SSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQL-NKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +EN+E+  E D             +   +LI+ ++T    P+W +ED+T                         K P S+  ++L            ++ + S+     +D  L  + +++AL   +  + RHYA RS Q+FRAL        +S L SRL++ +G+  E+VQ YV+EL LTLES + NL      A  L +N       D +     S+P+L    SS K+  ++  + Q     G      +    HQR+ +V +     ++ S    ++    +  ++S +                 +   + +   +L+  IFW    LMES+ E E+   LR L  L+  ++    + + KLEKI     W   F G   LL+KG  S +   ++ +L S++       +VD +  +GFP  VL L   LV  FD  +Q  +  A+ I+ I       +L NL  VM LY   ++ +D   W   V +YL++A+S+ +  ++ ++  +L +    M   +LQ++ + + ++++  S I  +L N  + +  + F+    WKE   IL+L+VS+++SL  P+S    SS +    +      +TP   LPG+ L++ FD+
Sbjct: 1727 MENMESSTEDD-------------EKSSKLIEFLTTRPFGPLWSHEDIT------------------------PKNPQSKSTEQL---------TNFLRHVVSVFKESKSDIRLEQQLSEVALQMALCSSSRHYAGRSFQVFRALRQPLSALAVSDLLSRLVEVVGEHGEEVQGYVMELLLTLESVVDNL------AECLKNN-------DFFVILRASSPDLP---SSGKLTLNRKSTSQLELIPGSA--TASERIRHQRSYSVPKRFGEAERSSDVPRSATLDRIHHHQSNISKLRSLSSSSSRDNVVSTDPTNANHPHNLLATIFWAVVSLMESDFEFEYQMSLRLLGKLLGHISLDKQEYKEKLEKIQLQLKWKD-FTGLQKLLLKGFTSANTTELTLELFSQLTPVSRLPVVDTSQAIGFPLNVLCLIPHLVLHFDSPSQFCKDVAERISQICLEEKNSKLSNLAHVMTLYKTHSYTRDCFSWVNVVCRYLHEAFSDSTLSMVTYMTELLEKGLPSMQQTLLQIIYSLLSHMDL--SGIQAKLFNMEVLTTIEKFVQTTHWKEALNILKLVVSRSASLVSPSSPQSNSSSVDVRRVW-----DTPSKALPGKTLDFHFDI 2279          
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Match: frya (furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060510-4])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 568/1671 (33.99%), Postives = 885/1671 (52.96%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLI-ASTKENNQKSKA---LDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESH---LSTNL---WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVA------PLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQY---SSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLV-NYR-TDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            +PGEYV+++L  +F  IS  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+                                    +   ++ Y    P + +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D ++  V+ +AF+HFKY++     PN   ++ +ADLYAEV+GVL+Q++F  V+ +FTSELK LR KE +    QS ISL+MG+KFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  D+ S+KKH +AL P+VTCLL + QKQFFL  W VF+  CLS LK++DP +ARVALESL+RLLWVY++RIK E +T TQ +L+SIV +LFPKGS+ VVP+D  +NIFVKII FIAQE+LDFAMKE+IFDL+   +  K   + PERMNIGL AFL+IA  LQQK+GEPPMP   N+ +  PS                         G   R+              ++  SKP             L++  A  +G+  Y   VRK+ D +LR LD++V R M+L+  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  MSKSEL++LL+RL++H+D+ELR+++Q +L +++ +  +WR + +  +  F+ +E+ D+    L++++K+L  L+  WK  +I  S+  +  +  A      T+L  VEG  LV+LC  ++  RRL+V +L+EV+ + I I               E P          +IDV+D  +  +LE     +   + A L   Q+ D   L E            ++ ++  +H  + S S    L+ +L   W+ C+ ++  + +L K C  A++ AW     R+  L  ++D  V               + KK  ++   D  + LW+NY+     VA      P ++  S   +     SPD S S+ D+  +                   P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ +S      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM S++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  +D CY  S       F +I  T     +Y  D V+++ L L   S+ + +I E A QL+Q+L  +  + S  +        VE  S   +       GT   +        L +LS  ++S+ L+ M P+LTL +FSE++QR  T +PN + ++L+ L+PW+ NIEL+D          S+ S   S V   K Y   SSSP       L G GWGS QA+ LVLNNL ++T ++G ++  + +EN W  LV N R T+N+  ++ +LI +  ++ + S L + K+++++L +    + +E L   LQ  D +N  V    + PFYR 
Sbjct:   56 RPGEYVLKSLFANFTTISERKIRIVMAEPLEKPLVKSLQRGEDLQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ-------------------------------NGVDDESHEY---RPRSNTKSKNDEQQKD--YLLERRDLAIDFIFSLVLIEVLKQMPLHPVVDGLVQEVIHLAFKHFKYKEGYHG-PNTANMHIVADLYAEVIGVLSQAKFPAVKKRFTSELKELRQKEQSPYVVQSTISLIMGVKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLDLSSRKKHSLALYPMVTCLLCVSQKQFFLNRWHVFLNNCLSNLKSKDPKMARVALESLYRLLWVYMIRIKCESNTATQGRLNSIVTNLFPKGSRSVVPKDMPLNIFVKIIQFIAQERLDFAMKEVIFDLLFVGKPAKAFSLNPERMNIGLRAFLVIADKLQQKDGEPPMP---NTGATLPS-------------------------GNTLRV-------------KKTFLSKP-------------LSEDEAKVIGMSLYYPHVRKALDNILRHLDKEVGRCMMLSNAQMLNKEPEDMITG----------------------ERKPKIDLFRTCMAAIPRILPDGMSKSELIDLLARLTIHMDDELRLIAQNSLQSLLVDFSDWREEVLLGFCSFLLREVQDTHQTLLDSSLKLLLQLLTQWKLLVIFISSNSSGSRLPAEWTSHSTVLHAVEGLALVLLCSCQTGTRRLAVSILREVRQIFIIIGQ---------TEEDERP----------MIDVLDQLSPMVLE-SFAHVAVADSASLPAGQHADLQWLVE------------WNGSLVGSHYDVRSPSRVWILAQSLKEPWALCLFSLLRQEYLPKHCPTALSYAWPYAFTRLQLLMPLLDNPV---------------NAKKTSSAGSADTYVSLWRNYLILCFGVAKPSIMSPGHLRASTPEI--ITPSPD-SNSSYDNKILGT-----------------PSVAWLLKQLVPLMRSESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAES------DKDMEILKDIRAHFSAMVANLIQSVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSSVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQMNLFNWAVDRCYTGSCQLASGCFKAIA-TVCGSRNYSSDIVTLLNLVLFKASDTNREIYEIAMQLMQILEAKLSVYSKRI--------VEQKSGAIL------YGTHRPLP------PLYSLSVTQLSKQLARMYPELTLPLFSEVSQRFPTTHPNGRQVMLAYLLPWLSNIELVD------GGLLSTVSGPSSCVDNRKGYTHNSSSP-----HLLRGTGWGSLQASSLVLNNLMFMTAKYGDDVPGAEMENAWNALVSNERWTNNLRTVLQFLISLCGVSSDTSLLPHIKKVVIYLCRNNTMQTMEELLYELQQTDPVNPVVVHCDNPPFYRF 1497          

HSP 2 Score: 169.859 bits (429), Expect = 5.090e-41
Identity = 161/625 (25.76%), Postives = 284/625 (45.44%), Query Frame = 3
Query: 8904 IENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLID---ADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY----RSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTV-----------------SSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQL-NKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +EN+E+  E D             +   +LI+ ++T    P+W +ED+T                         K P S+  ++L            ++ + S+     +D  L  + +++AL   +  + RHYA RS Q+FRAL        +S L SRL++ +G+  E+VQ YV+EL LTLES + NL      A  L +N       D +     S+P+L    SS K+  ++  + Q     G      +    HQR+ +V +     ++ S    ++    +  ++S +                 +   + +   +L+  IFW    LMES+ E E+   LR L  L+  ++    + + KLEKI     W   F G   LL+KG  S +   ++ +L S++       +VD +  +GFP  VL L   LV  FD  +Q  +  A+ I+ I       +L NL  VM LY   ++ +D   W   V +YL++A+S+ +  ++ ++  +L +    M   +LQ++ + + ++++  S I  +L N  + +  + F+    WKE   IL+L+VS+++SL  P+S    SS +    +      +TP   LPG+ L++ FD+
Sbjct: 1725 MENMESSTEDD-------------EKSSKLIEFLTTRPFGPLWSHEDIT------------------------PKNPQSKSTEQL---------TNFLRHVVSVFKESKSDIRLEQQLSEVALQMALCSSSRHYAGRSFQVFRALRQPLSALAVSDLLSRLVEVVGEHGEEVQGYVMELLLTLESVVDNL------AECLKNN-------DFFVILRASSPDLP---SSGKLTLNRKSTSQLELIPGSA--TASERIRHQRSYSVPKRFGEAERSSDVPRSATLDRIHHHQSNISKLRSLSSSSSRDNVVSTDPTNANHPHNLLATIFWAVVSLMESDFEFEYQMSLRLLGKLLGHISLDKQEYKEKLEKIQLQLKWKD-FTGLQKLLLKGFTSANTTELTLELFSQLTPVSRLPVVDTSQAIGFPLNVLCLIPHLVLHFDSPSQFCKDVAERISQICLEEKNSKLSNLAHVMTLYKTHSYTRDCFSWVNVVCRYLHEAFSDSTLSMVTYMTELLEKGLPSMQQTLLQIIYSLLSHMDL--SGIQAKLFNMEVLTTIEKFVQTTHWKEALNILKLVVSRSASLVSPSSPQSNSSSVDVRRVW-----DTPSKALPGKTLDFHFDI 2277          
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Match: frya (furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060510-4])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 569/1684 (33.79%), Postives = 886/1684 (52.61%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENN----------QKSKA--------LDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESH---LSTNL---WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVA------PLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQY---SSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLV-NYR-TDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYR 7892
            +PGEYV+++L  +F  IS  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+                                    +   ++ Y    P + +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D ++  V+ +AF+HFKY++     PN   ++ +ADLYAEV+GVL+Q++F  V+ +FTSELK LR KE +    QS ISL+MG+KFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  D+ S+KKH +AL P+VTCLL + QKQFFL  W VF+  CLS LK++DP +ARVALESL+RLLWVY++RIK E +T TQ +L+SIV +LFPKGS+ VVP+D  +NIFVKII FIAQE+LDFAMKE+IFDL+   +  K   + PERMNIGL AFL+IA  LQQK+GEPPMP   N+ +  PS                         G   R+              ++  SKP             L++  A  +G+  Y   VRK+ D +LR LD++V R M+L+  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  MSKSEL++LL+RL++H+D+ELR+++Q +L +++ +  +WR + +  +  F+ +E+ D+    L++++K+L  L+  WK  L+++ K  +          Q S             T+L  VEG  LV+LC  ++  RRL+V +L+EV+ + I I               E P          +IDV+D  +  +LE     +   + A L   Q+ D   L E            ++ ++  +H  + S S    L+ +L   W+ C+ ++  + +L K C  A++ AW     R+  L  ++D  V               + KK  ++   D  + LW+NY+     VA      P ++  S   +     SPD S S+ D+  +                   P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ +S      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM S++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  +D CY  S       F +I  T     +Y  D V+++ L L   S+ + +I E A QL+Q+L  +  + S  +        VE  S   +       GT   +        L +LS  ++S+ L+ M P+LTL +FSE++QR  T +PN + ++L+ L+PW+ NIEL+D          S+ S   S V   K Y   SSSP       L G GWGS QA+ LVLNNL ++T ++G ++  + +EN W  LV N R T+N+  ++ +LI +  ++ + S L + K+++++L +    + +E L   LQ  D +N  V    + PFYR
Sbjct:   56 RPGEYVLKSLFANFTTISERKIRIVMAEPLEKPLVKSLQRGEDLQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ-------------------------------NGVDDESHEY---RPRSNTKSKNDEQQKD--YLLERRDLAIDFIFSLVLIEVLKQMPLHPVVDGLVQEVIHLAFKHFKYKEGYHG-PNTANMHIVADLYAEVIGVLSQAKFPAVKKRFTSELKELRQKEQSPYVVQSTISLIMGVKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLDLSSRKKHSLALYPMVTCLLCVSQKQFFLNRWHVFLNNCLSNLKSKDPKMARVALESLYRLLWVYMIRIKCESNTATQGRLNSIVTNLFPKGSRSVVPKDMPLNIFVKIIQFIAQERLDFAMKEVIFDLLFVGKPAKAFSLNPERMNIGLRAFLVIADKLQQKDGEPPMP---NTGATLPS-------------------------GNTLRV-------------KKTFLSKP-------------LSEDEAKVIGMSLYYPHVRKALDNILRHLDKEVGRCMMLSNAQMLNKEPEDMITG----------------------ERKPKIDLFRTCMAAIPRILPDGMSKSELIDLLARLTIHMDDELRLIAQNSLQSLLVDFSDWREEVLLGFCSFLLREVQDTHQTLLDSSLKLLLQLLTQWKLALLSTNKSPDTSKICSAELLQSSSGSRLPAEWTSHSTVLHAVEGLALVLLCSCQTGTRRLAVSILREVRQIFIIIGQ---------TEEDERP----------MIDVLDQLSPMVLES-FAHVAVADSASLPAGQHADLQWLVE------------WNGSLVGSHYDVRSPSRVWILAQSLKEPWALCLFSLLRQEYLPKHCPTALSYAWPYAFTRLQLLMPLLDNPV---------------NAKKTSSAGSADTYVSLWRNYLILCFGVAKPSIMSPGHLRASTPEI--ITPSPD-SNSSYDNKILGT-----------------PSVAWLLKQLVPLMRSESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAES------DKDMEILKDIRAHFSAMVANLIQSVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSSVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQMNLFNWAVDRCYTGSCQLASGCFKAIA-TVCGSRNYSSDIVTLLNLVLFKASDTNREIYEIAMQLMQILEAKLSVYSKRI--------VEQKSGAILY------GTHRPLP------PLYSLSVTQLSKQLARMYPELTLPLFSEVSQRFPTTHPNGRQVMLAYLLPWLSNIELVD------GGLLSTVSGPSSCVDNRKGYTHNSSSP-----HLLRGTGWGSLQASSLVLNNLMFMTAKYGDDVPGAEMENAWNALVSNERWTNNLRTVLQFLISLCGVSSDTSLLPHIKKVVIYLCRNNTMQTMEELLYELQQTDPVNPVVVHCDNPPFYR 1510          

HSP 2 Score: 170.244 bits (430), Expect = 3.997e-41
Identity = 161/625 (25.76%), Postives = 284/625 (45.44%), Query Frame = 3
Query: 8904 IENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLID---ADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY----RSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTV-----------------SSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQL-NKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +EN+E+  E D             +   +LI+ ++T    P+W +ED+T                         K P S+  ++L            ++ + S+     +D  L  + +++AL   +  + RHYA RS Q+FRAL        +S L SRL++ +G+  E+VQ YV+EL LTLES + NL      A  L +N       D +     S+P+L    SS K+  ++  + Q     G      +    HQR+ +V +     ++ S    ++    +  ++S +                 +   + +   +L+  IFW    LMES+ E E+   LR L  L+  ++    + + KLEKI     W   F G   LL+KG  S +   ++ +L S++       +VD +  +GFP  VL L   LV  FD  +Q  +  A+ I+ I       +L NL  VM LY   ++ +D   W   V +YL++A+S+ +  ++ ++  +L +    M   +LQ++ + + ++++  S I  +L N  + +  + F+    WKE   IL+L+VS+++SL  P+S    SS +    +      +TP   LPG+ L++ FD+
Sbjct: 1752 MENMESSTEDD-------------EKSSKLIEFLTTRPFGPLWSHEDIT------------------------PKNPQSKSTEQL---------TNFLRHVVSVFKESKSDIRLEQQLSEVALQMALCSSSRHYAGRSFQVFRALRQPLSALAVSDLLSRLVEVVGEHGEEVQGYVMELLLTLESVVDNL------AECLKNN-------DFFVILRASSPDLP---SSGKLTLNRKSTSQLELIPGSA--TASERIRHQRSYSVPKRFGEAERSSDVPRSATLDRIHHHQSNISKLRSLSSSSSRDNVVSTDPTNANHPHNLLATIFWAVVSLMESDFEFEYQMSLRLLGKLLGHISLDKQEYKEKLEKIQLQLKWKD-FTGLQKLLLKGFTSANTTELTLELFSQLTPVSRLPVVDTSQAIGFPLNVLCLIPHLVLHFDSPSQFCKDVAERISQICLEEKNSKLSNLAHVMTLYKTHSYTRDCFSWVNVVCRYLHEAFSDSTLSMVTYMTELLEKGLPSMQQTLLQIIYSLLSHMDL--SGIQAKLFNMEVLTTIEKFVQTTHWKEALNILKLVVSRSASLVSPSSPQSNSSSVDVRRVW-----DTPSKALPGKTLDFHFDI 2304          
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Match: FRYL (FRY like transcription coactivator [Source:NCBI gene;Acc:779572])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 583/1680 (34.70%), Postives = 894/1680 (53.21%), Query Frame = 3
Query: 2946 ILINYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK-------------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTS-NERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            I+ N  I    KPGEYVI++L   F   +  K E+ +       + + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                        T+  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D ++  VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++LVELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK       K  + +              ++L  ++   VEGF LV+LC  R + RRL+V+VL+E+++L            + + VS+              IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I              N K +T+    D  + LW+NY+   C  A    + S G+V     + L S   SG  IDS  I N                 P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E++D++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F N  DY CD V+++ L L   ++    I E A QLLQ+L  + F           +  +E++    + SP             S    L + S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  +     R  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G E++ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   93 IMSNITIDPDVKPGEYVIKSLFAEFAIQAEKKIEVVMAEPLEKPLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYKRQ-----------------------------------NGTDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDSLVQEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSSKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMCNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRADLVELLARLTIHMDEELRGLAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNIDVQRGVPNGAAHTLPLERSLYSSVFHVVEGFALVILCNSRPATRRLAVNVLREIRAL-----------CTVLEVSK--------GDEELAIDVMDRLSPSILESFIHLTGADQTTLLYCPNSIDLQTLAEWSSSPI----SHQF-DVVSPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKYCPTAVSYAWMFAYTRL----QLLSPQVDI----------NSPINAKKVTAVTGSDSYIGLWRNYLILCCSAATSTSAASTGSVRCSPPETLASTPDSGYCIDSKIIGN-----------------PSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALDRRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHSLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMYWAVDRCYTGSKRVASGCFKAIASVFQNR-DYQCDTVTLLNLILFKAADSARDIYEVAMQLLQILEPKMF---------RYAHKLEVHRTDGILSP------------PSALPHLYSASYYQLSEELARTYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHEDEDEDSLR-DRDMMVNS------RRWLRGEGWGSPQATVMVLNNLMYMTAKYGDEVAWSEIENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTVQLLEELVSELQLTDPVSSGVSHMDNPPYYRI 1559          

HSP 2 Score: 193.356 bits (490), Expect = 5.939e-48
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGT---LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY--------RSTPNLKNSFSSPKIG-YHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL----KGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEA-ETPRLELPGRILEYQFDV 10694
            + + V+ L++ I++ +  P+W +EDV+                         K P          I S   L   +K + S+     +   L  + +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  E+ Q +V+EL LTLES I  L+      + L      +  D L         +ST  L  S S    G +  + +  R  ++     +    +  +  +  I         S  R  SL    +G ++D + T        + T+L+  IFW+   L+ES+ E+E+   L+ L+ L+  L     + R K+EK+     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L LL   +  FD   Q  R  A  IA +        L NL  +M LYS  ++++D   W   V +YL+D++S+I+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+         +  P +   +       ELPG+ L+++FD+
Sbjct: 1827 QEEKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNP---------CIKSAEQLTVFLKHVVSVFKHSRSGFQLEHQLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTAQTLSDVLSRLVETVGDATEEAQGFVIELLLTLESAIDTLSETMKHYDLLSVLAQSSYHDSLMGNKNAANRKSTGQLNLSTSPLSSGNFMGNYNNARSNSLRLSLIVDRRGDRRRSNTLDIADGRINHGGSLARTRSLSSLREGGMQDVQPTT-------DPTNLLATIFWIGASLLESDYEYEYLLALKLLNKLLTHLPLDKSECREKIEKVQSKLKWNN-FPGLQQLFLKGFTSMSTQEMTVHLLSKLITVSKHALVDPSQMAGFPLNILCLLPHLIQHFDNPNQFCRETADRIAKVCAEEKTATLTNLAHMMSLYSTHSYSRDCANWINVVCRYLHDSFSDITFNLVTYLAELLEKGLASMQQSLLQIIHSLLSHIDLS-AAPVKQFNLEIIKVIGKYVQSPYWKESLNILKLVVSRSASLVVPSDAPKSYGGDIGSPEISFTKIFNCTSKELPGKTLDFKFDI 2379          
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Match: FRYL (FRY like transcription coactivator [Source:NCBI gene;Acc:779572])

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 583/1680 (34.70%), Postives = 894/1680 (53.21%), Query Frame = 3
Query: 2946 ILINYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK-------------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTS-NERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            I+ N  I    KPGEYVI++L   F   +  K E+ +       + + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                        T+  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D ++  VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++LVELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK       K  + +              ++L  ++   VEGF LV+LC  R + RRL+V+VL+E+++L            + + VS+              IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I              N K +T+    D  + LW+NY+   C  A    + S G+V     + L S   SG  IDS  I N                 P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E++D++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F N  DY CD V+++ L L   ++    I E A QLLQ+L  + F           +  +E++    + SP             S    L + S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  +     R  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G E++ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   93 IMSNITIDPDVKPGEYVIKSLFAEFAIQAEKKIEVVMAEPLEKPLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYKRQ-----------------------------------NGTDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDSLVQEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSSKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMCNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRADLVELLARLTIHMDEELRGLAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNIDVQRGVPNGAAHTLPLERSLYSSVFHVVEGFALVILCNSRPATRRLAVNVLREIRAL-----------CTVLEVSK--------GDEELAIDVMDRLSPSILESFIHLTGADQTTLLYCPNSIDLQTLAEWSSSPI----SHQF-DVVSPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKYCPTAVSYAWMFAYTRL----QLLSPQVDI----------NSPINAKKVTAVTGSDSYIGLWRNYLILCCSAATSTSAASTGSVRCSPPETLASTPDSGYCIDSKIIGN-----------------PSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALDRRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHSLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMYWAVDRCYTGSKRVASGCFKAIASVFQNR-DYQCDTVTLLNLILFKAADSARDIYEVAMQLLQILEPKMF---------RYAHKLEVHRTDGILSP------------PSALPHLYSASYYQLSEELARTYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHEDEDEDSLR-DRDMMVNS------RRWLRGEGWGSPQATVMVLNNLMYMTAKYGDEVAWSEIENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTVQLLEELVSELQLTDPVSSGVSHMDNPPYYRI 1559          

HSP 2 Score: 193.741 bits (491), Expect = 4.863e-48
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGT---LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY--------RSTPNLKNSFSSPKIG-YHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL----KGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEA-ETPRLELPGRILEYQFDV 10694
            + + V+ L++ I++ +  P+W +EDV+                         K P          I S   L   +K + S+     +   L  + +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  E+ Q +V+EL LTLES I  L+      + L      +  D L         +ST  L  S S    G +  + +  R  ++     +    +  +  +  I         S  R  SL    +G ++D + T        + T+L+  IFW+   L+ES+ E+E+   L+ L+ L+  L     + R K+EK+     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L LL   +  FD   Q  R  A  IA +        L NL  +M LYS  ++++D   W   V +YL+D++S+I+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+         +  P +   +       ELPG+ L+++FD+
Sbjct: 1837 QEEKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNP---------CIKSAEQLTVFLKHVVSVFKHSRSGFQLEHQLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTAQTLSDVLSRLVETVGDATEEAQGFVIELLLTLESAIDTLSETMKHYDLLSVLAQSSYHDSLMGNKNAANRKSTGQLNLSTSPLSSGNFMGNYNNARSNSLRLSLIVDRRGDRRRSNTLDIADGRINHGGSLARTRSLSSLREGGMQDVQPTT-------DPTNLLATIFWIGASLLESDYEYEYLLALKLLNKLLTHLPLDKSECREKIEKVQSKLKWNN-FPGLQQLFLKGFTSMSTQEMTVHLLSKLITVSKHALVDPSQMAGFPLNILCLLPHLIQHFDNPNQFCRETADRIAKVCAEEKTATLTNLAHMMSLYSTHSYSRDCANWINVVCRYLHDSFSDITFNLVTYLAELLEKGLASMQQSLLQIIHSLLSHIDLS-AAPVKQFNLEIIKVIGKYVQSPYWKESLNILKLVVSRSASLVVPSDAPKSYGGDIGSPEISFTKIFNCTSKELPGKTLDFKFDI 2389          
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Match: FRYL (FRY like transcription coactivator [Source:NCBI gene;Acc:779572])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 583/1695 (34.40%), Postives = 894/1695 (52.74%), Query Frame = 3
Query: 2946 ILINYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK-------------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTS-NERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            I+ N  I    KPGEYVI++L   F   +  K E+ +       + + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                        T+  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D ++  VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++LVELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK       K  + +              ++L  ++   VEGF LV+LC  R + RRL+V+VL+E+++L            + + VS+              IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I              N K +T+    D  + LW+NY+   C  A    + S G+V     + L S   SG  IDS  I N                 P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E++D++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F N  DY CD V+++ L L   ++    I E A QLLQ+L  + F           +  +E++    + SP             S    L + S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  +     R  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G E++ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   93 IMSNITIDPDVKPGEYVIKSLFAEFAIQAEKKIEVVMAEPLEKPLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYKRQ-----------------------------------NGTDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDSLVQEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSSKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMCNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRADLVELLARLTIHMDEELRGLAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNIDVQRGVPNGAAHTLPLERSLYSSVFHVVEGFALVILCNSRPATRRLAVNVLREIRAL-----------CTVLEVSK--------GDEELAIDVMDRLSPSILESFIHLTGADQTTLLYCPNSIDLQTLAEWSSSPI----SHQF-DVVSPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKYCPTAVSYAWMFAYTRL----QLLSPQVDI----------NSPINAKKVTAVTGSDSYIGLWRNYLILCCSAATSTSAASTGSVRCSPPETLASTPDSGYCIDSKIIGN-----------------PSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALDRRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHSLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMYWAVDRCYTGSKRVASGCFKAIASVFQNR-DYQCDTVTLLNLILFKAADSARDIYEVAMQLLQILEPKMF---------RYAHKLEVHRTDGILSP------------PSALPHLYSASYYQLSEELARTYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHEDEDEDSLR-DRDMMVNS------RRWLRGEGWGSPQATVMVLNNLMYMTAKYGDEVAWSEIENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTVQLLEELVSELQLTDPVSSGVSHMDNPPYYRI 1574          

HSP 2 Score: 193.741 bits (491), Expect = 4.914e-48
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGT---LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY--------RSTPNLKNSFSSPKIG-YHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL----KGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEA-ETPRLELPGRILEYQFDV 10694
            + + V+ L++ I++ +  P+W +EDV+                         K P          I S   L   +K + S+     +   L  + +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  E+ Q +V+EL LTLES I  L+      + L      +  D L         +ST  L  S S    G +  + +  R  ++     +    +  +  +  I         S  R  SL    +G ++D + T        + T+L+  IFW+   L+ES+ E+E+   L+ L+ L+  L     + R K+EK+     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L LL   +  FD   Q  R  A  IA +        L NL  +M LYS  ++++D   W   V +YL+D++S+I+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+         +  P +   +       ELPG+ L+++FD+
Sbjct: 1852 QEEKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNP---------CIKSAEQLTVFLKHVVSVFKHSRSGFQLEHQLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTAQTLSDVLSRLVETVGDATEEAQGFVIELLLTLESAIDTLSETMKHYDLLSVLAQSSYHDSLMGNKNAANRKSTGQLNLSTSPLSSGNFMGNYNNARSNSLRLSLIVDRRGDRRRSNTLDIADGRINHGGSLARTRSLSSLREGGMQDVQPTT-------DPTNLLATIFWIGASLLESDYEYEYLLALKLLNKLLTHLPLDKSECREKIEKVQSKLKWNN-FPGLQQLFLKGFTSMSTQEMTVHLLSKLITVSKHALVDPSQMAGFPLNILCLLPHLIQHFDNPNQFCRETADRIAKVCAEEKTATLTNLAHMMSLYSTHSYSRDCANWINVVCRYLHDSFSDITFNLVTYLAELLEKGLASMQQSLLQIIHSLLSHIDLS-AAPVKQFNLEIIKVIGKYVQSPYWKESLNILKLVVSRSASLVVPSDAPKSYGGDIGSPEISFTKIFNCTSKELPGKTLDFKFDI 2404          
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Match: FRYL (FRY like transcription coactivator [Source:NCBI gene;Acc:779572])

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 580/1684 (34.44%), Postives = 890/1684 (52.85%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK-------------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTS-NERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +       + + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                        T+  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D ++  VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++LVELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK       K  + +              ++L  ++   VEGF LV+LC  R + RRL+V+VL+E+++L            + + VS+              IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I              N K +T+    D  + LW+NY+   C  A    + S G+V     + L S   SG  IDS  I N                 P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E++D++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F N  DY CD V+++ L L   ++    I E A QLLQ+L  + F           +  +E++    + SP             S    L + S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  +     R  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G E++ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAIQAEKKIEVVMAEPLEKPLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYKRQ-----------------------------------NGTDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDSLVQEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSSKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMCNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRADLVELLARLTIHMDEELRGLAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNIDVQRGVPNGAAHTLPLERSLYSSVFHVVEGFALVILCNSRPATRRLAVNVLREIRAL-----------CTVLEVSK--------GDEELAIDVMDRLSPSILESFIHLTGADQTTLLYCPNSIDLQTLAEWSSSPI----SHQF-DVVSPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKYCPTAVSYAWMFAYTRL----QLLSPQVDI----------NSPINAKKVTAVTGSDSYIGLWRNYLILCCSAATSTSAASTGSVRCSPPETLASTPDSGYCIDSKIIGN-----------------PSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALDRRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHSLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMYWAVDRCYTGSKRVASGCFKAIASVFQNR-DYQCDTVTLLNLILFKAADSARDIYEVAMQLLQILEPKMF---------RYAHKLEVHRTDGILSP------------PSALPHLYSASYYQLSEELARTYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHEDEDEDSLR-DRDMMVNS------RRWLRGEGWGSPQATVMVLNNLMYMTAKYGDEVAWSEIENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTVQLLEELVSELQLTDPVSSGVSHMDNPPYYRI 1481          

HSP 2 Score: 193.741 bits (491), Expect = 5.640e-48
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGT---LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY--------RSTPNLKNSFSSPKIG-YHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL----KGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEA-ETPRLELPGRILEYQFDV 10694
            + + V+ L++ I++ +  P+W +EDV+                         K P          I S   L   +K + S+     +   L  + +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  E+ Q +V+EL LTLES I  L+      + L      +  D L         +ST  L  S S    G +  + +  R  ++     +    +  +  +  I         S  R  SL    +G ++D + T        + T+L+  IFW+   L+ES+ E+E+   L+ L+ L+  L     + R K+EK+     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L LL   +  FD   Q  R  A  IA +        L NL  +M LYS  ++++D   W   V +YL+D++S+I+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+         +  P +   +       ELPG+ L+++FD+
Sbjct: 1759 QEEKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNP---------CIKSAEQLTVFLKHVVSVFKHSRSGFQLEHQLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTAQTLSDVLSRLVETVGDATEEAQGFVIELLLTLESAIDTLSETMKHYDLLSVLAQSSYHDSLMGNKNAANRKSTGQLNLSTSPLSSGNFMGNYNNARSNSLRLSLIVDRRGDRRRSNTLDIADGRINHGGSLARTRSLSSLREGGMQDVQPTT-------DPTNLLATIFWIGASLLESDYEYEYLLALKLLNKLLTHLPLDKSECREKIEKVQSKLKWNN-FPGLQQLFLKGFTSMSTQEMTVHLLSKLITVSKHALVDPSQMAGFPLNILCLLPHLIQHFDNPNQFCRETADRIAKVCAEEKTATLTNLAHMMSLYSTHSYSRDCANWINVVCRYLHDSFSDITFNLVTYLAELLEKGLASMQQSLLQIIHSLLSHIDLS-AAPVKQFNLEIIKVIGKYVQSPYWKESLNILKLVVSRSASLVVPSDAPKSYGGDIGSPEISFTKIFNCTSKELPGKTLDFKFDI 2311          
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Match: FRYL (FRY like transcription coactivator [Source:NCBI gene;Acc:779572])

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 583/1695 (34.40%), Postives = 894/1695 (52.74%), Query Frame = 3
Query: 2946 ILINYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK-------------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTS-NERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            I+ N  I    KPGEYVI++L   F   +  K E+ +       + + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                        T+  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D ++  VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+E+F   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++LVELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK       K  + +              ++L  ++   VEGF LV+LC  R + RRL+V+VL+E+++L            + + VS+              IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I              N K +T+    D  + LW+NY+   C  A    + S G+V     + L S   SG  IDS  I N                 P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E++D++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F N  DY CD V+++ L L   ++    I E A QLLQ+L  + F           +  +E++    + SP             S    L + S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  +     R  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G E++ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   71 IMSNITIDPDVKPGEYVIKSLFAEFAIQAEKKIEVVMAEPLEKPLSRSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYKRQ-----------------------------------NGTDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDSLVQEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEEFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSSKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMCNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRADLVELLARLTIHMDEELRGLAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMHNKNIDVQRGVPNGAAHTLPLERSLYSSVFHVVEGFALVILCNSRPATRRLAVNVLREIRAL-----------CTVLEVSK--------GDEELAIDVMDRLSPSILESFIHLTGADQTTLLYCPNSIDLQTLAEWSSSPI----SHQF-DVVSPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKYCPTAVSYAWMFAYTRL----QLLSPQVDI----------NSPINAKKVTAVTGSDSYIGLWRNYLILCCSAATSTSAASTGSVRCSPPETLASTPDSGYCIDSKIIGN-----------------PSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALDRRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHSLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMYWAVDRCYTGSKRVASGCFKAIASVFQNR-DYQCDTVTLLNLILFKAADSARDIYEVAMQLLQILEPKMF---------RYAHKLEVHRTDGILSP------------PSALPHLYSASYYQLSEELARTYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHEDEDEDSLR-DRDMMVNS------RRWLRGEGWGSPQATVMVLNNLMYMTAKYGDEVAWSEIENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTVQLLEELVSELQLTDPVSSGVSHMDNPPYYRI 1552          

HSP 2 Score: 193.741 bits (491), Expect = 5.266e-48
Identity = 163/595 (27.39%), Postives = 281/595 (47.23%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGT---LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY--------RSTPNLKNSFSSPKIG-YHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL----KGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEA-ETPRLELPGRILEYQFDV 10694
            + + V+ L++ I++ +  P+W +EDV+                         K P          I S   L   +K + S+     +   L  + +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  E+ Q +V+EL LTLES I  L+      + L      +  D L         +ST  L  S S    G +  + +  R  ++     +    +  +  +  I         S  R  SL    +G ++D + T        + T+L+  IFW+   L+ES+ E+E+   L+ L+ L+  L     + R K+EK+     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L LL   +  FD   Q  R  A  IA +        L NL  +M LYS  ++++D   W   V +YL+D++S+I+  L+ ++  +L +  + M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+         +  P +   +       ELPG+ L+++FD+
Sbjct: 1810 QEEKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNP---------CIKSAEQLTVFLKHVVSVFKHSRSGFQLEHQLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTAQTLSDVLSRLVETVGDATEEAQGFVIELLLTLESAIDTLSETMKHYDLLSVLAQSSYHDSLMGNKNAANRKSTGQLNLSTSPLSSGNFMGNYNNARSNSLRLSLIVDRRGDRRRSNTLDIADGRINHGGSLARTRSLSSLREGGMQDVQPTT-------DPTNLLATIFWIGASLLESDYEYEYLLALKLLNKLLTHLPLDKSECREKIEKVQSKLKWNN-FPGLQQLFLKGFTSMSTQEMTVHLLSKLITVSKHALVDPSQMAGFPLNILCLLPHLIQHFDNPNQFCRETADRIAKVCAEEKTATLTNLAHMMSLYSTHSYSRDCANWINVVCRYLHDSFSDITFNLVTYLAELLEKGLASMQQSLLQIIHSLLSHIDLS-AAPVKQFNLEIIKVIGKYVQSPYWKESLNILKLVVSRSASLVVPSDAPKSYGGDIGSPEISFTKIFNCTSKELPGKTLDFKFDI 2362          
BLAST of Protein furry-like protein vs. Ensembl Mouse
Match: Fryl (FRY like transcription coactivator [Source:MGI Symbol;Acc:MGI:1919563])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 580/1672 (34.69%), Postives = 893/1672 (53.41%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTL-IASTKENNQKSKA--------LDK----TLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQ--GTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     + + +  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D +++ VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL                         Q  D +    ++       +  R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++L+ELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK    + +  +++Q   A        L++    T+   VEGF LV+LC  R + RRL+V VL+E+++L   +               E P  ++       IDV+D  +  ILE  +     ++   L    ++D  TLA+  ++PI    S+ + + I+ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I             + KK   +   D  + LW+NY+   CC A    S S   G+V     + L S   SG +IDS  +                   P+   L K ++ +++ E  ++  S++  +G  NP   R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S D+K   L  E +TLLL+ N +  + +   +D CY  S       F +I   F N  DY CD V ++ L L   ++    I E A QLLQ+L  + F                       +  +    T   +S +S    L ++S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  +  +L  L+PWM NIEL+D            D     +  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G EL+ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLS--RSLQRGEDLQFDQLVSSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------NGTDDESYGYRPRSSTKSKGDEQHRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSL-------------------------QQKDGDPPMPTTGVILPSGNTLRVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMYNRTQDSQHGIANGGPHPPPLERNPYSTVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL---------------EVPKGDD----ELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSVDLQTLADWNSSPI----SHQF-DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQ----LLSPQVDI---------NSPINAKKVNATTSSDSYIGLWRNYLVL-CCSAATSPSPSAPAGSVRCSPPETLASTPDSGYSIDSKIVG-----------------IPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGVFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDSETHFLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSLDKKVHQLGCEAVTLLLELNPDQSSLMYWAVDRCYTGSRRVAAGCFKAIANVFQNR-DYQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMF---------------------RYAHKLEVQRTDGVLSQLSPLPHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQAMLHYLLPWMNNIELVDLKPLPSGRRQDEDEDDSLK-DRELMVTS------RRWLRGEGWGSPQATAMVLNNLMYMTAKYGDELAWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRI 1468          

HSP 2 Score: 194.126 bits (492), Expect = 2.599e-48
Identity = 171/614 (27.85%), Postives = 293/614 (47.72%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLI---DADGT-LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNH-----HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS--TVSSNLSWD-----ERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL-----------ELPGRILEYQFDV 10694
            ++  V+ L++ I++ +  P+W +EDV+                        +K P+ +  D+L          T +K + S+    +A+G  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLES I  L                    DL  +    ++S+  P +G     +R+    +      +NSS H       R++++  S    ++   RR  +L          G+L   +S  ++     +D     E ++L+  IFW+A  L+ES+ E+E+   LR LS L+  L     + R K+E +     W + FPG   L +KG  S S   ++  LLS+++     +LVDP+   GFP  +L LL   +  FD  TQ  +  A  IA +        L NL  +M LYS  T+++D + W   V +YL+D++SE +  L+ ++  +L +  S M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P            +P     +  +P +           ELPG+ L++ FD+
Sbjct: 1747 QDGKVKTLMEFITSRKRGPLWNHEDVS------------------------SKNPSIKSADQLA---------TFLKHVVSVFKQSNAEGIHLERHLSEVALQTALSCSSRHYAGRSFQIFRALKQPLSADTLSDVLSRLVETVGDPGEDAQGFVIELLLTLESAIDTL-------------AETMKHYDLLSALS--QSSYHDPVMGNKYAANRKSTGQLNLSTSPINSSGHLGCNGDTRSNSLRLSLVGDRRGDRRRSNTLDITDGRINHGGSLARTRSLSSLREKGVYDTQPPTEPSNLMATIFWIATSLLESDYEYEYLLALRLLSKLLTHLPLDKSESREKIENVQSKLKWSN-FPGLQQLFLKGFTSVSTQEMTVHLLSQLISVSKHTLVDPSQVSGFPLNILCLLPHLIQHFDSPTQFCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDCSNWINVVCRYLHDSFSEATFSLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIIKIIGKYVQSPYWKEALNILKLVVSRSASLVVPND----------IPKAYGVDVGSPEISFAKIFNNVSKELPGKTLDFHFDI 2300          
BLAST of Protein furry-like protein vs. Ensembl Mouse
Match: Fryl (FRY like transcription coactivator [Source:MGI Symbol;Acc:MGI:1919563])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 580/1672 (34.69%), Postives = 893/1672 (53.41%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTL-IASTKENNQKSKA--------LDK----TLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQ--GTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     + + +  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D +++ VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL                         Q  D +    ++       +  R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++L+ELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK    + +  +++Q   A        L++    T+   VEGF LV+LC  R + RRL+V VL+E+++L   +               E P  ++       IDV+D  +  ILE  +     ++   L    ++D  TLA+  ++PI    S+ + + I+ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I             + KK   +   D  + LW+NY+   CC A    S S   G+V     + L S   SG +IDS  +                   P+   L K ++ +++ E  ++  S++  +G  NP   R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S D+K   L  E +TLLL+ N +  + +   +D CY  S       F +I   F N  DY CD V ++ L L   ++    I E A QLLQ+L  + F                       +  +    T   +S +S    L ++S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  +  +L  L+PWM NIEL+D            D     +  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G EL+ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLS--RSLQRGEDLQFDQLVSSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------NGTDDESYGYRPRSSTKSKGDEQHRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSL-------------------------QQKDGDPPMPTTGVILPSGNTLRVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMYNRTQDSQHGIANGGPHPPPLERNPYSTVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL---------------EVPKGDD----ELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSVDLQTLADWNSSPI----SHQF-DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQ----LLSPQVDI---------NSPINAKKVNATTSSDSYIGLWRNYLVL-CCSAATSPSPSAPAGSVRCSPPETLASTPDSGYSIDSKIVG-----------------IPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGVFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDSETHFLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSLDKKVHQLGCEAVTLLLELNPDQSSLMYWAVDRCYTGSRRVAAGCFKAIANVFQNR-DYQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMF---------------------RYAHKLEVQRTDGVLSQLSPLPHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQAMLHYLLPWMNNIELVDLKPLPSGRRQDEDEDDSLK-DRELMVTS------RRWLRGEGWGSPQATAMVLNNLMYMTAKYGDELAWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRI 1468          

HSP 2 Score: 194.126 bits (492), Expect = 2.599e-48
Identity = 171/614 (27.85%), Postives = 293/614 (47.72%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLI---DADGT-LVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNH-----HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS--TVSSNLSWD-----ERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL-----------ELPGRILEYQFDV 10694
            ++  V+ L++ I++ +  P+W +EDV+                        +K P+ +  D+L          T +K + S+    +A+G  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLES I  L                    DL  +    ++S+  P +G     +R+    +      +NSS H       R++++  S    ++   RR  +L          G+L   +S  ++     +D     E ++L+  IFW+A  L+ES+ E+E+   LR LS L+  L     + R K+E +     W + FPG   L +KG  S S   ++  LLS+++     +LVDP+   GFP  +L LL   +  FD  TQ  +  A  IA +        L NL  +M LYS  T+++D + W   V +YL+D++SE +  L+ ++  +L +  S M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P            +P     +  +P +           ELPG+ L++ FD+
Sbjct: 1747 QDGKVKTLMEFITSRKRGPLWNHEDVS------------------------SKNPSIKSADQLA---------TFLKHVVSVFKQSNAEGIHLERHLSEVALQTALSCSSRHYAGRSFQIFRALKQPLSADTLSDVLSRLVETVGDPGEDAQGFVIELLLTLESAIDTL-------------AETMKHYDLLSALS--QSSYHDPVMGNKYAANRKSTGQLNLSTSPINSSGHLGCNGDTRSNSLRLSLVGDRRGDRRRSNTLDITDGRINHGGSLARTRSLSSLREKGVYDTQPPTEPSNLMATIFWIATSLLESDYEYEYLLALRLLSKLLTHLPLDKSESREKIENVQSKLKWSN-FPGLQQLFLKGFTSVSTQEMTVHLLSQLISVSKHTLVDPSQVSGFPLNILCLLPHLIQHFDSPTQFCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDCSNWINVVCRYLHDSFSEATFSLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIIKIIGKYVQSPYWKEALNILKLVVSRSASLVVPND----------IPKAYGVDVGSPEISFAKIFNNVSKELPGKTLDFHFDI 2300          
BLAST of Protein furry-like protein vs. Ensembl Mouse
Match: Fry (FRY microtubule binding protein [Source:MGI Symbol;Acc:MGI:2443895])

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 597/1883 (31.70%), Postives = 943/1883 (50.08%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD-----------------SSPLQLENNMKILYHLINAWKNTLIASTKENN--QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ ++++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE +    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W VF+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I  +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  ++          +Y   TL +  A  +G+  Y + VRK+   +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                 +    +       Y   N  +N+ +     ++  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L + +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L    N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  +   +TS             T++  D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I     N  +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+  + +EN W  L N    ++N+ V + +LI +  ++ ++  L Y K++  +L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G    P      S +  L+ S+   S +I       + Y  S+ G+             DEDK   +          +    ++IT+ K        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   58 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDIINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQSPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHVFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITITTTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRVKK---------TYLSKTLTEEEAKMIGMSLYYSQVRKAVGNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGRAYEQANKIRNSELIPNGSSHRMQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFLALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPPTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPVNAKKTS-------------TASSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVMLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIATVCGNR-NYPFDIVTLLNLVLFKASDTNREIYEVSMQLMQILEAKLFVHSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGEVTASHGLKGNGWGSPEATSLVLNNLMYMTAKYGDEVPGAEMENAWNALANNEKWSNNLRVTLQFLISLCGVSSDTILLPYIKKVATYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQDSFP--DPEESKI--LKESDDRFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLSITEAK-----QPQPLPMPCSGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1657          

HSP 2 Score: 170.244 bits (430), Expect = 4.391e-41
Identity = 146/506 (28.85%), Postives = 248/506 (49.01%), Query Frame = 3
Query: 9249 AQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNP----QEMFA-------------NSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISR-QRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQ---PSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+      ++F              + L  +   T + ++   TP               + SR QR  +V   F +++ S+   R++ +      T+Q      R  +SLK +L D  S VS        T+L+  IFW+   LMES+ E E+   LR L+ L+  +     + R KLEK+     W   FPG   LL+KG  S +   ++ QL S +       +VD +  +GFP  VL LL  +   F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    M   +LQV+ + + Y++++    V Q N  +    + ++ ++ W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1848 SEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLSDCLKNSDLFTVLSRSSSPDLSSSSKLTASRKSTGQLNVNPGTPGSGGGGGGSGNTTTAERSRHQRSFSVPKKFGVVDRSSDPPRSATLDRIQACTQQGLSSKTRSNSSLKESLTD-PSHVS------HPTNLLATIFWVTVALMESDFEFEYLMALRLLNRLLAHMPLEKAENREKLEKLQAQLKWAD-FPGLQQLLLKGFTSLTTTDLTLQLFSLLTSVSKVPMVDSSQAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSMQQPLLQVIYSLLSYMDLS-VVPVKQFNMEVLKTIEKYVQSIHWREALNILKLVVSRSASLVLPSYQHSDLSKIELHRVWTSASK-----ELPGKTLDFHFDI 2339          
BLAST of Protein furry-like protein vs. Ensembl Mouse
Match: Fry (FRY microtubule binding protein [Source:MGI Symbol;Acc:MGI:2443895])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 599/1883 (31.81%), Postives = 944/1883 (50.13%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD-----------------SSPLQLENNMKILYHLINAWKNTLIASTKENN--QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ ++++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE +    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W VF+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I  +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  +        +KT Y   TL +  A  +G+  Y + VRK+   +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                 +    +       Y   N  +N+ +     ++  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L + +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L    N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  +   +TS             T++  D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I     N  +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+  + +EN W  L N    ++N+ V + +LI +  ++ ++  L Y K++  +L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G    P      S +  L+ S+   S +I       + Y  S+ G+             DEDK   +          +    ++IT+ K        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   61 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDIINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQSPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHVFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITITTTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRV--------KKT-YLSKTLTEEEAKMIGMSLYYSQVRKAVGNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGRAYEQANKIRNSELIPNGSSHRMQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFLALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPPTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPVNAKKTS-------------TASSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVMLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIATVCGNR-NYPFDIVTLLNLVLFKASDTNREIYEVSMQLMQILEAKLFVHSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGEVTASHGLKGNGWGSPEATSLVLNNLMYMTAKYGDEVPGAEMENAWNALANNEKWSNNLRVTLQFLISLCGVSSDTILLPYIKKVATYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQDSFP--DPEESKI--LKESDDRFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLSITEAK-----QPQPLPMPCSGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1660          

HSP 2 Score: 170.244 bits (430), Expect = 4.817e-41
Identity = 146/506 (28.85%), Postives = 248/506 (49.01%), Query Frame = 3
Query: 9249 AQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNP----QEMFA-------------NSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISR-QRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQ---PSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+      ++F              + L  +   T + ++   TP               + SR QR  +V   F +++ S+   R++ +      T+Q      R  +SLK +L D  S VS        T+L+  IFW+   LMES+ E E+   LR L+ L+  +     + R KLEK+     W   FPG   LL+KG  S +   ++ QL S +       +VD +  +GFP  VL LL  +   F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    M   +LQV+ + + Y++++    V Q N  +    + ++ ++ W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1851 SEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLSDCLKNSDLFTVLSRSSSPDLSSSSKLTASRKSTGQLNVNPGTPGSGGGGGGSGNTTTAERSRHQRSFSVPKKFGVVDRSSDPPRSATLDRIQACTQQGLSSKTRSNSSLKESLTD-PSHVS------HPTNLLATIFWVTVALMESDFEFEYLMALRLLNRLLAHMPLEKAENREKLEKLQAQLKWAD-FPGLQQLLLKGFTSLTTTDLTLQLFSLLTSVSKVPMVDSSQAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSMQQPLLQVIYSLLSYMDLS-VVPVKQFNMEVLKTIEKYVQSIHWREALNILKLVVSRSASLVLPSYQHSDLSKIELHRVWTSASK-----ELPGKTLDFHFDI 2342          
BLAST of Protein furry-like protein vs. Ensembl Mouse
Match: Fryl (FRY like transcription coactivator [Source:MGI Symbol;Acc:MGI:1919563])

HSP 1 Score: 227.639 bits (579), Expect = 3.709e-67
Identity = 114/184 (61.96%), Postives = 139/184 (75.54%), Query Frame = 3
Query: 3960 MCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHK--VIIPERMNIGLCAFLLIALSLQQKEGEPPMP 4460
            + S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SLQQK+G+PPMP
Sbjct:    1 LSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKIPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSLQQKDGDPPMP 184          
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Match: sp|O94915|FRYL_HUMAN (Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2)

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 585/1672 (34.99%), Postives = 895/1672 (53.53%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKN--EKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSK-----------ALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE----DQLSQLI--TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYVI++L   F   +  K E+ +    EK+LS  + ++  +D +F  L+ ++++ AE+ LPSLL+ L DW+                                     + + +  +   P +++    D    +  ++ E+RD+ VD+IFC  ++ VLKQ+ +HP  D +++ VL++AF+HFK+++   +  N   ++ IADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  ++ S+KKH +AL PL+TCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVY++RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFDL+   +S K   I PERMNIGL  FL+IA SL          Q+ + E   P+        N                 R+ ++ +NK                             TL D  A  +G+  Y   VRK+ D++LR LD++V R M +T  +  NKE +D++TG                      ERKPKI+L +TCI+AIPRL+P  MS+++L+ELL+RL++H+DEELR ++   L  ++ + P+WR   +  ++ F+ +E+TD  P  L+N +K+L  LIN WK    A     NQ ++            L+++    +   VEGF LV+LC  R + RRL+V VL+E+++L   +               E P  ++       IDV+D  +  ILE  +     ++   L    +ID  TLAE  ++PI    S+ + + I+ +H  + +      + W   +++   +  L K C  AV+ AW     R+     ++ P V I             + KK  T+   D  + LW+NY+   C  A    S S G+V     + L S   SG +IDS  I                   P+   L K ++ +++ E  ++  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  +S     D  +  +  T++++++L R  L++ ++      +     L + R HF  L+  ++ + P  +R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S D+K   L  E +TLLL+ N +    +   +D CY  S       F +I   F N  DY CD V ++ L L   ++    I E A QLLQ+L  + F                       +  +    T   +S +S    L ++S  ++S  L+   P+LTL+IFSEI+QR+ TA+P  + ++L  L+PWM NIEL+D      +  +  D     +  R    +S      +  L G GWGS QAT +VLNNL Y+T ++G EL+ S +EN+W  L +    N+ +I+H+LI I  + +  S L Y K++IV+L ++K  +LLE L S LQ  D ++  V    + P+YRI
Sbjct:   11 KPGEYVIKSLFAEFAVQAEKKIEVVMAEPLEKLLS--RSLQRGEDLQFDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------NGTEDESYEYRPRSSTKSKGDEQQRERDYLLERRDLAVDFIFCLVLVEVLKQIPVHPVPDPLVHEVLNLAFKHFKHKEG-YSGTNTGNVHIIADLYAEVIGVLAQSKFQAVRKKFVTELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFELSSRKKHSLALYPLITCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYVIRIKCESNTVTQSRLMSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIFDLLSVGKSTKTFTINPERMNIGLRVFLVIADSL----------QQKDGEPPMPTTGVILPSGNTL---------------RVKKIFLNK-----------------------------TLTDEEAKVIGMSVYYPQVRKALDSILRHLDKEVGRPMCMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCIAAIPRLIPDGMSRTDLIELLARLTIHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQA--AQMHNKNQDTQHGVANGASHPPPLERSPYSNVFHVVEGFALVILCSSRPATRRLAVSVLREIRALFALL---------------EIPKGDD----ELAIDVMDRLSPSILESFIHLTGADQTTLLYCPSSIDLQTLAEWNSSPI----SHQF-DVISPSHIWIFAHVTQGQDPWIISLSSFLKQENLPKHCSTAVSYAWMFAYTRLQ----LLSPQVDI---------NSPINAKKVNTTTSSDSYIGLWRNYLILCCSAATSSSSTSAGSVRCSPPETLASTPDSGYSIDSKIIG-----------------IPSPSSLFKHIVPMMRSESMEITESLVLGLGRTNPGAFRELIEELHPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHSASGGLDNETHFLNNTLLEYVDLTR-QLLEAEN------EKDSDTLKDIRCHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSLDKKVHQLGCEAVTLLLELNPDQSNLMYWAVDRCYTGSGRVAAGCFKAIANVFQNR-DYQCDTVMLLNLILFKAADSSRSIYEVAMQLLQILEPKMF---------------------RYAHKLEVQRTDGVLSQLSPLPHLYSVSYYQLSEELARAYPELTLAIFSEISQRIQTAHPAGRQVMLHYLLPWMNNIELVDLKPLPTARRHDEDEDDSLK-DRELMVTS------RRWLRGEGWGSPQATAMVLNNLMYMTAKYGDELAWSEVENVWTTLADGWPKNLKIILHFLISICGVNSEPSLLPYVKKVIVYLGRDKTMQLLEELVSELQLTDPVSSGVTHMDNPPYYRI 1467          

HSP 2 Score: 196.823 bits (499), Expect = 2.971e-48
Identity = 182/636 (28.62%), Postives = 296/636 (46.54%), Query Frame = 3
Query: 8892 NSCIIENIETP--NEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKW----AQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLY---------RSTPNLKNSF----SSPKIGYHKDISRQ--RGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL-----------ELPGRILEYQFDV 10694
            NS  I ++ T   NE D+ +        ++  V+ L++ I++ +  P+W +EDV+                         K P+         I S   L T +K + S+     +  I      +++AL T ++C+ RHYA RS QIFRAL      T LS + SRL++T+GD  ED Q +V+EL LTLES I  L  + M    L    S T   D           +ST  L  S     SS  +GY+ +      R + +G        SN        I  ++S  +         KG + D +ST        E T+L+  IFW+A  L+ES+ E+E+   LR L+ L+  L     + R K+E +     W + FPG   L +KG  S S   ++  LLSK++     +LVDP+   GFP  +L L   L+  FD  TQ  +  A  IA +        L NL  +M LYS  T+++D + W   V +YL+D++S+ +  L+ ++  +L +  S M  ++LQ++ + + +I+++ +A   Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P+           +P     +  +P +           ELPG+ L++ FD+
Sbjct: 1725 NSAAISHLHTTILNEVDISV-------EQDGKVKTLMEFITSRKRGPLWNHEDVSA------------------------KNPS---------IKSAEQLTTFLKHVVSVFKQSSSEGIHLEHHLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTATTLSDVLSRLVETVGDPGEDAQGFVIELLLTLESAIDTL-AETMKHYDLLSALSQTSYHDPIMGNKYAANRKSTGQLNLSTSPINSSSYLGYNSNARSNSLRLSLIGDRRGDRRRSNTLDIMDGRINHSSSLARTRSLSSLREKG-MYDVQSTT-------EPTNLMATIFWIAASLLESDYEYEYLLALRLLNKLLIHLPLDKSESREKIENVQSKLKWTN-FPGLQQLFLKGFTSASTQEMTVHLLSKLISVSKHTLVDPSQLSGFPLNILCLLPHLIQHFDSPTQFCKETASRIAKVCAEEKCPTLVNLAHMMSLYSTHTYSRDCSNWINVVCRYLHDSFSDTTFNLVTYLAELLEKGLSSMQQSLLQIIYSLLSHIDLS-AAPAKQFNLEIIKIIGKYVQSPYWKEALNILKLVVSRSASLVVPSD----------IPKTYGGDTGSPEISFTKIFNNVSKELPGKTLDFHFDI 2299          
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Match: sp|Q5TBA9|FRY_HUMAN (Protein furry homolog OS=Homo sapiens OX=9606 GN=FRY PE=1 SV=1)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 606/1884 (32.17%), Postives = 951/1884 (50.48%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD------------------SSPLQLENNMKILYHLINAWKNT-LIASTKENN-QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ V+++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE N    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W +F+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I+ +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  ++          +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                     L ++   K+ Y   N  +N+ LIA+   +  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L I +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L +  N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  I   +TS             T+   D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I  T     +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+    +EN W  L N    ++N+ + + +LI +  ++ ++  L Y K++ ++L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G +  P A         L+ S++  S +I       + Y  S+ G+             DEDK   +          +    + IT+TK        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   61 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDVINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQNPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHIFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITIITTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRVKK---------TYLSKTLTEEEAKMIGMSLYYSQVRKAVDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGKV-YEQANKIRNSELIANGSSHRIQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFIALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPLTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPINAKKTS-------------TAGSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIA-TVCGSRNYPFDIVTLLNLVLFKASDTNREIYEISMQLMQILEAKLFVYSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGDVTASHGLRGNGWGSPEATSLVLNNLMYMTAKYGDEVPGPEMENAWNALANNEKWSNNLRITLQFLISLCGVSSDTVLLPYIKKVAIYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQENFPDAEENKI----LKESDERFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLTITETK-----QPQPLPMPCTGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1660          

HSP 2 Score: 165.236 bits (417), Expect = 1.031e-38
Identity = 158/591 (26.73%), Postives = 276/591 (46.70%), Query Frame = 3
Query: 8973 NKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVI--KWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANS----------LDDNCSDTDEDDLYRSTP--NLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++   +LI+ ++T    P+W +ED+T                         K  NS+  ++L         N +  ++    D+     +  + +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+  +   NS            D  S +      +ST   N+    +S      +    QR  +V   F +++ S+   R SA ++   +  Q           +LKD+ +  S     +  T+L+  IFW+   LMES+ E E+   LR LS L+  +     + R KLEK+     W   F G   LL+KG  S +   ++ QL S +      S+VD +  +GFP  VL L   L+  F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    +   +LQV+ + + Y++++    V Q N  +    + ++ +V W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1789 DEKANKLIEFLTTRAFGPLWCHEDIT------------------------PKNQNSKSAEQLT--------NFLRHVVSVFKDSKSGFHLEHQLSEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLS--DCLKNSDLLTVLSRSSSPDLSSSSKLTASRKSTGQLNMNPGTTSGNTATAERSRHQRSFSVPKKFGVIDRSSDPPR-SATLDRIQACTQQGLSSKTRSSSSLKDSLTDPS---HINHPTNLLATIFWVTVALMESDFEFEYLMALRLLSRLLAHMPLDKAENREKLEKLQAQLKWAD-FSGLQQLLLKGFTSLTTTDLTLQLFSLLTPVSKISMVDASHAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSVQQPLLQVIYSLLSYMDLS-VVPVKQFNVEVLKTIEKYVQSVHWREALNILKLVVSRSASLVLPSYQHSDLSKIEIHRVWTSASK-----ELPGKTLDFHFDI 2334          
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Match: sp|E9Q8I9|FRY_MOUSE (Protein furry homolog OS=Mus musculus OX=10090 GN=Fry PE=1 SV=1)

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 599/1883 (31.81%), Postives = 944/1883 (50.13%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITD-----------------SSPLQLENNMKILYHLINAWKNTLIASTKENN--QKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSP-IPFNKI-----------GLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYR--TDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG--YKSSIVLMFFIDIVPIANTRSFW 8471
            KPGEYV+++L  +F   +  K  + +       + K ++  +D +F  ++ ++++ +E  LPS+L+ L DW+     +G+  +    R                                P  ++   SD    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ ++++AF+HFKY++  +  PN   ++ +ADLYAEV+GVL Q++F  V+ KF +ELK LR+KE +    QSIISL+MGMKFFR+KMYP+EDF     F+ E A+YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  ++ S+KKH +AL PLVTCLL + QKQ FL  W VF+  CLS LKN+DP +ARVALESL+RLLWVY++RIK E +T TQS+L +I  +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEIIFD +   +  K   + PERMNIGL AFL+IA SLQQK+GEPPMP                                  +G  L            P  N+  +        +KT Y   TL +  A  +G+  Y + VRK+   +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MSK EL++LL+RLS+H+D+ELR ++Q +L  ++ +  +WR   +  +  F+ +E+ D                 +    +       Y   N  +N+ +     ++  Q  +    ++L  VEGF LV+LC ++ + R+LSV +LKE+++L + +                 P  ++      +IDV+D  +  ILE  +  +  ++ A L    N+D   L E     W  V       + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  +  ++DP+  +   +TS             T++  D+ + LW+NY+     VA   I  S G +     +P+   +T D +               + ++  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA  G+   S       D L+     +++++L R  L++ ++      D  + IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  ID CY  S       F +I     N  +YP D V+++ L L   S+ + +I E + QL+Q+L  + F+ S  V            ++Q   S +   GT   +        L ++S   +S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW++NIEL+D                    SR     SSP  P +++           GL GNGWGS +AT LVLNNL Y+T ++G E+  + +EN W  L N    ++N+ V + +LI +  ++ ++  L Y K++  +L +    + +E L   LQ  + +N  V+   + PFYR       S+  S        +SNT                 V+ G    P      S +  L+ S+   S +I       + Y  S+ G+             DEDK   +          +    ++IT+ K        PLP+P  GG  APL  +L E   P    G  ++ +I ++F  ++V   + R  W
Sbjct:   61 KPGEYVLKSLFVNFTTQAERKIRIIMAEPLEKPLTKSLQRGEDPQFDQVISSMSSLSEYCLPSILRTLFDWYKRQ--NGIEDESHEYR--------------------------------PRTSNKSKSDEQQRD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPVIDSLIHDIINLAFKHFKYKEGYLG-PNTGNMHIVADLYAEVIGVLAQAKFPAVKKKFMAELKELRHKEQSPYVVQSIISLIMGMKFFRIKMYPVEDFEASLQFMQECAHYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCLRNFVESLYDTTLELSSRKKHSLALYPLVTCLLCVSQKQLFLNRWHVFLNNCLSNLKNKDPKMARVALESLYRLLWVYMIRIKCESNTATQSRLITITTTLFPKGSRGVVPRDMPLNIFVKIIQFIAQERLDFAMKEIIFDFLCVGKPAKAFSLNPERMNIGLRAFLVIADSLQQKDGEPPMP---------------------------------VTGAVL------------PSGNTLRV--------KKT-YLSKTLTEEEAKMIGMSLYYSQVRKAVGNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSKLELIDLLARLSIHMDDELRHIAQNSLQGLLVDFSDWREDVLFGFTNFLLREVNDMHHTLLDSSLKLLLQLLTQWKLVIQTQGRAYEQANKIRNSELIPNGSSHRMQSERGPHCSVLHAVEGFALVLLCSFQVATRKLSVLILKEIRALFLALG---------------QPEDDDRP----MIDVMDQLSSSILESFI-HVAVSDSATLPPTHNVDLQWLVE-----WNAV-------LVNSHYDVKSPSHVWIFAQSVKDPWVLCLFSFLRQENLPKHCPTALSYAWPYAFTRLQSVMPLVDPNSPVNAKKTS-------------TASSGDNYVTLWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMATTPDGT-----------VSYDNKAIGTPSVGVLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADAGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKEVEILKDIRAHFSAMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVMLLLELNPDQINLFNWAIDRCYTGSYQLASGCFKAIATVCGNR-NYPFDIVTLLNLVLFKASDTNREIYEVSMQLMQILEAKLFVHSKKV------------AEQRPGSILY--GTHGPLP------PLYSVSLALLSCELARMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLHNIELVD--------------------SRLLLPGSSPSSPEDEVKDREGEVTASHGLKGNGWGSPEATSLVLNNLMYMTAKYGDEVPGAEMENAWNALANNEKWSNNLRVTLQFLISLCGVSSDTILLPYIKKVATYLCRNNTIQTMEELLFELQQTEPVNPIVQHCDNPPFYRF----TASSKASAAASGTTSSSNT-----------------VVAGQDSFP--DPEESKI--LKESDDRFSNVIRAHTRLESRYSNSSGGS------------YDEDKNDPISP--------YTGWLLSITEAK-----QPQPLPMPCSGGCWAPLVDYLPETITP---RGPLHRCNIAVIFMTEMVVDHSVREDW 1660          

HSP 2 Score: 170.244 bits (430), Expect = 3.369e-40
Identity = 146/506 (28.85%), Postives = 248/506 (49.01%), Query Frame = 3
Query: 9249 AQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNP----QEMFA-------------NSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISR-QRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQ---PSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +++AL T +  + RHYA RS QIFRAL        LS L SRL++ IG+  +++Q YV+E  LTLE+ + NL+      ++F              + L  +   T + ++   TP               + SR QR  +V   F +++ S+   R++ +      T+Q      R  +SLK +L D  S VS        T+L+  IFW+   LMES+ E E+   LR L+ L+  +     + R KLEK+     W   FPG   LL+KG  S +   ++ QL S +       +VD +  +GFP  VL LL  +   F+   Q  +  A+ IA +       +L NL  VM LY   ++ +D   W   V +YL++AY++I+  ++ ++  +L +    M   +LQV+ + + Y++++    V Q N  +    + ++ ++ W+E   IL+L+VS+++SL LP+ +  + S +    +           ELPG+ L++ FD+
Sbjct: 1851 SEVALQTALASSSRHYAGRSFQIFRALKQPLSAHALSDLLSRLVEVIGEHGDEIQGYVMEALLTLEAAVDNLSDCLKNSDLFTVLSRSSSPDLSSSSKLTASRKSTGQLNVNPGTPGSGGGGGGSGNTTTAERSRHQRSFSVPKKFGVVDRSSDPPRSATLDRIQACTQQGLSSKTRSNSSLKESLTD-PSHVS------HPTNLLATIFWVTVALMESDFEFEYLMALRLLNRLLAHMPLEKAENREKLEKLQAQLKWAD-FPGLQQLLLKGFTSLTTTDLTLQLFSLLTSVSKVPMVDSSQAIGFPLNVLCLLPQLIQHFENPNQFCKDIAERIAQVCLEEKNPKLSNLAHVMTLYKTHSYTRDCATWVNVVCRYLHEAYADITLNMVTYLAELLEKGLPSMQQPLLQVIYSLLSYMDLS-VVPVKQFNMEVLKTIEKYVQSIHWREALNILKLVVSRSASLVLPSYQHSDLSKIELHRVWTSASK-----ELPGKTLDFHFDI 2342          
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Match: sp|Q9VT28|FRY_DROME (Protein furry OS=Drosophila melanogaster OX=7227 GN=fry PE=1 SV=2)

HSP 1 Score: 590.497 bits (1521), Expect = 1.189e-167
Identity = 329/749 (43.93%), Postives = 447/749 (59.68%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK 5222
            +PGE V+ NL   F   +  K EL +      ++ K ++  +D +F  LL AL + AE+ LPSLL  LL WH                   + +L D+   +D+     S S++    ++P           T D     ++R+  V++IFC ++I +LKQL  HPGH++++  + ++AF+HFKY+D L  NPN L I+ IADLYAEV+GVL QSRF  VR +F SELK LR KE + +  QSIISLLMGMKFFRVKM PIE+F   F F+ E   YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P +KNFVE LY    D  +K KH +AL PLVTCLL + QK FFL NW  F+  CLS LKNRD  ++RVALESLFRLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI++DL+   RS K+I+ PERM+IGL AFL++A SL          Q+   E   P  V      N    K +                 NK                           ++ L D  A S+G+  Y   VR+ F  +LR LD    R +++T  +N NKE D++++G                      ERKP+I+L +TC++A+PRL+P  M+  ELV++LSRLS+H+DEELR+++ Q+L  ++ + P+WR   +  Y QF+ +++TD+ P  LEN  +IL+  +N W+
Sbjct:  279 RPGEIVMRNLFSDFTAQAEKKIELVMLESADKNLSKLLQRGEDQQFDQLLSALGSVAEHCLPSLLHTLLAWH-------------------RRQLSDMEIKNDLKKPAPSGSSSQAATNKP-----------TVDLDFQLQRREAAVEFIFCLALIEILKQLPYHPGHEDLVRSIENLAFKHFKYKDGLQNNPNALNIHMIADLYAEVIGVLAQSRFASVRKRFMSELKELRGKEVSPTTTQSIISLLMGMKFFRVKMVPIEEFEASFQFMHECGQYFLEVKDKDIKHALAGLFVEILVPVAAAVKNEVNVPCVKNFVELLYVQTLDASTKSKHRLALFPLVTCLLCVSQKTFFLTNWHYFLAMCLSNLKNRDAKMSRVALESLFRLLWVYMIRIKCESNSATHSRLQSIVNSLFPKGSKGVVPRDTPLNIFVKIIQFIAQERLDFAMREIVYDLLCVGRSIKLILNPERMSIGLRAFLVVADSL----------QQKAGEPPMPRTVPVLPSGNTLRVKKT----------------FNKM--------------------------YVLLTDDTARSIGMSTYFPHVRRVFVDILRALDVHYGRPLMMTNTQNQNKEPDEMLSG----------------------ERKPRIDLFRTCVAAVPRLIPDTMTPHELVDMLSRLSVHMDEELRILTHQSLTTLVIDFPDWRQDVVHGYTQFLVRDVTDTYPQLLENCTRILFTFLNIWR 923          

HSP 2 Score: 306.99 bits (785), Expect = 1.550e-81
Identity = 231/774 (29.84%), Postives = 395/774 (51.03%), Query Frame = 3
Query: 6162 CEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS-----EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIP----FNKIGLTG--NGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSP-SNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            CEV D+R++ + A+G  N  +L+DLM+EL + +RE+VD KQEN+RRR+R+D+LRL +V++LE +A NG F  S      D +S   T + ++     YL       NLS       + E + HFC  I+ ++ + P E    L++   K++ F + A W G+F KPL                     + + L ++A+ AM +L+CCG IF+P  LQ+D  I  WL  ++ SK+EK   L  +T+ LLL+ N +    L+ +ID CY ++       FL++   F+   +YPCD Y S+IT+ L  T     ++   A QLLQ+L  RFF           S+   L+SD +      ++   T   ++S        SQ  +S+ L+++ P+LT+SIFSEIT R  +A  +++ +LL CL+PW+ N+EL+                       T    ++P+     F   G  G   G GS +AT+++LNNLFY+T +F     + +E +WG L  +  +N+ VI+ YL++++ + P   L YAK++ ++L +  P +LL+ L + LQTV+ +N  +ERT++ PFYR+ +    S+ ++  +     N    ++I +  +   T      +G   + + + +S +         + +    +   S  N P      +R     +   ++   +   +   +LR++E      + +  T D +P  + HPLP+P YGG+ APL +FL +   P+ +  ++ ++ +M   DIV
Sbjct: 1300 CEVVDVRDAAVNALGLINHDALKDLMEELVVYIREAVDCKQENMRRRRRRDALRLQVVRVLEKIAENGTFGVSTCVLERDTMSLHPTFVLYISGAMGYLTSETDKDNLS-------IREVKAHFCNFIRKMIKNFPLEACATLLSRVLKRNLFNLFAAWCGSFSKPLGYTMQSDHTL-----------EEEKLQFSALQAMSALLCCGQIFNPSYLQDDSIIYKWLDMLLTSKNEKIYQLARDTVVLLLESNPDIGQLLEWVIDRCYTSTPREADACFLALASIFSAK-EYPCDHYTSVITVTLLMTGCPRVEVHATALQLLQILDKRFF----------GSVVGTLHSDSDKE----DDKVGTLDVLLS---SAYCRSQRFLSKQLAQLRPELTMSIFSEITHRFQSAREDVRALLLQCLLPWLQNMELV----------------------ATSVPPATPLSYIMYFPDSGTRGRREGTGSTEATEMILNNLFYITAKFSDAHPRDIEELWGTLCQFWPNNLKVILRYLVIMSGMAPTELLPYAKRVALYLVRSCPDRLLDELMAELQTVETLNCLIERTETPPFYRLTSMRKASSHSADGQAAGGIN---DSRIQDLAVEKGTIHTKRHSGEDPMKIGTCKSDSGIRAYTQAAAAAAAAAVTPGSSGNRPPRGADKIR---AASGPSILPRPEDILINDPELRQEEN-----VELRGTSDAAPNGHPHPLPMPEYGGYFAPLTEFLPDVSLPI-SGFHRCNVAVMLLTDIV 2003          

HSP 3 Score: 222.631 bits (566), Expect = 5.026e-56
Identity = 165/603 (27.36%), Postives = 285/603 (47.26%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN---------------SFSSPKIGYHKDISRQRGTTVG---GGFRILNSSNHHQ-----RASAV-IESTTSTK---QPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLS-LPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            ++ L+K ++    +P+W YED+T   +       ++           + +P +R                              +  +WAQ AL  G++C+ RHYA R LQIFRAL    +   LS + SRL++T+ +  ED+Q YV EL LTLE+ +          +SLD +    D   D+++STPNL N               S  +P+   +   S  R T+      G +  NS    Q     R+S + +E +   K          A  +     +   +    + D++  ++ ++FWL+  L+ES+ EHEF   LR L+ +++ L     D R K+EK+ Q   W + +PG   LL+KGC   + +  +  LLS+    +   + DPT    FP  V+ LL  +   +++  +    +A+NIA ++  L   +L NL  VM LYS  TF K+  QWT+CVVKYL+D Y+ +   ++AF+  +L + P  +   +L V+   ++Y++++          ++ ++ + +++   WK+   IL+L+V+++SSL  +P S    + +  S            + EL GR +E+ FDV
Sbjct: 2191 IKSLLKFLAQDTCQPLWNYEDITAKVWAVKSAEQLSCFLKHMVKVFADSYPQAR------------------------------IAERWAQTALQLGLSCSSRHYAGRCLQIFRALNVPINSRMLSDILSRLVETVAEQGEDMQGYVTELLLTLEAAV----------DSLDSDFRPLDVMKDIFKSTPNLNNKDGGPNSILPGKKSPSGMTPQSSNYSIPSHGRSTSYSVSYCGRKANNSPCDKQVELRNRSSGIDLERSVVCKFGVGGGGAGSALSRSRSAQSLKMLGDTATQDDKMTILAQLFWLSVSLLESDYEHEFMLALRLLTRVLHRLPLDRPDARDKVEKLQQQLKWTA-YPGVHALLLKGCTHSATYEPTITLLSQFAPLLTLPVCDPTQSCAFPMNVIALLPYMLLHYEDANEICIRSAENIAQVSTELGA-KLENLGTVMTLYSRKTFCKESFQWTKCVVKYLHDTYAHMGLHMVAFLIEVLEKGPQQVQVPVLNVIHCMLHYVDLSAPQAQSINADLLRAIGK-YLDTAYWKDSLKILKLIVTRSSSLQVVPPSDGSSAGLSFSFYGAYPDSDMFCKKELAGRTMEFTFDV 2750          

HSP 4 Score: 124.02 bits (310), Expect = 3.483e-26
Identity = 78/264 (29.55%), Postives = 139/264 (52.65%), Query Frame = 3
Query: 5220 KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVV-----SNTYSNNINDNHGSLN------SESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAP 5972
            ++T++    +  +K++    T L  VEGF LV+LC YR+ +R+L+  +LKEVK+L+            ++ + +  P          +IDV+D     I+E+CLP LP  EK  +     ID   +AER++ +W  G+      S+T + N++ +  + N      S   L  + W+ C+  +  R  +++ C +AV  AW     R+N L+++IDP+  +++NR +SLLR  +  KK  T +++D  + LW+N +  A  + P
Sbjct: 1008 QHTVLNMASDVGKKNEIPLATTLHFVEGFALVLLCNYRTYLRKLAALILKEVKNLM-----------RALGIPETEPP---------LIDVMDRCVPGIIEKCLPQLPQTEKTAILNANCIDLQWIAERSSGVWLAGLTDDNSKSSTSTLNLSQSSSTPNASATAASSPQLPFDPWATCLFGLLERQNVLQQCPSAVAQAWPICFTRLNALYSVIDPT-PVSDNR-ASLLRSSAPTKKVPTESQKDSYLRLWRNQVACAMRLVP 1249          
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Match: sp|Q9HDV6|MOR2_SCHPO (Cell polarity protein mor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mor2 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 3.532e-19
Identity = 81/338 (23.96%), Postives = 163/338 (48.22%), Query Frame = 3
Query: 3393 ISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSI-ISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKF-VVPRDA--SINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNI 4394
            ++E+R     YI C+ +  + + +  +   +  ++ +L   F       +L  + ++  +    + +A +VG +++  F +V  +F  E++ L     +S   +++ + LL  M++ R+++YP     +   FL  L ++F++ +   +K   A L  ++L P+ +    EVNIP     +E +Y     MC+K K++    P    LL +  KQFFL +W   + A   ++K+R   +    L  L R++W Y  + K E+ +   S + +I+ S F  G KF VVP      ++ + +I+  +     +  +KEI+  L   +   + I PE++ I
Sbjct:  126 VNERRSSISIYILCRVLTEIAETIPSNALEESTVSCLLECVFHQLLSAKNLPVSSSYFSLAN-WESFAFLVGSMSRFNFVMVSDRFIEEIEHLEKSGCDSRQKETVLVHLLRAMRYLRLQLYPTTLLEESIAFLQSLTSFFMKAN-TALKIEYAYLMEQLLRPLISRATFEVNIPAWSRTIETIYPVVLKMCTKTKYWNVFFPFCCTLLCLSPKQFFLKHWISSLDAAFFRVKDR--RLRNTGLPHLSRVVWTYSNQYK-EEPSIMNSNISNILKSGFSIGKKFSVVPFATLEELDGYAQIVRVVGAHFPELVIKEILTPL-STDAFTENIGPEKLMI 457          
BLAST of Protein furry-like protein vs. TrEMBL
Match: A0A1D8KD34 (Furry OS=Lymnaea stagnalis OX=6523 GN=fry PE=2 SV=1)

HSP 1 Score: 1069.69 bits (2765), Expect = 0.000e+0
Identity = 684/1854 (36.89%), Postives = 1009/1854 (54.42%), Query Frame = 3
Query: 2964 IKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNT-LIASTKENNQKSKA---LDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW---GVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYN--------GIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYR---IXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG---------YKSSIVLMFFIDIV 8444
            I    K GE++++NL   F +++  + E  +       + K ++  +D +F  +L AL   AE+ LPS+LK L  W+                                                P+  S Q   S    + ++ E+RD+ +++++C  +I VL +LS HPGH++ +  ++   F+HFKYRD L +NPN   IN IADLYAEV+GVL  SRF  VR KF +ELK L+ ++      QSIISLLMG+KFFRVKM+PIE+F  C   L EL +YF+EV D+ IKHALAGLFVE+LLPVAA VKNEVNIPVLK   E LY+   DM +K+KH + L PLVTCLL + QKQFFL NW  F+  CLSQLKNRD  ++RVALESL+RLLWVY+VRIK E +T TQS+L SIVNSLFPKGSK V P+D  +NIFVKII FIA+E+LDFA+K+IIFDL+   R++K + PERM+IGL AFL+IA SLQQK+G+PPMPQ   S S+ PS                       S  R+ +  +NK                              L+D  A S+G+  Y   + K+FD++LR LD QV R++L+TK EN NKE ++++TG                      +RKPK++L +TCI+AIPRL+P  M+  ELVEL++RL++H+DEEL+ ++ QAL N++ E P WR   I  ++QF++K+I+D+ P  L++ +++L  L+  W++T ++A   +   K  A    +  +L +VEG CLVM+C  R   RRL++H+LKEV++ I ++  D ++N SS+                  ++VID +   +LE+ +P LP +EK  L  +  ID   + +R   +W   G  S    N IN         S    ++W  C+A   +R     SC +AV +AW  +  R+N LF ++DPS Q    R SS+LR   S+KK   ++E+D  M LW+NY+  AC +A       Q      L       ST D S                 +V   T+  L + L+ L++C+ SDLR++++  +G+ NP+  ++L +EL   L+E++DKKQ+N+RRR+++D LR+ +  I EL+A N        GI D     L+ +   +D+++  R YL +G++      D  L IL E RLHF   IQ+L+ + P + R+NL++ + + S F + A+W+G+F                  K  + ++  ++   +A+ AM +++CCG +FDP  L +DGYI  WL  +++S+DEK   L +ET+ LLLD+NSET   LD +ID CY   N      F ++   F    +YPCD+V+M+ LA+    +      E A QLL LL  RFF DS  V+ E         S+++  +  A N T   +S  +        SQ  IS  L+ +  DLT+ +FSEITQR  TA P+++  LL  L+PW++N+EL+D          S  +   +R+S  +     P       L G GWGS QAT++VLNNLFY+TV FG E    +E +W  LV+    N+ VII YLI+IT++     L YAK+++ +L + KP+KL++ L + LQTV+ +N ++ERTQ  P+YR   I    + +N     K  + P       I+ T  + +  +    +  +    AS+RS   +    +  +  + + I +  V   P S  G                         +LR+ E               SP+  +PLP+PAYGG+ APLN+ L E+  P  T G         Y+S+I +MF  D+V
Sbjct:   46 INRDAKSGEFILQNLFLEFCRVTERRIEFVLAEPLEKPLSKSLQRGEDPQFDQVLSALGNVAEHCLPSILKTLFAWYQRQMKE----------------------------------------DSPLLDSRQRHRSKGNKD-YLCERRDLALEFVYCLVLIEVLSKLSYHPGHEDFVGYLIDQCFRHFKYRDGLQSNPNASNINIIADLYAEVIGVLANSRFLAVRKKFMNELKELKLRDPTPYTAQSIISLLMGLKFFRVKMHPIEEFELCVQLLLELGHYFLEVKDRDIKHALAGLFVEILLPVAATVKNEVNIPVLKKLAEDLYSVTVDMATKRKHTLHLFPLVTCLLCVSQKQFFLNNWHYFLSMCLSQLKNRDVKMSRVALESLYRLLWVYMVRIKCESNTATQSRLQSIVNSLFPKGSKLVTPKDMPLNIFVKIIQFIAKERLDFAVKDIIFDLLCVGRNNKFLTPERMSIGLRAFLVIADSLQQKDGDPPMPQ---STSSLPS----------------------GSTVRVKKTFLNKM-----------------------------LSDTTAKSIGLAPYYPYILKTFDSILRALDLQVGRSLLMTKSENANKEPEEMITG----------------------DRKPKLDLFRTCIAAIPRLIPDGMTPPELVELITRLTVHVDEELKGLAFQALQNLMSESPVWREHVIHGFVQFIQKDISDTKPGLLDSTLRLLSQLMVQWRSTMMMAGANQQAVKDPAHAHPNVDVLHEVEGLCLVMMCSCRVVTRRLALHLLKEVRN-IFNMYPDDQINVSSL------------------LEVIDKSCPAVLEKLMPLLPPSEKPILLTLPTIDLAWVVDRAVTLWLPAGGGSMQDGNQIN--------YSFHRVDMWIRCVAEFASREHAQHSCPHAVGHAWPIVFTRLNALFPLVDPSAQAEPTRASSILR---SSKK--GTSEKDVHMQLWQNYVILACTIAMHSAGLPQRCSSPELGVASSPESTSDKSP----------------TVQACTATGLFQRLVPLMRCDSSDLRDTIVNGLGYCNPAVFKELAEELLPFLKEAIDKKQDNLRRRRKRDILRVQLAHIFELMAENKAFAQNESGIIDTDTGSLTSMF--VDYIDGARQYL-EGEN------DRDLPILQEIRLHFSGFIQHLICNTPMDYRKNLLSRDLRYSLFHLFANWSGHF----------NPTFGPGDKRHNKEESWNEQEISAVRAMSAVLCCGKVFDPSGLNDDGYIYHWLDTLLSSQDEKIYELAKETVFLLLDFNSETQGLLDWVIDRCYTGHNEVADGCFNALAAVFQTR-EYPCDHVAMLNLAVLNVGSPRMSTHETAIQLLHLLDLRFFQDSP-VFRE--------ASEESSPTVAALNDTLLAVSYCN--------SQIFISDQLARIHTDLTMPMFSEITQRFHTARPSVRQTLLKYLLPWLHNMELVD----PSLPQTSPLASFLTRLSDAQSDVFMP------PLKGEGWGSTQATEMVLNNLFYITVTFGDEHPLEIEALWAALVSCWPFNLKVIIRYLIIITNIAATDLLPYAKRVVTYLGRAKPEKLVDELMNELQTVETLNVNIERTQPPPYYRLSSIKKVVSGANAADDGKQFSPPPDYQEKGILHTKRHSANEEVQHESTPRTNSTASLRSINSNS---TGSTAEQPVFISDDDVIGAPPSRAGV------------------------ELRRSE---------------SPAP-YPLPMPAYGGYYAPLNECLPENFTP--TPGFHSSTDNLLYRSNIAVMFLCDLV 1642          

HSP 2 Score: 225.713 bits (574), Expect = 1.639e-54
Identity = 174/598 (29.10%), Postives = 290/598 (48.49%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSF--------SSPK---------IGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPT----SKVIEXXXXXXXXXXXXXEAETP---RLELPGRILEYQFDV 10694
            +R ++  + + + RP+W  ED+T             ++ +++++T    F          L  +V     +  L  +L++       +W+Q+AL   ++C+ RHYA RS QI RAL        LS + SRL++T+ +  ED+Q YV E+ LTLE+ I NL+ +    + +          +L+ STPNL   F        ++PK           Y      QR    GG  RI + +    R S +  S         R   SLK NL D   T       +++  LV ++FW+   L+ES+ E+EF   +R L  ++  L     + R KL+K++    W + FPG   LL+KGC S      +  LLSK+++ VN  ++D +  +GFP   + L   LV  ++  +Q  R AA  +A +      DRL NL  VM LYS GTF KD  QWT+CVVKYL D YS  +  ++ F+  +L +      ++ LQ+L   ++Y+++  +   +   ++ +++++    N  W+E   IL+L V+++S+L+ P     + +  S + +        EAE+      ELPGR L++  D+
Sbjct: 1771 IRAMLNFMESRKGRPLWSSEDIT------------PKMLSTQSATHLGYF----------LKYTVKCFKELSPL--ALVEQ------RWSQVALQLALSCSSRHYAGRSFQILRALLIRPSTQMLSDILSRLVETVAEQGEDMQGYVTEMMLTLEASIDNLDLEFRPIDFM---------RELFMSTPNLAKDFGDTRRSAITAPKHTQAHHARSTSYTVSAYTQRAYAGGGDGRIRSCTEVESRKSNLARS---------RSAQSLK-NL-DQSGT-------EDKLTLVTQMFWITVSLLESDYEYEFTLAVRLLDKILCHLQPERPECRDKLDKVLNQIKWPN-FPGVYILLMKGCTSHMAAEATWALLSKIILCVNSPIIDTSGHLGFPLVTIALLPYLVHNYENPSQICRDAADRVAQMCSHQG-DRLTNLATVMSLYSRGTFGKDSFQWTKCVVKYLLDVYSSSAISMVTFLVEVLEKGQQIYQTSCLQILYCMVHYLDIATAPSSFLNQELFQAINKHVQTN-NWREALKILKLAVTRSSTLATPPPSSQTSIPSSDLTVFATHTSFAEAESLTKFSKELPGRTLDFTIDL 2308          
BLAST of Protein furry-like protein vs. TrEMBL
Match: A0A1D8KD36 (Furry OS=Lymnaea stagnalis OX=6523 GN=fry PE=2 SV=1)

HSP 1 Score: 1069.69 bits (2765), Expect = 0.000e+0
Identity = 684/1854 (36.89%), Postives = 1009/1854 (54.42%), Query Frame = 3
Query: 2964 IKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNT-LIASTKENNQKSKA---LDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW---GVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYN--------GIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYR---IXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHG---------YKSSIVLMFFIDIV 8444
            I    K GE++++NL   F +++  + E  +       + K ++  +D +F  +L AL   AE+ LPS+LK L  W+                                                P+  S Q   S    + ++ E+RD+ +++++C  +I VL +LS HPGH++ +  ++   F+HFKYRD L +NPN   IN IADLYAEV+GVL  SRF  VR KF +ELK L+ ++      QSIISLLMG+KFFRVKM+PIE+F  C   L EL +YF+EV D+ IKHALAGLFVE+LLPVAA VKNEVNIPVLK   E LY+   DM +K+KH + L PLVTCLL + QKQFFL NW  F+  CLSQLKNRD  ++RVALESL+RLLWVY+VRIK E +T TQS+L SIVNSLFPKGSK V P+D  +NIFVKII FIA+E+LDFA+K+IIFDL+   R++K + PERM+IGL AFL+IA SLQQK+G+PPMPQ   S S+ PS                       S  R+ +  +NK                              L+D  A S+G+  Y   + K+FD++LR LD QV R++L+TK EN NKE ++++TG                      +RKPK++L +TCI+AIPRL+P  M+  ELVEL++RL++H+DEEL+ ++ QAL N++ E P WR   I  ++QF++K+I+D+ P  L++ +++L  L+  W++T ++A   +   K  A    +  +L +VEG CLVM+C  R   RRL++H+LKEV++ I ++  D ++N SS+                  ++VID +   +LE+ +P LP +EK  L  +  ID   + +R   +W   G  S    N IN         S    ++W  C+A   +R     SC +AV +AW  +  R+N LF ++DPS Q    R SS+LR   S+KK   ++E+D  M LW+NY+  AC +A       Q      L       ST D S                 +V   T+  L + L+ L++C+ SDLR++++  +G+ NP+  ++L +EL   L+E++DKKQ+N+RRR+++D LR+ +  I EL+A N        GI D     L+ +   +D+++  R YL +G++      D  L IL E RLHF   IQ+L+ + P + R+NL++ + + S F + A+W+G+F                  K  + ++  ++   +A+ AM +++CCG +FDP  L +DGYI  WL  +++S+DEK   L +ET+ LLLD+NSET   LD +ID CY   N      F ++   F    +YPCD+V+M+ LA+    +      E A QLL LL  RFF DS  V+ E         S+++  +  A N T   +S  +        SQ  IS  L+ +  DLT+ +FSEITQR  TA P+++  LL  L+PW++N+EL+D          S  +   +R+S  +     P       L G GWGS QAT++VLNNLFY+TV FG E    +E +W  LV+    N+ VII YLI+IT++     L YAK+++ +L + KP+KL++ L + LQTV+ +N ++ERTQ  P+YR   I    + +N     K  + P       I+ T  + +  +    +  +    AS+RS   +    +  +  + + I +  V   P S  G                         +LR+ E               SP+  +PLP+PAYGG+ APLN+ L E+  P  T G         Y+S+I +MF  D+V
Sbjct:   46 INRDAKSGEFILQNLFLEFCRVTERRIEFVLAEPLEKPLSKSLQRGEDPQFDQVLSALGNVAEHCLPSILKTLFAWYQRQMKE----------------------------------------DSPLLDSRQRHRSKGNKD-YLCERRDLALEFVYCLVLIEVLSKLSYHPGHEDFVGYLIDQCFRHFKYRDGLQSNPNASNINIIADLYAEVIGVLANSRFLAVRKKFMNELKELKLRDPTPYTAQSIISLLMGLKFFRVKMHPIEEFELCVQLLLELGHYFLEVKDRDIKHALAGLFVEILLPVAATVKNEVNIPVLKKLAEDLYSVTVDMATKRKHTLHLFPLVTCLLCVSQKQFFLNNWHYFLSMCLSQLKNRDVKMSRVALESLYRLLWVYMVRIKCESNTATQSRLQSIVNSLFPKGSKLVTPKDMPLNIFVKIIQFIAKERLDFAVKDIIFDLLCVGRNNKFLTPERMSIGLRAFLVIADSLQQKDGDPPMPQ---STSSLPS----------------------GSTVRVKKTFLNKM-----------------------------LSDTTAKSIGLAPYYPYILKTFDSILRALDLQVGRSLLMTKSENANKEPEEMITG----------------------DRKPKLDLFRTCIAAIPRLIPDGMTPPELVELITRLTVHVDEELKGLAFQALQNLMSESPVWREHVIHGFVQFIQKDISDTKPGLLDSTLRLLSQLMVQWRSTMMMAGANQQAVKDPAHAHPNVDVLHEVEGLCLVMMCSCRVVTRRLALHLLKEVRN-IFNMYPDDQINVSSL------------------LEVIDKSCPAVLEKLMPLLPPSEKPILLTLPTIDLAWVVDRAVTLWLPAGGGSMQDGNQIN--------YSFHRVDMWIRCVAEFASREHAQHSCPHAVGHAWPIVFTRLNALFPLVDPSAQAEPTRASSILR---SSKK--GTSEKDVHMQLWQNYVILACTIAMHSAGLPQRCSSPELGVASSPESTSDKSP----------------TVQACTATGLFQRLVPLMRCDSSDLRDTIVNGLGYCNPAVFKELAEELLPFLKEAIDKKQDNLRRRRKRDILRVQLAHIFELMAENKAFAQNESGIIDTDTGSLTSMF--VDYIDGARQYL-EGEN------DRDLPILQEIRLHFSGFIQHLICNTPMDYRKNLLSRDLRYSLFHLFANWSGHF----------NPTFGPGDKRHNKEESWNEQEISAVRAMSAVLCCGKVFDPSGLNDDGYIYHWLDTLLSSQDEKIYELAKETVFLLLDFNSETQGLLDWVIDRCYTGHNEVADGCFNALAAVFQTR-EYPCDHVAMLNLAVLNVGSPRMSTHETAIQLLHLLDLRFFQDSP-VFRE--------ASEESSPTVAALNDTLLAVSYCN--------SQIFISDQLARIHTDLTMPMFSEITQRFHTARPSVRQTLLKYLLPWLHNMELVD----PSLPQTSPLASFLTRLSDAQSDVFMP------PLKGEGWGSTQATEMVLNNLFYITVTFGDEHPLEIEALWAALVSCWPFNLKVIIRYLIIITNIAATDLLPYAKRVVTYLGRAKPEKLVDELMNELQTVETLNVNIERTQPPPYYRLSSIKKVVSGANAADDGKQFSPPPDYQEKGILHTKRHSANEEVQHESTPRTNSTASLRSINSNS---TGSTAEQPVFISDDDVIGAPPSRAGV------------------------ELRRSE---------------SPAP-YPLPMPAYGGYYAPLNECLPENFTP--TPGFHSSTDNLLYRSNIAVMFLCDLV 1642          

HSP 2 Score: 225.713 bits (574), Expect = 1.625e-54
Identity = 174/598 (29.10%), Postives = 290/598 (48.49%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSF--------SSPK---------IGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPT----SKVIEXXXXXXXXXXXXXEAETP---RLELPGRILEYQFDV 10694
            +R ++  + + + RP+W  ED+T             ++ +++++T    F          L  +V     +  L  +L++       +W+Q+AL   ++C+ RHYA RS QI RAL        LS + SRL++T+ +  ED+Q YV E+ LTLE+ I NL+ +    + +          +L+ STPNL   F        ++PK           Y      QR    GG  RI + +    R S +  S         R   SLK NL D   T       +++  LV ++FW+   L+ES+ E+EF   +R L  ++  L     + R KL+K++    W + FPG   LL+KGC S      +  LLSK+++ VN  ++D +  +GFP   + L   LV  ++  +Q  R AA  +A +      DRL NL  VM LYS GTF KD  QWT+CVVKYL D YS  +  ++ F+  +L +      ++ LQ+L   ++Y+++  +   +   ++ +++++    N  W+E   IL+L V+++S+L+ P     + +  S + +        EAE+      ELPGR L++  D+
Sbjct: 1771 IRAMLNFMESRKGRPLWSSEDIT------------PKMLSTQSATHLGYF----------LKYTVKCFKELSPL--ALVEQ------RWSQVALQLALSCSSRHYAGRSFQILRALLIRPSTQMLSDILSRLVETVAEQGEDMQGYVTEMMLTLEASIDNLDLEFRPIDFM---------RELFMSTPNLAKDFGDTRRSAITAPKHTQAHHARSTSYTVSAYTQRAYAGGGDGRIRSCTEVESRKSNLARS---------RSAQSLK-NL-DQSGT-------EDKLTLVTQMFWITVSLLESDYEYEFTLAVRLLDKILCHLQPERPECRDKLDKVLNQIKWPN-FPGVYILLMKGCTSHMAAEATWALLSKIILCVNSPIIDTSGHLGFPLVTIALLPYLVHNYENPSQICRDAADRVAQMCSHQG-DRLTNLATVMSLYSRGTFGKDSFQWTKCVVKYLLDVYSSSAISMVTFLVEVLEKGQQIYQTSCLQILYCMVHYLDIATAPSSFLNQELFQAINKHVQTN-NWREALKILKLAVTRSSTLATPPPSSQTSIPSSDLTVFATHTSFAEAESLTKFSKELPGRTLDFTIDL 2308          
BLAST of Protein furry-like protein vs. TrEMBL
Match: A0A210PPR8 (Protein furry-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12158 PE=4 SV=1)

HSP 1 Score: 1050.04 bits (2714), Expect = 0.000e+0
Identity = 650/1842 (35.29%), Postives = 989/1842 (53.69%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLA-CLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKS----------KALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDS--SQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQL-----SQLI-TVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGY-KSSIVLMFFIDIV 8444
            KPGEY+++ L   F  ++  K E  +       + K ++  +D +F  LL +    AE  LPS+L++L  W                   ++  L D C+  D      S  +  +                      + E+RD+ V++++C  +I VL +L  HPGH++++  +++ AF+HFKY+D +  NPN   I+ + DLY+EV+GVL QSRF  V+  F SEL+ L+ ++      QSIISLL  +K+F+VKM+PIEDF  C  FL +L +YF+EV D+ IKHA+A LFV++LLPVAA  KNEVN+PVLKN V+ LY    D+  KKKH     PLVTCLL + QK FFL NWP F+   CLSQLKN+D  ++R+AL+SL RLLWVY+VRIK E +T T S+L SIV+SLFP+GSK V PRD  +N FVKII FIA+EK DFAMKEIIFDL+   RS K++ PERM+IGL AFL+IA SLQQK+G+PPMPQ                    QAT  S       +  R+ R  +NK                              L D  A ++G+  Y   + K+FD+ML  LD QV R  LLTK EN+NKE DD+M G                      ERK KIEL +TCI+AIPRL+P  MS  ELVELL+RL++H+DEEL+  + QAL N++QE P+WR   ++ ++QFV+++I+D++   L+  +++L  L+  WK  ++ + +                +A +  +L +VEG  LVMLC  R   R+L+  +LKEV+++            +        P          ++++ID A   +++R LP LP +EK  L    NID   + +R   +W  V  T  NNI +   S+ S+     + W  CIA   +  + M  C +AV  +W  +  R+  +  ++DP+  I E RTSS+LR G+S+KKP T  E+D  M LW+NY+  AC VA       + ++  Y  +  + GS+ +S  S  +  S++ +        +MK               CE  D+R++++  +G+ N ++ RDL+DEL   L+E++++KQE   RR++KD+LR+ +  I EL+A N  F  SE  +     S LI T +++++  R YL          +D  L +L++ RLHF R ++ L+ H P E +++L+T + + S F + A W+G F           +I  T  +  + D+   +L  +A+ AM +++CCGP+FDP  L +DGYI  WL  +++S +++   L +ET+ LLLD+N +T   LD +ID CY  +N      F ++   F    +YPCD+V+M+ LA+    +  TQ  E A  LL LL  RFF ++  V+++        ++D      +  N     +S           SQ  +S  L+ + PDLT+ +FSEI QR  TA P ++L+LL  L+PW++N+ELID         +S  +   +R+  T+     P       L G GWGS +AT +VLNNLF+LTV+FG +  K +E++W  LV    +N+ V+IHYL++IT++  +  L YAK+++ +L + KP++L++ L + LQTV+ +N S+ERTQ+ PF+R+     +    S   +N   +   +T   +  +   T      + +  LP  S R+   D       S S   + D+                        ++DED +     +    +   +  P              +PLP+PAYGG+ APL ++L E+  P  T G+ +S+I +MF  D+V
Sbjct:   48 KPGEYILQTLFLEFCNMAEKKVEQVLAEPLEKPLSKSLQRGEDAQFDQLLNSFGCLAEQCLPSILRSLFRWF------------------ERQNLMDECSQPDTRQRHRSKGSKDF----------------------LCERRDLAVEFVYCLVLIEVLAKLGFHPGHNDLVTYIITQAFRHFKYKDGIQTNPNSGNISILTDLYSEVIGVLVQSRFTAVKKHFMSELRELKIRDQTPYTAQSIISLLTSLKYFKVKMHPIEDFEACVMFLQDLGHYFLEVKDRDIKHAVATLFVDILLPVAATAKNEVNVPVLKNLVDMLYTPALDLTMKKKHMFHCFPLVTCLLCVSQKTFFLNNWPYFLTTHCLSQLKNKDQKLSRMALDSLHRLLWVYMVRIKCESNTITHSRLQSIVSSLFPRGSKVVTPRDVPLNFFVKIIQFIAKEKQDFAMKEIIFDLLCVGRSAKILTPERMSIGLRAFLVIADSLQQKDGDPPMPQ-------------------TQATLPS------GATVRVKRTFLNK-----------------------------KLTDQMAKTIGLAQYYPHMLKAFDSMLHALDLQVGRQHLLTKSENVNKEPDDLMIG----------------------ERKAKIELFRTCIAAIPRLIPDGMSCQELVELLTRLTVHLDEELKGHAFQALQNLMQESPQWREHVVKGFVQFVQRDISDTNTQLLDGALRLLMQLLVQWKTNIVTAQQRERSTGDSAAPMQTLPEATNILVLREVEGLSLVMLCSCRVVTRKLAALLLKEVRNIF-----------TCCQAQMPEP---------CLLEMIDKACPDVVKRLLPSLPASEKPVLLTSPNIDLAWVIDRAASVWNPV--TKENNIEERSESVFSK----VDPWMRCIAMFVSSEYGMIICPHAVAASWPIVYTRLVSMHTLLDPNNMINEFRTSSILRSGTSSKKPTT--EKDVHMQLWQNYVILACSVA------QKDSLNSYRCASPEQGSSPESEKSDSRQASTSCTDLFKLIVPLMK---------------CENPDMRDTIVNGLGYTNAAAFRDLIDELLPFLKEAIERKQETKNRRRKKDTLRVQLAHIFELMAENRTFAQSESGVIDTGSSCLIKTFVEYIDGARQYL-------ESESDRDLPVLHDIRLHFSRFVRELIAHTPAEFKRSLLTRDLRYSLFHLFASWSGKF---------SHTIGDTLDRRFNKDESCSELELSAVRAMSAVLCCGPVFDPSGLNDDGYIYQWLDMLLSSHNDRIYELAKETVVLLLDFNPDTQGLLDWVIDRCYTGANEVADGCFNALAAVFQTR-EYPCDHVAMLNLAVLNVGSPRTQTHETAVHLLHLLDTRFFQETP-VFTD--------SADDQRQQSLPLNDILMSVSYCH--------SQMYLSEQLARVQPDLTMPMFSEIAQRFQTAKPAVRLMLLKYLLPWLHNMELID----PSLPQSSPLNNFLTRLHDTQTDIFKP------PLKGEGWGSPEATKMVLNNLFHLTVKFGDDHPKEVEDLWSSLVICWPNNLKVVIHYLVIITNMAASELLQYAKRVVSYLGRAKPERLVDELMNELQTVETLNMSIERTQTPPFFRL-----SQIKKSLLHINTTDDEKVATHFSDHPLEKGTLHTKRHSANDDLPSESPRT---DSTPSLRSSSSTSSNPDQ-----------------------FLMDEDLHMPTSGRGCETRRSESPMP--------------YPLPMPAYGGYFAPLTEYLPENLHP--TAGFHRSNIAVMFLSDLV 1633          

HSP 2 Score: 243.047 bits (619), Expect = 9.746e-60
Identity = 177/585 (30.26%), Postives = 280/585 (47.86%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLN----PQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPK-------IGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTV---LTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAET-PRLELPGRILEYQFD 10691
            V+ ++  +   R RP+W  ED+T          T+N  S  R               E  L   V     +  L  +L++       +W+Q+AL   ++C+ RHYA RS Q+ RAL        LS + SRL++T+ +  ED+Q YV E+ LTLE+ + NL+    P +                +L+ STPNL     S            H      R T+   G     + +   R+   +E+      P  R   SLK NL  N +        +++  ++ ++FW+A  L+ES+ E+EF   +R LS ++  +     + R +LEKI Q   W + FPG   LL+KG  S +   ++  LLS++ V +   +VDPT  +GFP  V   L LLV  ++  +Q+ R AA +IA +    S DRL NL  +M LYS GTF KD  QWT+CV+KYL D Y   S  L++F+  +L + P     ++ Q+L   ++Y+++N +       ++  ++S+  +    W+E   IL+L V ++S+L+        S V   +      EAE   R ELPGR L++  D
Sbjct: 1763 VKAILDFMDAKRGRPLWSCEDITPR--------TLNTQSAVRL--------------EYFLKCVVKCFKEMQPL--ALVEQ------RWSQVALQLALSCSSRHYAGRSFQVLRALHIRPSTQMLSDILSRLVETVAEQGEDMQGYVTEIILTLEAAVDNLDLEFRPMDFMR-------------ELFISTPNLAKDGGSEGRKSCALMAPRHPSPHHARSTSYSQGPVHRTAPHLRLRSGTEVENRMRANMPRSRSAHSLK-NLDHNGA--------EDKLTIMSQMFWIAVSLLESDFEYEFSLCVRLLSKILTNIQPERPECRERLEKIQQQIKWTN-FPGIQTLLLKGFTSGALSELTWSLLSRLTVCIAAPVVDPTENLGFPINVVALLPLLVQNYENPSQSCRDAADHIAQVCSQRS-DRLNNLGTIMSLYSRGTFGKDSFQWTKCVIKYLLDVYLPASYSLISFLVEVLEKGPGTNQLSVFQILHCMVHYMDINTTPASSLNPELFHTISR-HVQGFHWREALKILKLAVGRSSTLTAAPPSAHTSEVGTFMSHTSFAEAEVITRKELPGRTLDFAVD 2292          
BLAST of Protein furry-like protein vs. TrEMBL
Match: A0A2T7PMZ1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_06066 PE=4 SV=1)

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 670/1853 (36.16%), Postives = 996/1853 (53.75%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK---NTLIASTKENNQKSKALDKT----------------LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW---GVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSE--------DQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIV 8444
            KPGEY+++ L   F +I   K E  +       + K ++  +D +F  +L +L   AE+ LPS+L+ L  WH+    +G                                     +   P+  S Q   S  + ++ + E+RD+ V+++ C  ++ VL +LS HPGHD+++  ++  AF+HFKYRD L  NPN   IN IADLYAEV+GVL  SRF+ VR KF  EL+ L+ ++      QSIISLLMG+KFFRVKM+PIEDF  C +FL E+ +YF+EV D+ IKHALAGLFVE+LLPVAA VKNEVNIPVLK  V+ LY+   DM +K+KH + L PLVTCLL + QKQFFL NWP F+  CLSQLKN+DP ++R+ALESL+RLLWVY+VRIK E +T TQS+L SIVNSLFPKGSK V P+D  +NIFVKII FIA+  L  A+++IIFDL+   RS+K+ + PERM+IGL AFL+IA SL+QK+G+PPMPQ                  +N A  S        S  R  R  +NK                              L+D+ A ++G+  Y + + K+FD++LR LD QV R +L+TK EN NKE D+++TG                      +RKPKI+L +TCI+AIPRL P  M+  ELV+LL+RL++H+DEEL+ ++ QAL N++ E   W+   I  ++QF+ K+I+DS    L+  +++L  L+  WK    TL +    ++ K    ++                 +L +VEG CLVM+C  R   R+L+ H+L+EV++++           ++ +V Q+   S        ++DVID A   I+E+ L  LP  EKA +    NID M +A+R   +W   G  S    N IN         S    ++W   +A + ++ F   SCQ A+ +AW  +  R+N LF  IDP+ Q+ ENR SS+LR GS       + E+D  M LW+NYI  AC +A     Q    + +   SP+  G + +SS      S +S +      ++ P           L+KCE SD+R++V+  +G+ NP+  ++L +EL   L+E++DKKQ+N+RRR+++D LR+ +  I +LLA N +F  SE         QLS +   +D+++  R YL +G++      D  L IL E RLHF             E R+ L++ + + S F + A+W+G+F     +               S D+   +    A+ AM +++CCGP+FD     +DGYI  WL  +++S DEK   L +ET+ LLLD+N +    LD +ID CY          F ++   F N  +YPCD+V+M+ LA+    +    I E A QLL LL  RF         +   +      D      +  N     +S           SQ  +S+ L+ + PDLT+ +FSEIT R  TA P+++  LL  L+PW++N+EL+D        + +  +   +R+S ++Q      P     L G GWGS QAT++VLNNLFY+TV+FG E    +E +W  LV     N+ V+I YL+VI ++     L +AK+++ +L + KP+KL++ + + LQTV+ +N ++ERTQ+ PFYR+            ++L   P +N +T            D+ ++N     P   ++   L       K  S   DI   + T+   S  G+L+     +T    ++     + A    + E   +  I   +++   P   HPLP+PAYGG+ APLN+ L ED  P     ++S+I +M   D+V
Sbjct:   44 KPGEYILQCLFLEFCRICERKIEQVLAEPLERPLTKSLQRGEDAQFDQILNSLGCAAEHCLPSILRTLFAWHDRQTRYG-------------------------------------YEDSPLLDSRQRHRSKGSKDV-LCERRDLAVEFVHCLILVEVLSKLSYHPGHDDLVQHIIDQAFRHFKYRDGLQTNPNAANINVIADLYAEVIGVLAASRFSAVRKKFMGELRELKLRDQTPYTAQSIISLLMGLKFFRVKMHPIEDFEACVHFLLEMGHYFLEVKDRDIKHALAGLFVEILLPVAATVKNEVNIPVLKKLVDDLYSVTVDMTTKRKHTLHLFPLVTCLLCVSQKQFFLSNWPYFLTMCLSQLKNKDPKMSRIALESLYRLLWVYMVRIKCESNTATQSRLQSIVNSLFPKGSKMVTPKDTPLNIFVKIIQFIAKACLQLALRDIIFDLLCVGRSNKLFLTPERMSIGLRAFLVIADSLEQKDGDPPMPQ------------------SNAALPS-------GSTVRHKRTFLNKM-----------------------------LSDSTARTIGLAQYYSHILKTFDSILRALDLQVGRPLLMTKSENANKEPDEMITG----------------------DRKPKIDLFRTCIAAIPRLKPDGMTSPELVDLLTRLTVHVDEELKGLAFQALQNLMSESQAWKEHVIHGFVQFIMKDISDSKTHLLDMTLRLLMQLLVQWKTSIGTLTSGAGSSHAKESGKERGDHSCLGSGPESAASVDVLHEVEGLCLVMMCSCRIMTRKLAFHLLREVRNIL-----------TACSVIQDFSLS--------LLDVIDKACPVIVEKLLSHLPPQEKAIVLTQPNIDLMWVADRAVTLWLPAGGGSLQEGNQIN--------YSFHRVDMWIRFMAAVVSKDFAQISCQRAIAHAWPIVYTRLNALFPSIDPNTQLNENRASSILRSGSKK----VTTEKDVHMQLWQNYIILACSIA-----QQSAVIPQRCSSPEL-GLSPESSPSDKTESRSSCTATNLFRLLVP-----------LMKCENSDMRDTVVNGLGYCNPAVFKELAEELLPFLKEAIDKKQDNLRRRRKRDVLRVQLAHIFQLLAENRVFAQSEAGAIDTDSGQLSSMF--VDYIDGARQYL-EGEN------DRDLPILQEIRLHFM------------EYRKTLLSRDLRYSLFHLFANWSGHFGAIDRRF--------------SKDETWSEQELPAVRAMSAVLCCGPVFDVNGFNDDGYIYHWLDTLLSSNDEKIYELAKETVYLLLDFNPDAQGLLDWVIDRCYTGQKEVADGCFKALAAVFQN-KEYPCDHVAMLNLAVLNVGSPRMSIHETALQLLHLLDARFL--------QEEVVFTAAADDLPRPPQLPLNDVLLAVSYYH--------SQMCLSQQLARLHPDLTMPMFSEITHRFQTARPSVRQSLLKYLLPWLHNMELVD----PSLPATNPLTNFLTRLSDSQQADHFLPP-----LKGEGWGSTQATEMVLNNLFYITVKFGDEHPLEIETLWAALVMCWPSNLKVLIRYLLVIINMAATDLLPFAKRVVTYLGRAKPEKLVDEIMNELQTVETLNMNIERTQTPPFYRL------------SQLRKSPAANNTTD-----------DEKLVNHE---PDVQLQKGVL-----HTKRHSANEDIQNETRTSRTNST-GSLKSITSSSTGSTAEQAMDDEVVAHTQTRLERGERSTIEARRSESPVP---HPLPMPAYGGYFAPLNEMLPED-VPAMQGFHRSNIAVMLLSDLV 1637          

HSP 2 Score: 226.868 bits (577), Expect = 7.108e-55
Identity = 174/553 (31.46%), Postives = 274/553 (49.55%), Query Frame = 3
Query: 8979 SVRELIKIISTYRD----RPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNL--------KNSFSSPKIGY-HKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPF---TVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLF------INNVQWKEVYPILRLLVSKNSSLS 10571
            SV E+IK I ++ D    +P+W  ED+T             ++  +++ST    F                 L  +++    L      +  +W+Q+AL   ++C+ RHYA RS Q+ RAL        LS + SRL++T+ +  ED+Q YV E+ LTLE+ ++NL+ +    + +          +L+ STPNL         ++  +PK  Y H   S     +V        + ++  R+S  +E   S    S R   SLK NL  +          +++  LV +IFW+   L+ES+ E+EF   +R LS ++  L     D R KL+KI+Q   W + FPG   LL+KGC SQ     +  LLSK ++ +N  ++DP+   GF      +L  LV  ++   Q  R AA NIA +    S D L NL  VM LYS GTF KD  QWT+CV+KYL D YS ++  L++F+  +L +        ILQ+L    +Y++++  A+    N+II    +LF      +  V WKE   IL+L ++++S+L+
Sbjct: 1759 SVDEIIKAILSFMDTRKGKPLWSSEDIT------------PKVLTTQSSTHLQSF-----------------LKCVVRCFKEL-SPMALVEQRWSQVALQLALSCSSRHYAGRSFQVLRALQIRPTTQMLSDILSRLVETVAEQGEDMQGYVTEIMLTLEAFVENLDLELRPIDFM---------RELFMSTPNLAKDQLENRHSAIMAPKQPYPHHARSTSYSVSVFTQRAHYGAGDNRNRSSTDVEGHRSNLGRS-RSAQSLK-NLDQS--------GMEDKLTLVTQIFWITVSLLESDYEYEFSLAVRLLSKILQHLQPERPDCREKLDKILQQIKWPN-FPGVFVLLLKGCTSQVAAEATWALLSKTILCINSPVMDPSGACGFALVTTALLPYLVHNYENPCQTCRDAADNIAQMCSQQSED-LTNLATVMSLYSRGTFGKDSVQWTKCVIKYLLDVYSCLALTLISFLVEVLEKGALLYQPDILQILYCIAHYVDIH--ALPSCSNRIIN--QELFHTLNKHLQGVHWKEALKILKLAITRSSTLA 2256          
BLAST of Protein furry-like protein vs. TrEMBL
Match: A0A0P5YX11 (Furry OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 1043.88 bits (2698), Expect = 0.000e+0
Identity = 677/1856 (36.48%), Postives = 1026/1856 (55.28%), Query Frame = 3
Query: 2964 IKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVII-PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQK------SKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIW--GVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQS------GSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFD--YSEDQLSQL-ITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGY--ILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCD-YVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEI--SRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGN--GWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLN-NKPNSNTSTQIMET-NINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINIT-KTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGY-KSSIVLMFFIDIV 8444
            ++ S KPGEYV+ NL   F+  S  K    +      S+ K ++  +D +F  LL +  + AE+ LPSLL+ L  W       G+   P N  K                       T    ASE  A S +          +I E+RD+ V +I C  +I VLKQL +HPGH++++N + ++AF++FKYRD +  +PN   +  IADLYAEV+GVL QSRF+ VR +F SELK LR +EA+ +  Q+IISLLMGMKFFRVKM PIE+F   F F+ E A+YF+EV DK IKH+LAGLFVE+L+PVAA VK+EVN+P LKNFVE LY    D+ +K KH +AL PLVTCLL +GQK FFL NW  F+  CL+ LKNRDP  +RVALESL+RLLWVY++RIK E ++ T S+L SIVNSLFPKGSK VVPRD  +NIFVKII FIAQE+LDFAM+EI+FDL+   R  K+I+ PERMNIGL AFL+IA SLQ+KEGEPPMP+   +    PS                       S  R+ +  ++K  T   E  ++SI    +       Y +M                   RK  + +LR LD Q  R +++T  +NINKE D++M+G                      ERKPKI+L +TC++A+PRL+P  MS+ ELVELLSR+++H+DEELR ++ Q L NI+ + P WR   +  Y+QF+ KE+ D+SP  L+N ++IL  L++ W+N++I +T  + Q+      SK    + L   EG  LVMLCQ R   RR+S  +LKEVK         L L    +    E P          V+DV+D     ++++    LP++E+A L   QN+D   L+ER++P+W  GV+ ++       N GS+ + S    ++WS C+ +   +  +   C +A  NAWT +  R+N L+ ++DP+  +++NR +SLLR  ++ K+P+  NERD  + LWKNY+  AC V P     S   V +   SPD S      G + + S++++ S                +   L K+++ LI+CEV+D+R++V+ A+G  N +++RDLMDEL + +RE++D+KQ NVRR++R+D+LRL +V++ +L+A  G F   Y   + + L   VI++L+ +R  L        L  D       E R  F   +  L+   P + R +L+  + +Q  F++ A W+G F                N    + +++  +L   A+ AM S++CCGP F+ Q L ED +  +  WL  ++ SK+EK  +L +ET+ LLL++N +    LD ++D CY  +       FL++   F+   +YPCD Y ++I + L  T    T I E A QLLQ+L  RFF           S+ +      + ++  A  G ST  ++++     +T S+ +I  SR L+++ P+LT+ +FSEIT R+ TA P ++ +L   L+PW+ N+EL+D       +S  +     + + R+   ++          TG+  GWGS +AT++VLNNLFY+TV+FG +  K LE++W  L      N+ VI+ YL ++T +  +  L YAK+++++L + +P++LL+ L + LQT++ ++  +ERT++ PF+R+ +    S+   ++      P+ ++  QI    + +L      V  G+      S     +  L  +      +      +V     S+P   R    +   I++              KK V  + P  I     D   S  HPLP+P YGG+ APL +FL     P+  +G+ + ++ +MF +D+V
Sbjct:  125 VETSLKPGEYVMRNLFAEFVIQSDKKITGVMAEAFDRSLSKSLQRGEDAQFDQLLSSFGSVAEHCLPSLLRTLFAWFER---QGIEWMPGNEHK-------------------QKGDTKRSNASEIFALSEEE---------YIMERRDLAVQFILCLVLIEVLKQLPVHPGHEDLVNYIENLAFKNFKYRDGVQNSPNAANMLVIADLYAEVIGVLAQSRFHSVRKRFMSELKELRGREASPATTQAIISLLMGMKFFRVKMVPIEEFEASFQFMQECAHYFLEVKDKDIKHSLAGLFVEILVPVAATVKHEVNVPCLKNFVEMLYPPTIDLATKNKHRLALFPLVTCLLCVGQKMFFLSNWHCFLAMCLNHLKNRDPQFSRVALESLYRLLWVYMIRIKCESNSATLSRLLSIVNSLFPKGSKSVVPRDTPLNIFVKIIQFIAQERLDFAMREIVFDLLSVARPVKIILTPERMNIGLRAFLVIADSLQKKEGEPPMPRTVGA---LPS----------------------GSTMRVKKTYLSKMLT---EDAARSIGMSAY-------YPYM-------------------RKVLNGILRALDGQFGRPLIMTNLQNINKEPDEMMSG----------------------ERKPKIDLFRTCVAAMPRLIPDGMSRGELVELLSRITLHMDEELRTLAFQCLQNIVVDFPIWREDVLYGYIQFIVKEVPDTSPQLLDNVLRILLQLLSTWRNSVITATHRSPQEDLPSTISKLETASALRAAEGLALVMLCQCRLPPRRVSALILKEVK---------LLLKAFGLTSRDEEP----------VLDVMDTYCAAVVDKWSHLLPSSERAAL---QNVDLQWLSERSSPVWTSGVIDDSA------NKGSVAANSVSGVDVWSSCLYSFLEKDRVTSHCLSATANAWTIVFTRLNSLYIVVDPT-PVSDNR-ASLLRSAATVKRPV--NERDVYLHLWKNYVAFACRVVP----PSTNPVLR-CASPDISLSSSPDGMSTERSEVRSSSGTV-------------SPSSLYKLIVPLIRCEVTDMRSTVVNALGMINHAAIRDLMDELLLYIREALDRKQGNVRRQRRRDALRLQLVRVFQLIANRGTFGMSYVNGESNPLHPVVIEFLDGMRQCL-------ELDTDRDSVSGREVRSCFALFVTNLIDCFPLDVRPSLLKRDLRQQLFILFAGWSGKF----------GRPFGFNSSSAAKEQEPSELELTAVEAMSSVLCCGPCFNRQGLTEDNHSDVYSWLDILLASKNEKVYSLAQETVVLLLEFNPDISPLLDWVVDRCYTGNAQVADGCFLALATIFSAR-EYPCDHYTAIINVTLMSTGCPRTIIHEVALQLLQVLDARFF-------GSGPSLPLAFGDLDSEATERAEGGISTLDALLA-----TTYSRSQIYLSRQLAQLHPELTMPMFSEITHRLQTARPTVRQLLFRYLLPWLCNMELVD-PNLPPMSSGYNYPTYCADLGRSVPGAAVNNMTGDANETGHREGWGSAEATEMVLNNLFYVTVKFGDDHPKELEDVWAELCTCWPTNLRVILRYLFIVTGMAASELLPYAKRVVIYLGRARPERLLDELINELQTIETMSCLIERTETPPFFRVTSLRKTSSHWGESGSEPTAPSGSSGGQINRAEDASLGIGGLNVEKGTIHTKRHSSEDPGMLTLSAAAVVAGSVCSASIPAVNKLSCSSPRLDRSRSHNDAEILVT-------------KKVVLEEHPSTINPPNNDYESSQPHPLPMPEYGGYFAPLTEFLPNSSQPV--NGFHRCNLAVMFLVDLV 1777          

HSP 2 Score: 226.098 bits (575), Expect = 1.239e-54
Identity = 164/608 (26.97%), Postives = 286/608 (47.04%), Query Frame = 3
Query: 8982 VRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDAD---GTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTD-EDDLYRSTPNLKN-SFSSPKI--GYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDN----------------------KSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQ--SFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETP---RLELPGRILEYQFDV 10694
            ++ LI  IS+   +P+W YED+T                                  ++  + S   L+  ++ IC +         L  +WAQ+AL+  ++   RHYA RSLQIFR L        L+ + SRL++T  +  ED+Q YV EL LTLE+ ++          SL+ +    D   D+++STPNL N    SP +      +++R+            N+   H R+++   +    K  +      ++G                           K  + + L  D++  ++ ++FW+A  L+ES+ EHEF   LR L  +++ L     D R ++EK++    W + F G   +++KGC S   S +  +  LLS+    +  +L+DP++   F   V+ LL   V+ +++ T     +A+NIA ++      ++ NL  VM LYS  TF+K+  QWT+CVVKYL+D+Y  ++  ++ F+  +L   P+ M  A+L +L   ++Y++ N S+   Q+N  +  +   +I    WKE   IL+L V+++SSL  P S     +            +++    + ELPGR +E+ +D+
Sbjct: 1915 IKSLIYFISSRPGQPLWSYEDIT---------------------------------SKVWSVRSAEQLDVFVQHICRVFSESLPHSHLEERWAQVALHLALSSPSRHYAGRSLQIFRGLRVPITSRMLTDILSRLVETAAEQGEDMQGYVTELVLTLEASVE----------SLETDFRPMDVARDIFKSTPNLNNKECGSPFLERATGANLTRRHAFYGRTHLSAGNAPYSHIRSTSYTAACGDKKTGNSELKDQMRGRSSSGNANGVTLFPGSSLSRSRSAQSLKQALETGLVQDDKLAILAQLFWIAVCLLESDYEHEFLLALRLLERVLHRLPLDRPDCRDRVEKMLPQLKWNN-FAGVHAIVLKGCTSPNVSTYESTLSLLSQFTPFLEIALMDPSVGSAFAINVMALLPYMVANYEDATPLCIRSAENIAHVSTEKG-KKMENLATVMTLYSRRTFSKESFQWTKCVVKYLHDSYGYLTLPMVTFLVEVLERGPNGMQGAVLSILHCLLHYVDFNLSSNAQQVNADLLRVIAKYIEGAHWKEALKILKLAVTRSSSLVAPPSSASGPASGWGSDSNASSFSDSELFVKKELPGRTMEFTYDL 2477          
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Match: fryb (furry homolog b (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-080215-5])

HSP 1 Score: 821.617 bits (2121), Expect = 0.000e+0
Identity = 562/1670 (33.65%), Postives = 879/1670 (52.63%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKS--------KALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHL------STNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLT----GNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLV--NYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGEYV+++L  +F  +S  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+     +GL  +    R                                P A +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D ++  V+++AF+HFKY++  +  PN   ++ +ADLYAEVVGV+ QSRF  VR KF SELK LR KE +    QS ISL+MG+KFFR+KMYP+EDF   F F+ E A YF+EV DK IKH+LAGLFVE+L+PVAA VKNEVN+P L+NFVE LY+T  D+ S+KKH +AL PLVTCLL + QKQ FL  W VF+  CLS LKN+D  +ARVALESL+RLLWVY++RIK E +T TQS+L +I+++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII DL+   +S K   + PERMNI L AFL+IA +LQQK+GEPPMP   N+ +  P                        SG  L                           K+K +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  MSK EL++LL+RL++H+D ELR+++Q +L +++ +  +WR   +  Y  F+ +E+ D+     + ++K+L  L+  W+  L A  K + + +        ++   T+L  VEG  L++LC  ++S R+L+V VL+E++ L   I                   + + +K   +I+V+D  +  +L+  +  +  ++ A L +   +D   L E            ++  + ++H  + S SH+        + W  C+ +   +  L K C  A++ AW     R+  L  ++DP+  +   +TS             T    D  + LW+NY+     VA   I  S G +     +P+   +T D S   +           +  +  P+   LLK L+ L++ E  ++  S++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA +G+   S       D L+     +++++L R  L++ ++      D  L IL + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+   D +   L  E + LLL+ N +     +  +D C+  S       F +I  T     +YPCD V+++ L L  +S+   +I E + QL+Q+L  +  + S  +  + +      N       P+                 L ++S  ++S  L+ M P+LTL +FSE++QR  T +PN + I+L+ L+PW+ NIEL D      +      S   +    T++ S S      IGLT    GNGWGS QAT LVLNNL Y+T ++G EL    +EN W  LV  +  ++N+ + + +LI +  ++ + + L Y K+++++L +    + +E L   LQ  D +N  V    + PFYR 
Sbjct:   66 KPGEYVLKSLFANFTTLSERKIRIIMAEPLEKPLTKSLQRGEDHQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ--NGLEDESHEYR--------------------------------PRANTKSKNDEQQKD--YLMERRDLAIDFIFSLVLIEVLKQIPLHPLLDGLIQEVINLAFKHFKYKEGYLG-PNTTNMHIVADLYAEVVGVVAQSRFPAVRKKFISELKELRQKEQSPYVVQSTISLIMGVKFFRIKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHSLAGLFVEILVPVAATVKNEVNVPCLRNFVESLYDTTLDLSSRKKHSLALYPLVTCLLCVSQKQVFLNRWHVFLNNCLSNLKNKDHKMARVALESLYRLLWVYMIRIKCESNTATQSRLTTIISNLFPKGSRSVVPRDMPLNIFVKIIQFIAQERLDFAMKEIICDLLSVGKSAKAFSLNPERMNIALRAFLVIADNLQQKDGEPPMP---NTGATLP------------------------SGNTL---------------------------KKKKTYLSKTLTEEEAKLIGMALYYSQVRKAIDNILRHLDKEVGRCMMLTNVQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRILPDGMSKPELIDLLARLTVHMDIELRLIAQNSLQSLLLDFSDWREDVLFGYTNFLLREVQDTQQGLQDTSVKLLLQLLTQWRLALQAPGKRSAELAQSSRLPVERSPHSTVLHAVEGLALLLLCSCQTSTRKLAVAVLREIRCLFTAIG-----------------QAEDDDKP--MIEVMDRLSPAVLDSFV-HVAVSDSATLPLSHQVDLQWLVE------------WNARLVNSHYDVKSPSHVWIFAQSVKDPWVLCLYSFLRQEHLPKHCMMALSYAWPYAFTRLQLLMPLVDPNSPVYAKKTS-------------TPGPADGYVTLWRNYLILCLGVAKPSI-MSPGHLRA--STPEIMATTPDGSITYD-----------NKVIGTPSVAWLLKQLVPLMRLESIEITESLVLGFGRTNSLVFRELVEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADSGVISDSTNGALERDSLALGALFLEYVDLTR-MLLEAEN------DKELEILKDIRAHFSGMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSVMFTPLD----------RYSDRNHQITRYQYCALKAMSAVLCCGPVFDNVGLSTDGYLYKWLDNILGCHDLRVHRLGCEVVILLLELNPDQLNLFNWAVDRCFTGSYQLASGCFKAIA-TVCGSRNYPCDLVTLLNLVLFKSSDTSREIYEISMQLMQVLEAKLSVYSKRIVGQKSG-----NILYGTHRPLP---------------PLYSVSLSQLSNQLACMYPELTLPLFSEVSQRFPTTHPNGRQIMLTYLLPWLNNIELAD------TGLLPPASSPCTPEEETRESSDS------IGLTHRLKGNGWGSLQATSLVLNNLMYMTAKYGDELPGPEMENAWNALVTNDKWSNNLRITLQFLISLCGVSSDTTLLPYIKKVVIYLCRNNTIQTMEELLFELQQTDPVNPVVLHCDNPPFYRF 1513          

HSP 2 Score: 178.718 bits (452), Expect = 1.157e-43
Identity = 159/596 (26.68%), Postives = 279/596 (46.81%), Query Frame = 3
Query: 8988 ELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPS---PRRPASLK-------------------GNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIA--KILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            +LI+ ++T    P+W +ED+T                         K PNS+  ++L        L  ++ +      +D  L  + + +AL T +  + RHYA RS QIFRAL        +S L SRL++ +G+  ++VQ YV+E+ LTLES + NL   E   N      SD        S+P+      S K+  ++  + Q      GG    +  + HQR+ +V +    + + S   P R A+L                     + + + STV+        ++L+  IFW+A  LMES+ E E+   LR +  L+  +     + R +LEK+     W S F G   L++KG  S +   ++ QL  ++      ++VD +  +GFP  VL L   LV  FD  TQ  + +A+ IA +   +     +L +L  VM LY   ++ +D   W   V +YL++A+S+I+  ++ ++  +L +    M   +LQ++ + + ++++     V   N  +    + F+  V WKE   +L+L+VS+++SLSLP+    + + L    M+    ++     LPG+ L++ FD+
Sbjct: 1789 KLIEFLTTRAFGPLWCHEDIT------------------------PKNPNSKSAEQL-----ANFLRHVMSVFKE-TKSDFHLEQQLSDVALQTALCSSSRHYAGRSFQIFRALKQPLSAHAISDLLSRLVEVVGEHGDEVQGYVMEVLLTLESVVDNL--AECLKN------SDLMAALTRASSPDF---LVSGKLNCNRKSTGQLNLLQEGG---TSERSRHQRSYSVPKKFGESGERSASDPPRSATLDRIQACTQQGLARSARSTSSSSTRADGSTVTDPSHASHPSNLLATIFWVAVSLMESDFEFEYQMSLRLVHKLLARVPLELPENRERLEKLQAQLKW-SGFAGLQQLMLKGFTSPATSDLTLQLFCQLTPVSRVAVVDTSQAIGFPLNVLCLLPHLVQHFDSPTQFCKESAERIAQVCLEEKERNTKLSHLAHVMTLYKTRSYTRDPFSWVSVVCRYLHEAFSDITLSMVTYMAELLDKGLPSMQQPLLQIIYSLLSHMDL-AGIQVKPFNVEVLKTIEKFVQTVHWKEALNVLKLVVSRSASLSLPSYAHGDLANLEVSRMMWDGSSKA----LPGKTLDFHFDI 2334          
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Match: fryl (furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-040914-58])

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 552/1671 (33.03%), Postives = 852/1671 (50.99%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKE------NNQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQ-----GTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGI--------FDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTE-NFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            KPGE+VI++L   F  ++  K E+ +       + + ++  +D +F  LL ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+                                        +LYAEV+GVLTQS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRL+P  MS+ +L+ELL++L++H+DEELR ++   L  ++ + PEWR   +  ++ F+ +E+TD  P  L+N +K+L  LI+ W+  +  S +       N      L+++    +L  VEG  LV+LC  R + RRL+V+VLKEV++L          N   I    E             IDV+D  +  +LE  +     ++   L     ID  TLAE ++     +S+ + + ++ +H  + +      + W   +++   +  L K C  A++ AW     R+  L   +D +  I   + +SL            S+  D  + LW+NY+   C  A    S S      G+V     + L S   SG + DS  I                   P+   L K ++ +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA +G+         D     L+   T++++++L R  L++ ++      D     L + R HF  L+  ++ + P  +R+++  + + + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++    I E A QLLQ+L  + F           +  +E+     V +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+DF  T+       +      +             ++  L G GWGS QAT ++LNNL ++T ++G + + S +EN+W  L +    N+ +I+H+LI ++ + +  S L Y K+++V+L ++K  +LLE L   L+ +D ++ +V    + P+YRI
Sbjct:   11 KPGEFVIKSLFAEFAVLAEKKIEVVMAEPLEKPLSRSLQRGEDAQFDQLLSSMSSIAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYGYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQV----------------------------------------NLYAEVIGVLTQSKFQAVRKKFNTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTTTQSRLFSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGVILPSGNTLRVKKIFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDNILRHLDKEVGRSMSMTNVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLIPDGMSRQDLIELLAKLTIHMDEELRQLAFTTLQALMMDFPEWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLLQLISQWRGAVQTSNRSHDSQVSNGSACLPLERSPLWGVLHVVEGLALVVLCSCRPATRRLAVNVLKEVRAL---------HNALGIAKGDEE----------LTIDVMDRISASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSS---SPISHQF-DVVSPSHIWVFAHVTQGQDPWVISLSSYLRQENLPKHCPTALSYAWHFASTRLQLLSPQVDINSPINAKKMNSL------------SSSTDSYIGLWRNYLILCCSSATSSSSSSSSSSAPGSVRCSPPETLASTPDSGYSYDSKIIG-----------------IPSPSSLFKHVVPMMRSESMDITESLVLGLGRTNPVAFRELLEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADSGVVSQIGSGGLDGESHSLNG--TLLEYVDLTR-QLLEAEN------DKDSDTLRDIRSHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDRKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVATGCFRAIANVFHNR-DYQFDTVVLLNLILFKAADSSRDIYEVAMQLLQILEPKLF---------RYAHKLEIQRADGVLTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDFKPTARRQEEPEEEEDAREMMMVN---------SRRWLRGEGWGSPQATTMILNNLMFMTAKYGDDYAWSEIENVWTTLADSWPKNLKIILHFLISMSGVNSEPSLLPYVKRVVVYLGRDKTMQLLEELMCELELMDPVSSAVTHMDNPPYYRI 1429          

HSP 2 Score: 207.994 bits (528), Expect = 1.302e-52
Identity = 170/596 (28.52%), Postives = 289/596 (48.49%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL---------KGNLKDNKSTVSSNLSWD---ERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            +++ V+ LI+ IS+ +  P+W +ED++                         K PN +  ++L +      L  ++ +      A   L    +++AL T ++C+ RHYA RS QIFRAL      + LS L SRL++T+GD  E+ Q +V+EL LTLE+GI  L      A++L +    T         P L   F++     ++  + Q   + GG F +     +H R++++  S     +   RR  +L          GNL   +S  S         + T+L+  +FW+A  L+ES+ E E+   LR L+ L+  L     D R +LE++     W + FPG + L +KG  S +   ++  LLSK++     +LVDP+   GFP  +L LL  +   FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL+DA+++I+  L+ ++  +L +    M  ++LQ++ + + +I+++ +A   Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P     E     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1703 QDEKVKNLIEFISSRKRGPLWNHEDMS------------------------PKNPNIKSAEQLSVF-----LRHVVTVFKQTPSAGFQLDQLLSEVALQTALSCSSRHYAGRSFQIFRALKQPLTASTLSDLLSRLVETVGDPGEEAQGFVIELLLTLEAGIDTL------ADTLKNYDLLTALSQASSHDPLLGTKFAN-----NRKSTGQLNLSSGGLFHM---HYNHARSNSLRASLIGECKGDRRRSNTLDVADRLGGSHGNLARTRSLSSLREEAGPPVDPTNLMATVFWIAASLLESDYEFEYLLALRLLNRLLAQLPLEKPDSRERLERVQAKLRWYN-FPGLLQLFLKGFTSAATQELTIHLLSKLISVSRQTLVDPSQVAGFPLNILCLLPHLILHFDSPTVFCKETADRIAKVCAEEKSATLANLAHMMSLYSTHSYSRDSTNWINVVCRYLHDAFADITFNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPTKQFNLEIMKIIGKYVQSPYWKEAQNILKLVVSRSASLVVPD----EMQRSYSAESSGSPEIAFTRIFNNSSKELPGKTLDFHFDI 2249          
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Match: frya (furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-060510-4])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 544/1668 (32.61%), Postives = 877/1668 (52.58%), Query Frame = 3
Query: 2979 KPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTK-------------ENNQKSKALDK-----TLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYS------EDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLV--NYRTDNMMVIIHYLIVITSLTPNS-FLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFY 7889
            +PGEYV+++L  +F   S  K  + +       + K ++  +D +F  L+  +++ AE  LPS+L+ L DW+                                     +   +      P + +   +D    D  ++ E+RD+ +D+IF   +I VLKQ+ LHP  D +++ V+++AF+HFKY++     PN   ++ +ADLYAEV+GVL Q++F  V+ KF SELK LR KE +    QS ISL+MG+KFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAAV KNEVN+P L+NFVE LY+T  D+ ++KKH +AL PLVTCLL + QKQ FL  W VF+  CLS LK++DP +ARVALESL+RLLWVY++RIK E +T TQ +L++IV +LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKE+IFDL+   +  K   + PERMNIGL AFL+IA  LQQK+GEPPMP                   N  AT                           P  N+  +         K +Y   TL +  A  +G+  Y + VRK+ D +LR LD++V R M+LT  + +NKE +D++TG                      ERKPKI+L +TC++AIPR+LP  M+K EL++LL+RL++H+D+ELR+++Q +L +++ +  +WR + +  +  F+ +E+ D+    L++++K+L  L+  WK  L+AS K             +    S+ + +      +L  +EG  LV+LC   ++ R+L+V +L+EV+ +++                    NS E  +   ++DV+D     +LE     +   +   + + Q  D   L E +    G++S+ Y + ++ +   + ++S    + W+ C+ ++  +  L K C  A++ AW     R+  L  +ID                 ++ KK  ++   D  + LW+NY+     VA   I  S G +     +P+    T DSS   +           +  V  P+   LLK L+ L++ E  ++  +++   G  N    R+L++EL  +++E+++++ EN +RR+R+D LRL +++I ELLA +G+   S       D L+     +++++L R  L++ ++      D  + I  + R HF  ++  L+   P   R+ L   ++ +   F++ + W G F                  +    + +     Y A+ AM +++CCGP+FD   L  DGY+  WL NI+  +D +   L  E + LLL+ N +     +  +D CY  S       F +I  T     +YPCD V+++ L L   S+ + +I E + QL+Q+L  +  + S  +  E +S  +               GT   +        L TLS  ++S  L+   P+LTL +FSE++QR  T++PN + ++L+ L+PW+ NIEL+D             + + S +   ++  SS +  +   L G+GWGS QAT L+LNNL Y+T ++G ++  + +EN W  LV     + N+   + +LI +  ++ ++  L + K+++++L +    + +  L   LQ  D +N  V    + PFY
Sbjct:   58 RPGEYVLKSLFANFTTHSERKIRIVMAEPLEKPLTKSLQRGEDPQFDQLISTMSSLAEYCLPSILRTLFDWYKRQ----------------------------------NGEEDESHEYRPRSNTKSKNDEQQKD--YLLERRDLAIDFIFSLVLIEVLKQMPLHPVLDTLVHEVINLAFKHFKYKEGYHG-PNTANMHIVADLYAEVIGVLAQAKFPAVKKKFLSELKELRQKEQSPYVVQSTISLIMGLKFFRVKMYPVEDFEASFQFVQECAQYFLEVKDKDIKHALAGLFVEILVPVAAV-KNEVNVPCLRNFVESLYDTTLDLSTRKKHSLALYPLVTCLLCVSQKQLFLNRWHVFLSNCLSNLKSKDPKMARVALESLYRLLWVYMIRIKCESNTATQGRLNNIVTTLFPKGSRSVVPRDMPLNIFVKIIQFIAQERLDFAMKEVIFDLLSVGKPAKAFSLNPERMNIGLRAFLVIADKLQQKDGEPPMP-------------------NTGAT--------------------------LPSGNTMRV---------KKTYLSKTLTEEEAKVIGMSLYYSQVRKAIDNILRHLDKEVGRCMMLTNSQMLNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRILPDGMTKLELIDLLARLTIHMDDELRLIAQNSLQSLLVDFSDWREEVLLGFSSFLLREVQDTHQALLDSSIKLLLQLLTQWKLALLASNKHLDTAKICSAELLQGGSSSRLVPERAPHFAVLHALEGLALVLLCSCHTATRKLAVAILREVRIILLTTG-----------------NSEEDERP--MLDVLDQVGPVVLESFAHVV--RDSTSVPVGQQADLQWLVEWSG---GLLSSHY-DVLSPSRVWVVAQS--IRDPWALCLFSLLRQEHLPKHCPTALSYAWPYAFTRLQLLMPLID---------------NPANAKKTSSAGSGDSYVALWRNYLILCFGVAKPSI-MSPGHLRA--STPEIMTPTSDSSGSYD-----------NKVVGTPSVAWLLKQLVPLMRSESIEITEALVLGFGRTNSLVFRELIEELHPLMKEALERRPENKKRRERRDLLRLQLLRIFELLADSGVISDSTNGALERDTLALGALFLEYVDLTR-MLLEAEN------DKDVEIFKDIRAHFSSMVANLIQCVPVHHRRFLFPQQSLRHHLFILFSQWAGPFSIMFTPLD----------RYSDRNHQITRYQYCALKAMSTVLCCGPVFDNVGLSPDGYLYKWLDNILACQDLRVHQLGCEVVVLLLELNPDQANLFNWAVDRCYTGSYQLASGCFKAIA-TVCGSRNYPCDTVTLLNLILFKASDANREIYEISMQLMQILEIKLCVYSKRILEEKSSTLL--------------YGTHGPLP------PLYTLSLPQLSAQLARAYPELTLPLFSEVSQRFPTSHPNGRQVMLTYLLPWLRNIELVD-------GGLLPATSSPSHLLENRKGRSSSMNSSTSHLPGSGWGSPQATALILNNLMYMTAKYGDDVPGAEMENAWTALVCSERWSSNLRTALQFLISLCGVSSDTLLLPHIKKVVIYLCRNSTTQTMAELLFELQQTDPVNPVVLHCDNPPFY 1510          

HSP 2 Score: 177.563 bits (449), Expect = 2.216e-43
Identity = 165/589 (28.01%), Postives = 265/589 (44.99%), Query Frame = 3
Query: 8991 LIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSS------PKIGYHKD-ISRQRGTTVGGGFRILNSSNHHQRASAV--IESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTL---LVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINM---NESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            L++ ++T    P+W +ED+T            NQ S S     N             L   V+V             +D  L  + + +AL T +  + RHYA RS Q+FRAL        +S L SRL++ +G+  E+VQ YV+EL LTLES + NL  + +  N L    +     DL  +   L N  S+      P  G   + I  QR  +V   F     S+   R++ +  I + T   Q +  R  S       +    ++  + +   +L+  IFW A  LMES+ E E+   LR L  L   ++    + R KLEKI     W S F G   LL+KG  S     ++ QL S++       +VD +  +GFP  VL L   LV  FD  TQ  +  A+ I+ +       +L NL  VM LY   ++ +D   W   V +YL++A+SE +  ++ ++  +L +    M  ++LQ++ + + ++++          ++ K IE     F+  V WKE   IL+L+VS+++SL+L        +   S         E  R+       LPG+ L++ FD+
Sbjct: 1750 LVEFLTTRPFGPLWCHEDITPK----------NQHSRSTEQLTN------------FLRHVVSVFKES--------KSDVRLEQQLSDVALQTALCSSSRHYAGRSFQVFRALRQPLSALAVSDLLSRLVEVVGEHGEEVQGYVMELLLTLESVVDNLA-ECLKNNDLMALLTRASSPDLPTNGKLLFNRKSTSQLDLVPGSGTASERIRHQRSYSVPKRFGEAERSSEVPRSATLDRIHACTHQHQSNLSRLHSHSSTSSRDNVVSTNPANANHPRNLLATIFWAAVSLMESDFEFEYQMSLRLLGKLFTYVSLDKQENREKLEKIQSQLRW-SGFSGLQQLLLKGFTSAGTTELTLQLFSQLTPVSRLPVVDTSQAIGFPLNVLCLLPHLVQHFDCPTQFCKDVAERISQVCAEEKNAKLSNLAHVMTLYKTHSYTRDCFSWVNVVCRYLHEAFSENTLSMVTYMAELLEKGLPSMQQSLLQIIYSLLTHMDLGGIQAKPFNVEVLKTIEK----FVQTVHWKEALNILKLVVSRSASLAL----PSSPAGSSSSSSTGASHVEISRVWDAASKSLPGKTLDFTFDI 2298          
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Match: fryl (furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-040914-58])

HSP 1 Score: 432.95 bits (1112), Expect = 7.039e-121
Identity = 210/306 (68.63%), Postives = 247/306 (80.72%), Query Frame = 3
Query: 3549 ANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHK--VIIPERMNIGLCAFLLIALSLQQKEGEPPMP 4460
            + PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AFL+IA SLQQK+GEPPMP
Sbjct:   11 SGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFNTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTTTQSRLFSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAFLVIADSLQQKDGEPPMP 316          

HSP 2 Score: 405.986 bits (1042), Expect = 1.256e-112
Identity = 317/1101 (28.79%), Postives = 548/1101 (49.77%), Query Frame = 3
Query: 4686 TLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSK------ALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQ-----GTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGI--------FDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTE-NFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRL+P  MS+ +L+ELL++L++H+DEELR ++   L  ++ + PEWR   +  ++ F+ +E+TD  P  L+N +K+L  LI+ W+  +  S + ++ +S        L+++    +L  VEG  LV+LC  R + RRL+V+VLKEV++L          N   I    E             IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  A++ AW     R+  L   +D +  I   + +SL            S+  D  + LW+NY+   C  A    S S      G+V     + L S   SG + DS  I                   P+   L K ++ +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA +G+         D     L+   T++++++L R  L++ ++      D     L + R HF  L+  ++ + P  +R+++  + + + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++    I E A QLLQ+L  + F           +  +E+     V +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+DF  T+       +      +             ++  L G GWGS QAT ++LNNL ++T ++G + + S +EN+W  L +    N+ +I+H+LI ++ + +  S L Y K+++V+L ++K  +LLE L   L+ +D ++ +V    + P+YRI
Sbjct:  338 TLTDEEAKVIGMSLYYPQVRKALDNILRHLDKEVGRSMSMTNVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLIPDGMSRQDLIELLAKLTIHMDEELRQLAFTTLQALMMDFPEWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLLQLISQWRGAVQTSNRSHDSQSSNGSACLPLERSPLWGVLHVVEGLALVVLCSCRPATRRLAVNVLKEVRAL---------HNALGIAKGDEE----------LTIDVMDRISASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISLSSYLRQENLPKHCPTALSYAWHFASTRLQLLSPQVDINSPINAKKMNSL------------SSSTDSYIGLWRNYLILCCSSATSSSSSSSSSSAPGSVRCSPPETLASTPDSGYSYDSKIIG-----------------IPSPSSLFKHVVPMMRSESMDITESLVLGLGRTNPVAFRELLEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADSGVVSQIGSGGLDGESHSLNG--TLLEYVDLTR-QLLEAEN------DKDSDTLRDIRSHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDRKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVATGCFRAIANVFHNR-DYQFDTVVLLNLILFKAADSSRDIYEVAMQLLQILEPKLF---------RYAHKLEIQRADGVLTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDFKPTARRQEEPEEEEDAREMMMVN---------SRRWLRGEGWGSPQATTMILNNLMFMTAKYGDDYAWSEIENVWTTLADSWPKNLKIILHFLISMSGVNSEPSLLPYVKRVVVYLGRDKTMQLLEELMCELELMDPVSSAVTHMDNPPYYRI 1313          

HSP 3 Score: 200.29 bits (508), Expect = 3.269e-50
Identity = 173/618 (27.99%), Postives = 290/618 (46.93%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL---------KGNLKDNKSTVS-------------------------SNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            +++ V+ LI+ IS+ +  P+W +ED++                         K PN +  ++L +     V  T+ K   S    D  L    +++AL T ++C+ RHYA RS QIFRAL      + LS L SRL++T+GD  E+ Q +V+EL LTLE+GI  L      A++L +    T         P L   F++     ++  + Q   + GG F +     +H R++++  S     +   RR  +L          GNL   +S  S                               + T+L+  +FW+A  L+ES+ E E+   LR L+ L+  L     D R +LE++     W + FPG + L +KG  S +   ++  LLSK++     +LVDP+   GFP  +L LL  +   FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL+DA+++I+  L+ ++  +L +    M  ++LQ++ + + +I+++ +A   Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P     E     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1587 QDEKVKNLIEFISSRKRGPLWNHEDMS------------------------PKNPNIKSAEQLSVFLRHVV--TVFKQTPSGFQLDQLL----SEVALQTALSCSSRHYAGRSFQIFRALKQPLTASTLSDLLSRLVETVGDPGEEAQGFVIELLLTLEAGIDTL------ADTLKNYDLLTALSQASSHDPLLGTKFAN-----NRKSTGQLNLSSGGLFHM---HYNHARSNSLRASLIGECKGDRRRSNTLDVADRLGGSHGNLARTRSLSSLREGGVPGGGGGGGGGMVGGGSGLGEAGPPVDPTNLMATVFWIAASLLESDYEFEYLLALRLLNRLLAQLPLEKPDSRERLERVQAKLRWYN-FPGLLQLFLKGFTSAATQELTIHLLSKLISVSRQTLVDPSQVAGFPLNILCLLPHLILHFDSPTVFCKETADRIAKVCAEEKSATLANLAHMMSLYSTHSYSRDSTNWINVVCRYLHDAFADITFNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPTKQFNLEIMKIIGKYVQSPYWKEAQNILKLVVSRSASLVVPD----EMQRSYSAESSGSPEIAFTRIFNNSSKELPGKTLDFHFDI 2154          
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Match: fryl (furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-040914-58])

HSP 1 Score: 423.32 bits (1087), Expect = 7.566e-118
Identity = 210/321 (65.42%), Postives = 247/321 (76.95%), Query Frame = 3
Query: 3549 ANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHK--VIIPERMNIGLCAFLLIALSLQQKEGEPPMP 4460
            + PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QSIISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LKNFVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AFL+IA SLQQK+GEPPMP
Sbjct:   11 SGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFNTELKELRQKEQSPHVVQSIISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKNFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYIIRIKCESNTTTQSRLFSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAFLVIADSLQQKDGEPPMP 331          

HSP 2 Score: 405.601 bits (1041), Expect = 1.647e-112
Identity = 317/1101 (28.79%), Postives = 548/1101 (49.77%), Query Frame = 3
Query: 4686 TLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSK------ALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQ-----GTV----GKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGI--------FDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTE-NFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRL+P  MS+ +L+ELL++L++H+DEELR ++   L  ++ + PEWR   +  ++ F+ +E+TD  P  L+N +K+L  LI+ W+  +  S + ++ +S        L+++    +L  VEG  LV+LC  R + RRL+V+VLKEV++L          N   I    E             IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W   +++   +  L K C  A++ AW     R+  L   +D +  I   + +SL            S+  D  + LW+NY+   C  A    S S      G+V     + L S   SG + DS  I                   P+   L K ++ +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA +G+         D     L+   T++++++L R  L++ ++      D     L + R HF  L+  ++ + P  +R+++  + + + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++    I E A QLLQ+L  + F           +  +E+     V +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+DF  T+       +      +             ++  L G GWGS QAT ++LNNL ++T ++G + + S +EN+W  L +    N+ +I+H+LI ++ + +  S L Y K+++V+L ++K  +LLE L   L+ +D ++ +V    + P+YRI
Sbjct:  353 TLTDEEAKVIGMSLYYPQVRKALDNILRHLDKEVGRSMSMTNVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLIPDGMSRQDLIELLAKLTIHMDEELRQLAFTTLQALMMDFPEWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLLQLISQWRGAVQTSNRSHDSQSSNGSACLPLERSPLWGVLHVVEGLALVVLCSCRPATRRLAVNVLKEVRAL---------HNALGIAKGDEE----------LTIDVMDRISASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISLSSYLRQENLPKHCPTALSYAWHFASTRLQLLSPQVDINSPINAKKMNSL------------SSSTDSYIGLWRNYLILCCSSATSSSSSSSSSSAPGSVRCSPPETLASTPDSGYSYDSKIIG-----------------IPSPSSLFKHVVPMMRSESMDITESLVLGLGRTNPVAFRELLEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADSGVVSQIGSGGLDGESHSLNG--TLLEYVDLTR-QLLEAEN------DKDSDTLRDIRSHFSALVANIIQNVPVHQRRSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDRKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVATGCFRAIANVFHNR-DYQFDTVVLLNLILFKAADSSRDIYEVAMQLLQILEPKLF---------RYAHKLEIQRADGVLTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDFKPTARRQEEPEEEEDAREMMMVN---------SRRWLRGEGWGSPQATTMILNNLMFMTAKYGDDYAWSEIENVWTTLADSWPKNLKIILHFLISMSGVNSEPSLLPYVKRVVVYLGRDKTMQLLEELMCELELMDPVSSAVTHMDNPPYYRI 1328          

HSP 3 Score: 200.29 bits (508), Expect = 3.305e-50
Identity = 173/618 (27.99%), Postives = 290/618 (46.93%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASL---------KGNLKDNKSTVS-------------------------SNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            +++ V+ LI+ IS+ +  P+W +ED++                         K PN +  ++L +     V  T+ K   S    D  L    +++AL T ++C+ RHYA RS QIFRAL      + LS L SRL++T+GD  E+ Q +V+EL LTLE+GI  L      A++L +    T         P L   F++     ++  + Q   + GG F +     +H R++++  S     +   RR  +L          GNL   +S  S                               + T+L+  +FW+A  L+ES+ E E+   LR L+ L+  L     D R +LE++     W + FPG + L +KG  S +   ++  LLSK++     +LVDP+   GFP  +L LL  +   FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL+DA+++I+  L+ ++  +L +    M  ++LQ++ + + +I+++ +A   Q N  I  +   ++ +  WKE   IL+L+VS+++SL +P     E     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1602 QDEKVKNLIEFISSRKRGPLWNHEDMS------------------------PKNPNIKSAEQLSVFLRHVV--TVFKQTPSGFQLDQLL----SEVALQTALSCSSRHYAGRSFQIFRALKQPLTASTLSDLLSRLVETVGDPGEEAQGFVIELLLTLEAGIDTL------ADTLKNYDLLTALSQASSHDPLLGTKFAN-----NRKSTGQLNLSSGGLFHM---HYNHARSNSLRASLIGECKGDRRRSNTLDVADRLGGSHGNLARTRSLSSLREGGVPGGGGGGGGGMVGGGSGLGEAGPPVDPTNLMATVFWIAASLLESDYEFEYLLALRLLNRLLAQLPLEKPDSRERLERVQAKLRWYN-FPGLLQLFLKGFTSAATQELTIHLLSKLISVSRQTLVDPSQVAGFPLNILCLLPHLILHFDSPTVFCKETADRIAKVCAEEKSATLANLAHMMSLYSTHSYSRDSTNWINVVCRYLHDAFADITFNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPTKQFNLEIMKIIGKYVQSPYWKEAQNILKLVVSRSASLVVPD----EMQRSYSAESSGSPEIAFTRIFNNSSKELPGKTLDFHFDI 2169          
BLAST of Protein furry-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005308.1 (pep scaffold:Pmarinus_7.0:GL476613:2313:60678:-1 gene:ENSPMAG00000004779.1 transcript:ENSPMAT00000005308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 786.178 bits (2029), Expect = 0.000e+0
Identity = 543/1627 (33.37%), Postives = 827/1627 (50.83%), Query Frame = 3
Query: 3162 PSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIG-ANRSHKVII--PERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWK-----------------NTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSL---IIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSL-RDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAP-KEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLC---YAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIG-------------------LTGNGWGSKQATDLVLNNLFYLTVRFGQEL-SKSLENIWGCLVNYRTDNMMVIIHYLIVITSL-TPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            PSLL+ L DW+    +            C+                      +SY    P +++    D  + +   + EKR++ +D+IFC  +I VLKQ+ +HP  D +L  V+++AF+HFK ++     PN   ++ +ADLYAEV+GVL QS+F  VR KF +ELK LR KE +    QSIISL++G+KFFRVKMYP+E+F D F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P L+ FVE LY T  ++ S++KH +AL PL TCLL + QKQFFL NW +F+  CLS LKNRDP ++RVALESL+RLLWVY+VRIKGE +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LD+AM+EIIFDL+  A +  K +   PERMNIGL AFL+IA SLQ+KE                   C   M        S       S  R+ +  +NK                             TL +  A  +G+  +   VRK  D MLR LD++V R+M L   +N+ KE +       I +  G              ERKPKI+L +TC++AIPRLLP  MS SEL+E+L+RL+ H DEELR ++  +L +++ + P WR   + T+L FV +++ +     L+N +++L  L+  W+                  T  A   +   + +     +L  VEG  LVMLC      RRL+V +L+E ++L   + H  +D +L                      VID+++  +  +LE  +      +   L +   +D   L+E T    GV   +  +  + +H  L +++    + W   +A++       +SC  A   AW+  M R+  L  ++DP       R S++         P T    D  + LW+NY+   C ++P  +S   G   +   SP+   ST +SS   +  S   +S AA   ++ P           L++CE  +L   ++  +G  N  +   +LM+EL  I++E +DKKQENVR+RK++D LR+ +V+I ELLA  G+  +      +  T      LL  Y+ Q    + +  D     + + R+HF  LI  L+ H P  E+R     ++ + S F +++ W G F              L + ++E + +++  +    + A+ AM +++CCGP+ +   L  DGY+  WL +I+   D +   L  E + LLL+ N E    L   +D CY  S       F +I  TF +  D+P   V+++ L L   ++   +I E A QL+Q++  +      F ++E +      + D  +SSP+A                L +LS   +S  L+ + P+LTL +FSE+++R  T     + +LLS L PW+ NI+L+                            S+       G                   L G+GWGS  AT LVLNNL ++T ++G+   S  LE++W  L +    N+ VI+ +LI +  + +    L   K++++F+ +EK  + LE L   L+ ++ +N  + RT++ PFYR+
Sbjct:   15 PSLLRTLFDWYRRQIA------------CED-------------------GAHSY---RPRSSTKSKGDEPSRERDPVMEKRELAIDFIFCLVLIEVLKQIPVHPVPDSLLQDVMNLAFKHFKPKEG-YNGPNTANLHIVADLYAEVIGVLAQSKFQAVRKKFMTELKELRQKEQSPLVVQSIISLIVGLKFFRVKMYPVEEFEDSFQFMGECAKYFLEVKDKDIKHALAGLFVEILIPVAATVKNEVNVPCLRTFVELLYQTTFELSSRRKHSLALFPLTTCLLCVSQKQFFLNNWHIFLNNCLSHLKNRDPKMSRVALESLYRLLWVYMVRIKGESNTTTQSRLQSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDYAMREIIFDLLSVAIKMPKTLAINPERMNIGLRAFLVIADSLQKKE-------------------CEPPMPTTSVVLPS------GSTLRVKKTFLNK-----------------------------TLTEEEAKVIGMSQFYPQVRKILDLMLRQLDKEVGRSMTLGGGQNVAKETE-------ITLCRG--------------ERKPKIDLFRTCVAAIPRLLPDGMSHSELLEMLARLTTHADEELRSLACASLQSLMLDFPVWREDALITFLAFVSRDVGEHHAAALDNALRMLLQLLTQWRLAVQATAATTAPTAAANMTTAAVAAKVQDERQGRHSPVLHAVEGLALVMLCNTTVGTRRLAVLLLRETRALATTLGHCKVDEEL----------------------VIDILEKLSPSVLESFIHLTNAEQTTLLQLPPAVDLQWLSEGT----GVPECSMLDTRSASHVWLFAQAR---DPWLLALASLLGHEHFQRSCPLAQAWAWSYGMVRLTALTPLVDPGNPANAKRISAV---------PTT----DSPVGLWRNYLVLCCSLSPAGVSAGGGHQLRG-SSPETLASTPESSYSFDGKSVGGSSPAALFHLVVP-----------LMRCESLELTECLVLGLGCTNSGAFFTELMEELNPIIKEVLDKKQENVRKRKKRDILRVQLVRIFELLADTGVISHRGSGGLEASTHTLSSSLLE-YVDQTRQLLEVENDKDSDSVRDARMHFSALIANLISHLPISERRWLFPQQSLRHSLFHLLSQWAGPF-------------RLISTQLEWSTERSQPITRQNFLALKAMAAVLCCGPLLESVGLPMDGYLQRWLDSILGHPDPQVHQLGCEMVVLLLELNPELSYLLQWAVDRCYTGSPLVAAGCFTAIATTFTSR-DWPMGMVTLLNLILFKAADPSQEIYEMALQLMQVMEEKL-----FGYTERDESG---DVDGLLSSPMA-------------LPPLYSLSAYSLSEELARLYPELTLPLFSELSRRFQTTQTPGRQVLLSYLQPWLSNIQLVAGGAGGAWGLPGDAGSVGGGGGGGTPERSA---VEGAGWDEEEDAEARRDSGQGRRWLKGSGWGSPLATALVLNNLLHMTAQYGEGFPSAELESVWTALADSWPGNLRVILQFLIALCGVRSEPDLLPSIKKVVIFICREKTVETLEELLPELERMEPVNSILIRTKNPPFYRL 1438          
BLAST of Protein furry-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000710.1 (pep scaffold:Pmarinus_7.0:GL477180:48772:90158:-1 gene:ENSPMAG00000000642.1 transcript:ENSPMAT00000000710.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 7.228e-28
Identity = 137/518 (26.45%), Postives = 231/518 (44.59%), Query Frame = 3
Query: 9222 ADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNL-------NPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSW-------------DERTDLVCEIFWLANILMESELEHEFYAGLRFLSLL----MNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSI---FDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDV 10694
            A   L  +  ++AL   + C  RHYA RS Q+ RAL        LS L SRL++ +GD  E+ Q  V+E+ LTLE+ +  +       N    F+ SLD   S T  +    ST  L  S S  + G      R+R  +      +L       R+  +       ++ SP   A    +L D      +                  +   L+  +FW A+ L+ES+ E E+  GLR L  L    +   + +   +  +LEK +    W   FPG   LL+KG  SQ+   ++ +LLS++      +++D +   GFP  VL LL  +   FD  T   +  A  IA +       +L NL  VM +YS  T+ +D T W   V  Y++D Y + +  L+ ++  +L +  + M  +IL  + + +  + +  + + +   ++++ +S+ ++ +  WKE   IL+L+V +++SL   +S                  A      LPG+ LE+QFD+
Sbjct:    1 AGSNLEQRLGEMALRLALACPSRHYAGRSFQMLRALRQPLGMHSLSLLLSRLVERVGDAAEETQGNVLEVLLTLETAVDTIAECSKLNNFLIAFSGSLDPALS-TKMEPSRCSTGQLHLSSSPIRTGSLMG-RRKRSNSASQKHALLADGGSEWRSITLDRPYERVRRSSPLAKARSLTSLADGSGDGGAAGGVAGSGAGSGIGTPPSDPLALLTVMFWGASALLESDYESEYLMGLRLLERLLGHALPLDDGASSKVWERLEKALAQLRWAG-FPGLQLLLLKGLTSQATVELTTRLLSRLTPVSRVAVIDASQATGFPLNVLCLLPHLVLHFDNPTPFCKECADKIAKVCLEEKTTKLPNLAHVMSMYSNRTYTRDCTVWISVVCCYIHDTYGDYTLNLVGYLAELLEKGLASMQRSILLTMHSLLSQVELTAAPLKHFNLEVMKVVSK-YVQSPHWKEALNILKLVVGRSASLGASSSV-----------------AGNAYKGLPGKTLEFQFDI 497          
BLAST of Protein furry-like protein vs. Ensembl Yeast
Match: TAO3 (Component of the RAM signaling network; is involved in regulation of Ace2p activity and cellular morphogenesis, interacts with protein kinase Cbk1p and also with Kic1p [Source:SGD;Acc:S000001391])

HSP 1 Score: 80.8777 bits (198), Expect = 4.459e-15
Identity = 60/259 (23.17%), Postives = 130/259 (50.19%), Query Frame = 3
Query: 3393 ISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRN---KEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVR 4160
            +++++ +   YI C+ +  ++KQ S +   D + + +  + F   K  D L  + + L+ +   + +AE++G +++ +F  V  +F ++L+ +      E   S       L++GM++ +++ YP+E F +  +F+  L+ +F + ++  +  A A +  ++LLP+A  +  EVN P     +  L NT   + +  K++++   L   +L       F   W   + A  S++K++  N   +    L RL+WVY+ R
Sbjct:  346 LADRKSLISIYILCRVLNEIVKQASSNEEED-LSDKLEEIVFTQLKTTDPLSISTS-LIKSSNWNSFAELLGSMSEKKFLSVSDRFIADLEKIPAYIPPELEPSTHL----LILGMRYLKLRNYPLEKFEESADFMKSLSKFFAKTENFPVCLAYAEVTNQLLLPLAGSLTAEVNHPTWVEAMSTLLNTAKRLQADSKYWVSGFKLTVSILCASPPDLFSKQWLSLLEANASKVKSKSLNERIIFAVGLSRLVWVYLYR 598          

HSP 2 Score: 63.929 bits (154), Expect = 5.944e-10
Identity = 33/105 (31.43%), Postives = 56/105 (53.33%), Query Frame = 3
Query: 9171 SVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFA 9485
            S   ++ +I+ I S+        + W ++AL     C+ RH A RS QIFR+L T  D   L  +  RL +TI D N D+Q + +++ +TL + +  L+P  + +
Sbjct: 1797 SPKTMDLLIRNIISIFSDLDEFQVTWQRIALKWATTCSVRHIACRSFQIFRSLLTFLDQEMLRDMLHRLSNTISDGNVDIQGFAMQILMTLNAIMAELDPTNLIS 1901          
BLAST of Protein furry-like protein vs. Ensembl Medaka
Match: fryl (FRY like transcription coactivator [Source:NCBI gene;Acc:101159981])

HSP 1 Score: 850.507 bits (2196), Expect = 0.000e+0
Identity = 568/1677 (33.87%), Postives = 886/1677 (52.83%), Query Frame = 3
Query: 2955 NYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKEN-------NQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQS---------QGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSED---QLSQLITV-IDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            N  I    KPGE+VI++L   F  ++  K E+ +       + + ++  +D +   L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+ LHP  D +++ VL++AF+HFK+++     PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LK FVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MS+ EL+ELL++L++H+DEELR ++   L  ++ + PEWR   +  +  F+ +E+TD  P  L+N +K+L  LI+ WK  L ++ K +       N++S +L++T    +L  VEG  LV+LC  R + RRL+V+VLKEV+  ++H  + +             P  +E       IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W    ++   +  L K C  AVN AW     R+  L   +D +  I   + +SL             N  D  + LW+NY+   C  A    S S         +  + + L S   SG + DS  +                   P+   L K  + +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  ++     + S L +V +++++L R  L++ ++      D    +L + R HF  L+  ++ +   + R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++   +I E A QLLQ+L  + F           +  +E+    ++ +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+D          +  +   S     ++     +  ++  L G GWGS +AT +VLNNL ++T ++G E + S +EN+W  L +    N+ +I+ +LI +  ++ + S L Y K+++V+L ++K  +LLE L   L+  D ++ ++    + P+YRI
Sbjct:    3 NITIDPDLKPGEFVIKSLFAEFAVLAEKKIEMVMAEPLEKPLSRSLQRGEDAQLDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQIPLHPVPDVLVHEVLNLAFKHFKHKEG-YCGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFITELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKTFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTVTQSRLLSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGIIMPSGNTLRVKKVFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDHILRHLDKEVGRSMSMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSRQELIELLAKLTIHMDEELRGLAFTTLQALMVDFPEWREDVLSGFAYFIVREVTDVHPTLLDNAVKMLLQLISQWKQALQSNNKSHESQQGSKNRRSVSLERTSPSAVLHVVEGLALVVLCSCRPATRRLAVNVLKEVR--VLHAALGI-------------PKGDE----ELAIDVMDRLSASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISFSSYLRQENLPKHCPTAVNYAWLFAFTRLQLLSPQVDLNSPINAKKVNSL-------------NSSDSYVGLWRNYLILCCSCASPSPSMSSSSSTSGSVRCPLPETLASTPDSGYSYDSKIVG-----------------APSPSSLFKHTVPMMRSESMDITESLVLGLGRTNPVAFRELIEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHTVSGGLENSSLNSVLLEYVDLTR-QLLEAEN------DKDSDMLKDIRCHFSALVANIIQNVSVKNRKSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVAAGCFRAIAHVFHNR-DYQFDTVVLLNLILFKAADSSREIYEVAMQLLQILEPKLF---------RYAHKLEIQRMDSILTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDL-------KPARRAEEVSSAEEEEEEQDVVMVNSRRWLRGEGWGSPRATTMVLNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLRIILQFLISMCGVSSDPSLLPYVKRVVVYLGRDKTMQLLEELMCELEMTDPVSSAITHMDNPPYYRI 1468          

HSP 2 Score: 197.208 bits (500), Expect = 2.702e-49
Identity = 173/606 (28.55%), Postives = 284/606 (46.86%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSN--H--HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS---------TVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            + +  + LI+ I++ +  P+W +EDV+     N GI + + +S                       S V  +  + ++  +    D  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLESGI  L      A S+ +          Y     L  S +   +   K    ++ T    G   LNSS   H  H R++++  S  S ++   RR  +L          GNL   +S          V       + ++L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R  LE + +   W + FPG + L +KG  S S   ++  LLSK++      L+DPT   GFP  +L LL   +  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL DA++E    L+ ++  +L +    M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  W+E   IL+L+VS+++SL +P     +     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1748 QEEKAKALIEFITSRKQGPLWNHEDVSPK---NPGIKSADHLS-----------------------SFVRRVVAVFQISQTGFQLDSLL----SEVALRTALSCSSRHYAGRSFQIFRALKQPLTSATLSDILSRLVETVGDPGEDAQGFVIELLLTLESGIDTL------AESVKN----------YDFLSALTQSSAQEHLLGAKFAVNRKST----GQLNLNSSGLPHAVHTRSNSLRTSLMSERKADRRRSNTLDIAERVGSSLGNLARTRSLSSLGGGASPVRDAAPPVDPSNLMATVFWIATSLLESDYEFEYLLALRLLNKLLGQMPLDRPDSRECLETVQEKLKWYN-FPGLLQLFVKGFTSASTQELTIHLLSKLITVSRQMLIDPTQVAGFPLNILCLLPHLIQHFDSPTPFCKETADKIAKVCADEKSATLSNLAHMMSLYSTHSYSRDCTNWINVVCRYLNDAFAEKILNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPHWREAQNILKLVVSRSASLVVPD----DVQRSYSSESCSSPEIAFTRIFNNSSKELPGKTLDFHFDI 2297          
BLAST of Protein furry-like protein vs. Ensembl Medaka
Match: fryl (FRY like transcription coactivator [Source:NCBI gene;Acc:101159981])

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 568/1677 (33.87%), Postives = 886/1677 (52.83%), Query Frame = 3
Query: 2955 NYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKEN-------NQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQS---------QGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSED---QLSQLITV-IDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            N  I    KPGE+VI++L   F  ++  K E+ +       + + ++  +D +   L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+ LHP  D +++ VL++AF+HFK+++     PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LK FVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MS+ EL+ELL++L++H+DEELR ++   L  ++ + PEWR   +  +  F+ +E+TD  P  L+N +K+L  LI+ WK  L ++ K +       N++S +L++T    +L  VEG  LV+LC  R + RRL+V+VLKEV+  ++H  + +             P  +E       IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W    ++   +  L K C  AVN AW     R+  L   +D +  I   + +SL             N  D  + LW+NY+   C  A    S S         +  + + L S   SG + DS  +                   P+   L K  + +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  ++     + S L +V +++++L R  L++ ++      D    +L + R HF  L+  ++ +   + R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++   +I E A QLLQ+L  + F           +  +E+    ++ +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+D          +  +   S     ++     +  ++  L G GWGS +AT +VLNNL ++T ++G E + S +EN+W  L +    N+ +I+ +LI +  ++ + S L Y K+++V+L ++K  +LLE L   L+  D ++ ++    + P+YRI
Sbjct:    3 NITIDPDLKPGEFVIKSLFAEFAVLAEKKIEMVMAEPLEKPLSRSLQRGEDAQLDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQIPLHPVPDVLVHEVLNLAFKHFKHKEG-YCGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFITELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKTFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTVTQSRLLSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGIIMPSGNTLRVKKVFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDHILRHLDKEVGRSMSMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSRQELIELLAKLTIHMDEELRGLAFTTLQALMVDFPEWREDVLSGFAYFIVREVTDVHPTLLDNAVKMLLQLISQWKQALQSNNKSHESQQGSKNRRSVSLERTSPSAVLHVVEGLALVVLCSCRPATRRLAVNVLKEVR--VLHAALGI-------------PKGDE----ELAIDVMDRLSASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISFSSYLRQENLPKHCPTAVNYAWLFAFTRLQLLSPQVDLNSPINAKKVNSL-------------NSSDSYVGLWRNYLILCCSCASPSPSMSSSSSTSGSVRCPLPETLASTPDSGYSYDSKIVG-----------------APSPSSLFKHTVPMMRSESMDITESLVLGLGRTNPVAFRELIEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHTVSGGLENSSLNSVLLEYVDLTR-QLLEAEN------DKDSDMLKDIRCHFSALVANIIQNVSVKNRKSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVAAGCFRAIAHVFHNR-DYQFDTVVLLNLILFKAADSSREIYEVAMQLLQILEPKLF---------RYAHKLEIQRMDSILTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDL-------KPARRAEEVSSAEEEEEEQDVVMVNSRRWLRGEGWGSPRATTMVLNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLRIILQFLISMCGVSSDPSLLPYVKRVVVYLGRDKTMQLLEELMCELEMTDPVSSAITHMDNPPYYRI 1468          

HSP 2 Score: 197.208 bits (500), Expect = 2.322e-49
Identity = 173/606 (28.55%), Postives = 284/606 (46.86%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSN--H--HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS---------TVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            + +  + LI+ I++ +  P+W +EDV+     N GI + + +S                       S V  +  + ++  +    D  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLESGI  L      A S+ +          Y     L  S +   +   K    ++ T    G   LNSS   H  H R++++  S  S ++   RR  +L          GNL   +S          V       + ++L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R  LE + +   W + FPG + L +KG  S S   ++  LLSK++      L+DPT   GFP  +L LL   +  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL DA++E    L+ ++  +L +    M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  W+E   IL+L+VS+++SL +P     +     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1748 QEEKAKALIEFITSRKQGPLWNHEDVSPK---NPGIKSADHLS-----------------------SFVRRVVAVFQISQTGFQLDSLL----SEVALRTALSCSSRHYAGRSFQIFRALKQPLTSATLSDILSRLVETVGDPGEDAQGFVIELLLTLESGIDTL------AESVKN----------YDFLSALTQSSAQEHLLGAKFAVNRKST----GQLNLNSSGLPHAVHTRSNSLRTSLMSERKADRRRSNTLDIAERVGSSLGNLARTRSLSSLGGGASPVRDAAPPVDPSNLMATVFWIATSLLESDYEFEYLLALRLLNKLLGQMPLDRPDSRECLETVQEKLKWYN-FPGLLQLFVKGFTSASTQELTIHLLSKLITVSRQMLIDPTQVAGFPLNILCLLPHLIQHFDSPTPFCKETADKIAKVCADEKSATLSNLAHMMSLYSTHSYSRDCTNWINVVCRYLNDAFAEKILNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPHWREAQNILKLVVSRSASLVVPD----DVQRSYSSESCSSPEIAFTRIFNNSSKELPGKTLDFHFDI 2297          
BLAST of Protein furry-like protein vs. Ensembl Medaka
Match: fryl (FRY like transcription coactivator [Source:NCBI gene;Acc:101159981])

HSP 1 Score: 848.581 bits (2191), Expect = 0.000e+0
Identity = 568/1677 (33.87%), Postives = 886/1677 (52.83%), Query Frame = 3
Query: 2955 NYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKEN-------NQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQS---------QGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSED---QLSQLITV-IDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            N  I    KPGE+VI++L   F  ++  K E+ +       + + ++  +D +   L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+ LHP  D +++ VL++AF+HFK+++     PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LK FVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LKN+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MS+ EL+ELL++L++H+DEELR ++   L  ++ + PEWR   +  +  F+ +E+TD  P  L+N +K+L  LI+ WK  L ++ K +       N++S +L++T    +L  VEG  LV+LC  R + RRL+V+VLKEV+  ++H  + +             P  +E       IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W    ++   +  L K C  AVN AW     R+  L   +D +  I   + +SL             N  D  + LW+NY+   C  A    S S         +  + + L S   SG + DS  +                   P+   L K  + +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  ++     + S L +V +++++L R  L++ ++      D    +L + R HF  L+  ++ +   + R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++   +I E A QLLQ+L  + F           +  +E+    ++ +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+D          +  +   S     ++     +  ++  L G GWGS +AT +VLNNL ++T ++G E + S +EN+W  L +    N+ +I+ +LI +  ++ + S L Y K+++V+L ++K  +LLE L   L+  D ++ ++    + P+YRI
Sbjct:    3 NITIDPDLKPGEFVIKSLFAEFAVLAEKKIEMVMAEPLEKPLSRSLQRGEDAQLDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQIPLHPVPDVLVHEVLNLAFKHFKHKEG-YCGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFITELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKTFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKNKDPKMSRVALESLYRLLWVYIIRIKCESNTVTQSRLLSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGIIMPSGNTLRVKKVFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDHILRHLDKEVGRSMSMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSRQELIELLAKLTIHMDEELRGLAFTTLQALMVDFPEWREDVLSGFAYFIVREVTDVHPTLLDNAVKMLLQLISQWKQALQSNNKSHESQQGSKNRRSVSLERTSPSAVLHVVEGLALVVLCSCRPATRRLAVNVLKEVR--VLHAALGI-------------PKGDE----ELAIDVMDRLSASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISFSSYLRQENLPKHCPTAVNYAWLFAFTRLQLLSPQVDLNSPINAKKVNSL-------------NSSDSYVGLWRNYLILCCSCASPSPSMSSSSSTSGSVRCPLPETLASTPDSGYSYDSKIVG-----------------APSPSSLFKHTVPMMRSESMDITESLVLGLGRTNPVAFRELIEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHTVSGGLENSSLNSVLLEYVDLTR-QLLEAEN------DKDSDMLKDIRCHFSALVANIIQNVSVKNRKSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVAAGCFRAIAHVFHNR-DYQFDTVVLLNLILFKAADSSREIYEVAMQLLQILEPKLF---------RYAHKLEIQRMDSILTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDL-------KPARRAEEVSSAEEEEEEQDVVMVNSRRWLRGEGWGSPRATTMVLNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLRIILQFLISMCGVSSDPSLLPYVKRVVVYLGRDKTMQLLEELMCELEMTDPVSSAITHMDNPPYYRI 1468          

HSP 2 Score: 197.593 bits (501), Expect = 2.175e-49
Identity = 173/606 (28.55%), Postives = 284/606 (46.86%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSN--H--HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS---------TVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            + +  + LI+ I++ +  P+W +EDV+     N GI + + +S                       S V  +  + ++  +    D  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLESGI  L      A S+ +          Y     L  S +   +   K    ++ T    G   LNSS   H  H R++++  S  S ++   RR  +L          GNL   +S          V       + ++L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R  LE + +   W + FPG + L +KG  S S   ++  LLSK++      L+DPT   GFP  +L LL   +  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL DA++E    L+ ++  +L +    M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  W+E   IL+L+VS+++SL +P     +     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1748 QEEKAKALIEFITSRKQGPLWNHEDVSPK---NPGIKSADHLS-----------------------SFVRRVVAVFQISQTGFQLDSLL----SEVALRTALSCSSRHYAGRSFQIFRALKQPLTSATLSDILSRLVETVGDPGEDAQGFVIELLLTLESGIDTL------AESVKN----------YDFLSALTQSSAQEHLLGAKFAVNRKST----GQLNLNSSGLPHAVHTRSNSLRTSLMSERKADRRRSNTLDIAERVGSSLGNLARTRSLSSLGGGASPVRDAAPPVDPSNLMATVFWIATSLLESDYEFEYLLALRLLNKLLGQMPLDRPDSRECLETVQEKLKWYN-FPGLLQLFVKGFTSASTQELTIHLLSKLITVSRQMLIDPTQVAGFPLNILCLLPHLIQHFDSPTPFCKETADKIAKVCADEKSATLSNLAHMMSLYSTHSYSRDCTNWINVVCRYLNDAFAEKILNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPHWREAQNILKLVVSRSASLVVPD----DVQRSYSSESCSSPEIAFTRIFNNSSKELPGKTLDFHFDI 2297          
BLAST of Protein furry-like protein vs. Ensembl Medaka
Match: fryl (FRY like transcription coactivator [Source:NCBI gene;Acc:101159981])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 568/1692 (33.57%), Postives = 886/1692 (52.36%), Query Frame = 3
Query: 2955 NYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKEN-------NQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQS---------QGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSED---QLSQLITV-IDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            N  I    KPGE+VI++L   F  ++  K E+ +       + + ++  +D +   L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+ LHP  D +++ VL++AF+HFK+++     PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LK FVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MS+ EL+ELL++L++H+DEELR ++   L  ++ + PEWR   +  +  F+ +E+TD  P  L+N +K+L  LI+ WK  L ++ K +       N++S +L++T    +L  VEG  LV+LC  R + RRL+V+VLKEV+  ++H  + +             P  +E       IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W    ++   +  L K C  AVN AW     R+  L   +D +  I   + +SL             N  D  + LW+NY+   C  A    S S         +  + + L S   SG + DS  +                   P+   L K  + +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  ++     + S L +V +++++L R  L++ ++      D    +L + R HF  L+  ++ +   + R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++   +I E A QLLQ+L  + F           +  +E+    ++ +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+D          +  +   S     ++     +  ++  L G GWGS +AT +VLNNL ++T ++G E + S +EN+W  L +    N+ +I+ +LI +  ++ + S L Y K+++V+L ++K  +LLE L   L+  D ++ ++    + P+YRI
Sbjct:  112 NITIDPDLKPGEFVIKSLFAEFAVLAEKKIEMVMAEPLEKPLSRSLQRGEDAQLDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQIPLHPVPDVLVHEVLNLAFKHFKHKEG-YCGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFITELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKTFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYIIRIKCESNTVTQSRLLSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGIIMPSGNTLRVKKVFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDHILRHLDKEVGRSMSMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSRQELIELLAKLTIHMDEELRGLAFTTLQALMVDFPEWREDVLSGFAYFIVREVTDVHPTLLDNAVKMLLQLISQWKQALQSNNKSHESQQGSKNRRSVSLERTSPSAVLHVVEGLALVVLCSCRPATRRLAVNVLKEVR--VLHAALGI-------------PKGDE----ELAIDVMDRLSASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISFSSYLRQENLPKHCPTAVNYAWLFAFTRLQLLSPQVDLNSPINAKKVNSL-------------NSSDSYVGLWRNYLILCCSCASPSPSMSSSSSTSGSVRCPLPETLASTPDSGYSYDSKIVG-----------------APSPSSLFKHTVPMMRSESMDITESLVLGLGRTNPVAFRELIEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHTVSGGLENSSLNSVLLEYVDLTR-QLLEAEN------DKDSDMLKDIRCHFSALVANIIQNVSVKNRKSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVAAGCFRAIAHVFHNR-DYQFDTVVLLNLILFKAADSSREIYEVAMQLLQILEPKLF---------RYAHKLEIQRMDSILTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDL-------KPARRAEEVSSAEEEEEEQDVVMVNSRRWLRGEGWGSPRATTMVLNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLRIILQFLISMCGVSSDPSLLPYVKRVVVYLGRDKTMQLLEELMCELEMTDPVSSAITHMDNPPYYRI 1592          

HSP 2 Score: 197.593 bits (501), Expect = 2.208e-49
Identity = 173/606 (28.55%), Postives = 284/606 (46.86%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSN--H--HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS---------TVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            + +  + LI+ I++ +  P+W +EDV+     N GI + + +S                       S V  +  + ++  +    D  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLESGI  L      A S+ +          Y     L  S +   +   K    ++ T    G   LNSS   H  H R++++  S  S ++   RR  +L          GNL   +S          V       + ++L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R  LE + +   W + FPG + L +KG  S S   ++  LLSK++      L+DPT   GFP  +L LL   +  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL DA++E    L+ ++  +L +    M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  W+E   IL+L+VS+++SL +P     +     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1872 QEEKAKALIEFITSRKQGPLWNHEDVSPK---NPGIKSADHLS-----------------------SFVRRVVAVFQISQTGFQLDSLL----SEVALRTALSCSSRHYAGRSFQIFRALKQPLTSATLSDILSRLVETVGDPGEDAQGFVIELLLTLESGIDTL------AESVKN----------YDFLSALTQSSAQEHLLGAKFAVNRKST----GQLNLNSSGLPHAVHTRSNSLRTSLMSERKADRRRSNTLDIAERVGSSLGNLARTRSLSSLGGGASPVRDAAPPVDPSNLMATVFWIATSLLESDYEFEYLLALRLLNKLLGQMPLDRPDSRECLETVQEKLKWYN-FPGLLQLFVKGFTSASTQELTIHLLSKLITVSRQMLIDPTQVAGFPLNILCLLPHLIQHFDSPTPFCKETADKIAKVCADEKSATLSNLAHMMSLYSTHSYSRDCTNWINVVCRYLNDAFAEKILNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPHWREAQNILKLVVSRSASLVVPD----DVQRSYSSESCSSPEIAFTRIFNNSSKELPGKTLDFHFDI 2421          
BLAST of Protein furry-like protein vs. Ensembl Medaka
Match: fryl (FRY like transcription coactivator [Source:NCBI gene;Acc:101159981])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 568/1692 (33.57%), Postives = 886/1692 (52.36%), Query Frame = 3
Query: 2955 NYYIKMSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLK---------------NRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKV--IIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKEN-------NQKSKALDKT----LLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAE-RTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQS---------QGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSED---QLSQLITV-IDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLM-TENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKS-LENIWGCLVNYRTDNMMVIIHYLIVITSLTPN-SFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRI 7895
            N  I    KPGE+VI++L   F  ++  K E+ +       + + ++  +D +   L+ ++++ AE+ LPSLL+ L DW+                                     S + +  +   P +++    D    D  ++ E+RD+ +D+IFC   + VLKQ+ LHP  D +++ VL++AF+HFK+++     PN   ++ IADLYAEV+GVLTQS+F  VR KF +ELK LR KE +    QS+ISL+MGMKFFRVKMYP+EDF   F F+ E A YF+EV DK IKHALAGLFVE+L+PVAA VKNEVN+P LK FVE LY T  D+ S+KKH +AL PLVTCLL + QKQFFL NW +F+  CLS LK               N+DP ++RVALESL+RLLWVYI+RIK E +T TQS+L SIV++LFPKGS+ VVPRD  +NIFVKII FIAQE+LDFAMKEII+DL+   +SHK   I PERMNIGL AF                            +V + S+         P        G   R+     NT                          TL D  A  +G+  Y   VRK+ D +LR LD++V R+M +T  +  NKE +D++TG                      ERKPKI+L +TC++AIPRLLP  MS+ EL+ELL++L++H+DEELR ++   L  ++ + PEWR   +  +  F+ +E+TD  P  L+N +K+L  LI+ WK  L ++ K +       N++S +L++T    +L  VEG  LV+LC  R + RRL+V+VLKEV+  ++H  + +             P  +E       IDV+D  +  +LE  +     ++   L     ID  TLAE  ++PI    S+ + + ++ +H  + +      + W    ++   +  L K C  AVN AW     R+  L   +D +  I   + +SL             N  D  + LW+NY+   C  A    S S         +  + + L S   SG + DS  +                   P+   L K  + +++ E  D+  S++  +G  NP + R+L++EL  I++E+++++ EN++RR+R+D LR+ +V+I ELLA  G+  ++     + S L +V +++++L R  L++ ++      D    +L + R HF  L+  ++ +   + R+++   ++ + S F++ +HW G F                  +    + + +   Y A+ AM +++CCGP+ D   L  DGY+  WL NI++S+D+K   L  E + LLL+ N +    +   +D CY  S       F +I   F+N  DY  D V ++ L L   ++   +I E A QLLQ+L  + F           +  +E+    ++ +P             S    L ++S  ++S  L+   P+LTL IFSE++QR+ TA+P  + ++L  L+PWM N+EL+D          +  +   S     ++     +  ++  L G GWGS +AT +VLNNL ++T ++G E + S +EN+W  L +    N+ +I+ +LI +  ++ + S L Y K+++V+L ++K  +LLE L   L+  D ++ ++    + P+YRI
Sbjct:  134 NITIDPDLKPGEFVIKSLFAEFAVLAEKKIEMVMAEPLEKPLSRSLQRGEDAQLDQLISSMSSVAEHCLPSLLRTLFDWYRRQ----------------------------------SGTEDESYEYRPRSSTKSKGDEQHRDKDYLLERRDLAIDFIFCLVSVEVLKQIPLHPVPDVLVHEVLNLAFKHFKHKEG-YCGPNTGNVHIIADLYAEVIGVLTQSKFQAVRKKFITELKELRQKEQSPHVVQSVISLIMGMKFFRVKMYPVEDFEASFQFMQECAQYFLEVKDKDIKHALAGLFVEILIPVAAAVKNEVNVPCLKTFVEMLYQTTFDLSSRKKHSLALYPLVTCLLCVSQKQFFLNNWHIFLQNCLSHLKMPSNNSIRKQIETLQNKDPKMSRVALESLYRLLWVYIIRIKCESNTVTQSRLLSIVSALFPKGSRSVVPRDTPLNIFVKIIQFIAQERLDFAMKEIIYDLLCVGKSHKTFTINPERMNIGLRAF----------------------------LVIADSLQQKDGEPPMPTTGIIMPSGNTLRVKKVFLNT--------------------------TLTDEEAKVIGMSLYYPQVRKALDHILRHLDKEVGRSMSMTSVQMSNKEPEDMITG----------------------ERKPKIDLFRTCVAAIPRLLPDGMSRQELIELLAKLTIHMDEELRGLAFTTLQALMVDFPEWREDVLSGFAYFIVREVTDVHPTLLDNAVKMLLQLISQWKQALQSNNKSHESQQGSKNRRSVSLERTSPSAVLHVVEGLALVVLCSCRPATRRLAVNVLKEVR--VLHAALGI-------------PKGDE----ELAIDVMDRLSASVLESFIHLTGADQTNLLYCPSGIDLQTLAEWSSSPI----SHQF-DVVSPSHIWVFAHVTQGQDPWVISFSSYLRQENLPKHCPTAVNYAWLFAFTRLQLLSPQVDLNSPINAKKVNSL-------------NSSDSYVGLWRNYLILCCSCASPSPSMSSSSSTSGSVRCPLPETLASTPDSGYSYDSKIVG-----------------APSPSSLFKHTVPMMRSESMDITESLVLGLGRTNPVAFRELIEELNPIIKEALERRPENMKRRRRRDILRVQLVRIFELLADAGVISHTVSGGLENSSLNSVLLEYVDLTR-QLLEAEN------DKDSDMLKDIRCHFSALVANIIQNVSVKNRKSIFPQQSLRHSLFMLFSHWAGPFSIMFTPLD----------RYSDRNMQINRHQYCALKAMSAVLCCGPVADNVGLSSDGYLYKWLDNILDSQDKKVHQLGCEAVMLLLELNPDQSNLMFWAVDRCYTGSRRVAAGCFRAIAHVFHNR-DYQFDTVVLLNLILFKAADSSREIYEVAMQLLQILEPKLF---------RYAHKLEIQRMDSILTP------------PSPLPHLYSVSYYQLSEELARTYPELTLPIFSEVSQRIQTAHPGGRQVMLHYLLPWMNNVELVDL-------KPARRAEEVSSAEEEEEEQDVVMVNSRRWLRGEGWGSPRATTMVLNNLMFMTAKYGDEFAWSEIENVWTTLADSWPKNLRIILQFLISMCGVSSDPSLLPYVKRVVVYLGRDKTMQLLEELMCELEMTDPVSSAITHMDNPPYYRI 1614          

HSP 2 Score: 197.208 bits (500), Expect = 2.491e-49
Identity = 173/606 (28.55%), Postives = 284/606 (46.86%), Query Frame = 3
Query: 8970 KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSN--H--HQRASAVIESTTSTKQPSPRRPASLK---------GNLKDNKS---------TVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLL---VSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRL------ELPGRILEYQFDV 10694
            + +  + LI+ I++ +  P+W +EDV+     N GI + + +S                       S V  +  + ++  +    D  L    +++AL T ++C+ RHYA RS QIFRAL        LS + SRL++T+GD  ED Q +V+EL LTLESGI  L      A S+ +          Y     L  S +   +   K    ++ T    G   LNSS   H  H R++++  S  S ++   RR  +L          GNL   +S          V       + ++L+  +FW+A  L+ES+ E E+   LR L+ L+  +     D R  LE + +   W + FPG + L +KG  S S   ++  LLSK++      L+DPT   GFP  +L LL   +  FD  T   +  A  IA +        L NL  +M LYS  ++++D T W   V +YL DA++E    L+ ++  +L +    M  ++LQ++ + + +I+++ +A V Q N  I  +   ++ +  W+E   IL+L+VS+++SL +P     +     S      PE    R+      ELPG+ L++ FD+
Sbjct: 1894 QEEKAKALIEFITSRKQGPLWNHEDVSPK---NPGIKSADHLS-----------------------SFVRRVVAVFQISQTGFQLDSLL----SEVALRTALSCSSRHYAGRSFQIFRALKQPLTSATLSDILSRLVETVGDPGEDAQGFVIELLLTLESGIDTL------AESVKN----------YDFLSALTQSSAQEHLLGAKFAVNRKST----GQLNLNSSGLPHAVHTRSNSLRTSLMSERKADRRRSNTLDIAERVGSSLGNLARTRSLSSLGGGASPVRDAAPPVDPSNLMATVFWIATSLLESDYEFEYLLALRLLNKLLGQMPLDRPDSRECLETVQEKLKWYN-FPGLLQLFVKGFTSASTQELTIHLLSKLITVSRQMLIDPTQVAGFPLNILCLLPHLIQHFDSPTPFCKETADKIAKVCADEKSATLSNLAHMMSLYSTHSYSRDCTNWINVVCRYLNDAFAEKILNLVTYLAELLEKGLPSMQQSLLQIIYSLLSHIDLS-AAPVKQFNLEIMKIIGKYVQSPHWREAQNILKLVVSRSASLVVPD----DVQRSYSSESCSSPEIAFTRIFNNSSKELPGKTLDFHFDI 2443          
BLAST of Protein furry-like protein vs. Planmine SMEST
Match: SMESG000041948.1 (SMESG000041948.1)

HSP 1 Score: 4979.46 bits (12915), Expect = 0.000e+0
Identity = 2587/2589 (99.92%), Postives = 2589/2589 (100.00%), Query Frame = 3
Query: 2970 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERXXXXXXXXXXXXXXXKESLVFXXXXXXXXXXXXXXXPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRXXXXXXXXXXXXXIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK 10736
            MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTN+WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIE+MGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYTSISNSNSSDSITQSRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRINNTTNNSNVTSQTKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERDLELLLHCIILGLDHKESLVFQQCKILLIKILQILCPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRTLSSYSVTSTVTLIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIESSVLLSLPMVPLPEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK
Sbjct:    1 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNIWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIESMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYTSISNSNSSDSITQSRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRINNTTNNSNVTSQTKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERDLELLLHCIILGLDHKESLVFQQCKILLIKILQILCPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRTLSSYSVTSTVTLIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIESSVLLSLPMVPLPEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK 2589          

HSP 2 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 2
Query: 11684 CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM 12922
            CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM
Sbjct: 2905 CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM 3317          

HSP 3 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 284/284 (100.00%), Postives = 284/284 (100.00%), Query Frame = 1
Query: 10735 KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPSKKLWEQVIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK 11586
            KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPSKKLWEQVIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK
Sbjct: 2589 KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPSKKLWEQVIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK 2872          
BLAST of Protein furry-like protein vs. Planmine SMEST
Match: SMESG000041948.1 (SMESG000041948.1)

HSP 1 Score: 4979.08 bits (12914), Expect = 0.000e+0
Identity = 2587/2589 (99.92%), Postives = 2589/2589 (100.00%), Query Frame = 3
Query: 2970 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYXXXXXXXXXXXXXXXRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRIXXXXXXXXXXXXXKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERXXXXXXXXXXXXXXXKESLVFXXXXXXXXXXXXXXXPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRXXXXXXXXXXXXXIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIEXXXXXXXXXXXXXEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK 10736
            MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTN+WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIE+MGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYTSISNSNSSDSITQSRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRINNTTNNSNVTSQTKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERDLELLLHCIILGLDHKESLVFQQCKILLIKILQILCPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRTLSSYSVTSTVTLIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIESSVLLSLPMVPLPEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK
Sbjct:    1 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNIWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIESMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYTSISNSNSSDSITQSRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLTVRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQIIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRINNTTNNSNVTSQTKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTLDGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYATLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFLNEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERDLELLLHCIILGLDHKESLVFQQCKILLIKILQILCPDITEFKIINLLMTGSTTMPTKSLLCLNGGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRTLSSYSVTSTVTLIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQSKNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTDNNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNTGVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCYVVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSSPKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRRPASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAGLRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQSFWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRLAAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDAYSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLNKIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIESSVLLSLPMVPLPEAETPRLELPGRILEYQFDVKNYCMKNSETVDSK 2589          

HSP 2 Score: 846.269 bits (2185), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 2
Query: 11684 CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM 12922
            CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM
Sbjct: 2899 CRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLTRALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCSKCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYISADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIKPDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDFVKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVVEDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLVYVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLISPIDTEQSVVHITSDSSVM 3311          

HSP 3 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 278/284 (97.89%), Postives = 278/284 (97.89%), Query Frame = 1
Query: 10735 KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPSKKLWEQVIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK 11586
            KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPS      VIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK
Sbjct: 2589 KNNEHQDDLTMGNKKNKTKELLLQLINYFGTYGYRIGFPKSPS------VIFSQSTETLEHQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKMNFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTFAEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTVTKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNHSNEKIKVKNNSLSSEEETDWKREK 2866          
BLAST of Protein furry-like protein vs. Planmine SMEST
Match: SMESG000041948.1 (SMESG000041948.1)

HSP 1 Score: 2853.16 bits (7395), Expect = 0.000e+0
Identity = 1456/1458 (99.86%), Postives = 1458/1458 (100.00%), Query Frame = 3
Query: 2970 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 7343
            MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTN+WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIE+MGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS
Sbjct:    1 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNIWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIESMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 1458          
BLAST of Protein furry-like protein vs. Planmine SMEST
Match: SMESG000041948.1 (SMESG000041948.1)

HSP 1 Score: 2825.81 bits (7324), Expect = 0.000e+0
Identity = 1443/1445 (99.86%), Postives = 1445/1445 (100.00%), Query Frame = 3
Query: 3009 MKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 7343
            MKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTN+WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIE+MGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS
Sbjct:    1 MKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNIWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIESMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 1445          
BLAST of Protein furry-like protein vs. Planmine SMEST
Match: SMESG000041948.1 (SMESG000041948.1)

HSP 1 Score: 2797.31 bits (7250), Expect = 0.000e+0
Identity = 1434/1458 (98.35%), Postives = 1436/1458 (98.49%), Query Frame = 3
Query: 2970 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQXXXXXXXXXXXXXXPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDAERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLXXXXXXXXXXXXXXMKPTXXXXXXXXXXXXXCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVXXXXXXXXXXXXXXTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAXXXXXXXXXRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 7343
            MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMT                      AERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTN+WSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIE+MGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS
Sbjct:    1 MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQNLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPDVCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGVDYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLLINEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISLLMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEVLLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLSIGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKGEKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFAMKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKSNSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPEWNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLRLLDQQVIRTMLLTKQENINKEFDDVMT----------------------AERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAWKNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLKEVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKILERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHGSLNSESHLSTNIWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFNIIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVAPLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKPTSKDLLKILISLIKCEVSDLRNSVIESMGHFNPSSLRDLMDELQIILRESVDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDWLELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQNLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTDDLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALCEETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDYPCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNSINVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLPDLTLSIFS 1436          
The following BLAST results are available for this feature:
BLAST of Protein furry-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FRYL0.000e+035.23FRY like transcription coactivator [Source:HGNC Sy... [more]
FRYL6.187e-4934.99FRY like transcription coactivator [Source:HGNC Sy... [more]
FRY2.839e-3932.17FRY microtubule binding protein [Source:HGNC Symbo... [more]
FRY2.184e-3932.17FRY microtubule binding protein [Source:HGNC Symbo... [more]
FRY2.121e-3932.15FRY microtubule binding protein [Source:HGNC Symbo... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sax-21.092e-12639.61Sensory AXon guidance [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fry9.619e-16943.93gene:FBgn0016081 transcript:FBtr0333858[more]
fry9.726e-16943.93gene:FBgn0016081 transcript:FBtr0306241[more]
fry1.126e-16843.93gene:FBgn0016081 transcript:FBtr0306242[more]
fry1.173e-16843.93gene:FBgn0016081 transcript:FBtr0301435[more]
fry1.186e-16843.93gene:FBgn0016081 transcript:FBtr0076417[more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fryl3.476e-5333.77furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-0409... [more]
frya3.533e-4133.83furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
frya3.438e-4133.83furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
frya5.090e-4133.99furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
frya3.997e-4133.79furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FRYL5.939e-4834.70FRY like transcription coactivator [Source:NCBI ge... [more]
FRYL4.863e-4834.70FRY like transcription coactivator [Source:NCBI ge... [more]
FRYL4.914e-4834.40FRY like transcription coactivator [Source:NCBI ge... [more]
FRYL5.640e-4834.44FRY like transcription coactivator [Source:NCBI ge... [more]
FRYL5.266e-4834.40FRY like transcription coactivator [Source:NCBI ge... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fryl2.599e-4834.69FRY like transcription coactivator [Source:MGI Sym... [more]
Fryl2.599e-4834.69FRY like transcription coactivator [Source:MGI Sym... [more]
Fry4.391e-4131.70FRY microtubule binding protein [Source:MGI Symbol... [more]
Fry4.817e-4131.81FRY microtubule binding protein [Source:MGI Symbol... [more]
Fryl3.709e-6761.96FRY like transcription coactivator [Source:MGI Sym... [more]
back to top
BLAST of Protein furry-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O94915|FRYL_HUMAN2.971e-4834.99Protein furry homolog-like OS=Homo sapiens OX=9606... [more]
sp|Q5TBA9|FRY_HUMAN1.031e-3832.17Protein furry homolog OS=Homo sapiens OX=9606 GN=F... [more]
sp|E9Q8I9|FRY_MOUSE3.369e-4031.81Protein furry homolog OS=Mus musculus OX=10090 GN=... [more]
sp|Q9VT28|FRY_DROME1.189e-16743.93Protein furry OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q9HDV6|MOR2_SCHPO3.532e-1923.96Cell polarity protein mor2 OS=Schizosaccharomyces ... [more]
back to top
BLAST of Protein furry-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D8KD341.639e-5436.89Furry OS=Lymnaea stagnalis OX=6523 GN=fry PE=2 SV=... [more]
A0A1D8KD361.625e-5436.89Furry OS=Lymnaea stagnalis OX=6523 GN=fry PE=2 SV=... [more]
A0A210PPR89.746e-6035.29Protein furry-like OS=Mizuhopecten yessoensis OX=6... [more]
A0A2T7PMZ17.108e-5536.16Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A0P5YX111.239e-5436.48Furry OS=Daphnia magna OX=35525 PE=4 SV=1[more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fryb1.157e-4333.65furry homolog b (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
fryl1.302e-5233.03furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-0409... [more]
frya2.216e-4332.61furry homolog a (Drosophila) [Source:ZFIN;Acc:ZDB-... [more]
fryl7.039e-12168.63furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-0409... [more]
fryl7.566e-11865.42furry homolog, like [Source:ZFIN;Acc:ZDB-GENE-0409... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005308.10.000e+033.37pep scaffold:Pmarinus_7.0:GL476613:2313:60678:-1 g... [more]
ENSPMAT00000000710.17.228e-2826.45pep scaffold:Pmarinus_7.0:GL477180:48772:90158:-1 ... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAO34.459e-1523.17Component of the RAM signaling network; is involve... [more]
back to top
BLAST of Protein furry-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein furry-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fryl2.702e-4933.87FRY like transcription coactivator [Source:NCBI ge... [more]
fryl2.322e-4933.87FRY like transcription coactivator [Source:NCBI ge... [more]
fryl2.175e-4933.87FRY like transcription coactivator [Source:NCBI ge... [more]
fryl2.208e-4933.57FRY like transcription coactivator [Source:NCBI ge... [more]
fryl2.491e-4933.57FRY like transcription coactivator [Source:NCBI ge... [more]
back to top
BLAST of Protein furry-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041948.10.000e+099.92SMESG000041948.1[more]
SMESG000041948.10.000e+099.92SMESG000041948.1[more]
SMESG000041948.10.000e+099.86SMESG000041948.1[more]
SMESG000041948.10.000e+099.86SMESG000041948.1[more]
SMESG000041948.10.000e+098.35SMESG000041948.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010898 ID=SMED30010898|Name=Protein furry-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=13143bp
TAACGCATTTGTAATTTAATTAAAGTTTAGTAAAATTAATTAAAGATTAA
AAATATAAAAAATTTATGTATATACCAAATTTTTTTCATTTATTATGTTT
TTTATCAAGGGCTTATCTTATTATTAATATTTAATGATTTTTAATTTTTT
CATCTTTGAACTTTTAATTTCCTCCATCTTCATTTTTAAAATTATATAAA
ATTATAAAGTTGCCACAATTAAAAATTTATGAGACACTGCCAAAAACTTG
TGTTACATGCGGAAATTAATTTTTTTGATCTTGATATCTATATGAATGAT
TGTTTTAAATTAATGATGGTACTTCGTTTTAATTTATGTTAATTATATAT
TTAAAAATAAAATATAACATGGTATCACGAGCAGGGTACTTAAGAAATTT
GATTTTAATTGAAAAATTTCAAATCTCGGAAAATATCAAAAAATTGGCCA
GATAAATATATAAGAACATTTAAAAAAAACAATGAAAACTATTCATCTGG
AACCAACATAAAATGATTTAAAAATCGATTTTTGTAGAAGTTCGTTCAAT
GAGAAAATACTAAACTGAATAGAATGTATTGAAGAAGAACGAGTAAAGAA
TTAGAATATGCTTGAAAAAAGTAAGAAAAATTCAGAGAATTCGAAATTTA
ATGAATGTTGCTCAAGAAAATTGTGAGAAAATAGTAGTTTTTGCTACTAG
GGTAAAAGTTGAAATAAAATTAAAAATTGAAGATAAGCAAATAGAGTGTG
CCTTTTCCCGGATTTTTTCTGTTCCCAGGAAACGGGAATATTAAAAAAAA
ATACCGGGTATATCGGGAACAGAAAAAACCCGTGAAAATTCTTCCTGGAG
AAAAAGTTATAATTTTAAAATAAAAAATCATATTTTTAACTAAAATTTTA
AAATAATATTTTATTCAATAAATAAATACATATTAATTGTATTTATTTAA
ATTTATTGGTTTAAAAAACAAGTTTTTAAAAAACACAGACAATCAAGCGA
GTGGTTGTTAACGAAGTTCTTTTTATTGTACAAAGATTTGACGACGCAGA
GAACACCTTTTCACTTTCGACCGAGTTGGTCTGTATCGTCATTAATGCAT
CCATCAAATCTTGCAAATTTTTTGTTATATTTTTTGTACAACTGTATATT
TGAAATCCTTGTTTTAAATTTTTTGTTCGAGTACCTACAAATTTTTCTTC
ACACCTTTTAGTTTTTAATGCTACATTTATGGCACCATTTAGTCTTTCAT
ATATATCTGGAACTAAACAGTTTTGAGCGCAGATGAATGTTCTTCACAAA
GTATATCTTCATCAACACCAGCGCCTTCATTTTCTTTTTCGAATAACCGT
ATAAATATTTCGTTAGCACATAGAATAATTGTAGCTATTGATGATGAAGG
CAAGCCCAGTGTAGATTGTAAATCTAGTGCTTGAAGATACTTAATAAAAG
TTACAAGATGTTGATTTCTCCGTTCTTTAATACGAATTATTAGAACGTTC
AACAACTCTTTTGAGATATTATTATTGTTTTCATGCAAAGAATCAAATAC
AAATTTCAAAATCGCATCGGCTGTTACAAGATTTGCATCCCCTGTACCTA
ATGCTTCAACAGCTAATTTAACGGGCTGAATTGCGTTGTAAATATTTGAC
AATATTGAAATGTTATTTTCGTTCAGTAGAGTAGTTGAACCTAATACATT
CAATGCCTTCCGAACTGAGTCAATAATTTTTAAAAATCTTTCTATCATGG
TGACAATGCTGTTCCATCTTGTCTTACAATCTAAAAGCAAACTCAGTTGT
ATCCCATGCTTTTCCTTGACATGTTCTTAAAGTATGGAATTTCGTTTTGG
TGATCTTTTAAAAATTTTTACAATATTTCTTATCATTTGCAATGCTTTAC
TAATACTATAACGTTCACGATTTTGGGTTCTAGCATCGTTTGGTTCAACA
TCATCATCAGAGGCATAAAGTTCATCGGAAATCGAGCTATATTCATTTTC
ACCAGTTTTCACTTTGATCATCATCATTTACAATATCATTTTCCACTTGT
TATAAATTACATCAATAACAGCTAAATGTATGCTATGATTATAAAAAACT
GGTGGATATATTCAGATAATATTTCTAATCTTACCATGACAGAAGCACCA
CCTGTGGTCGACGCGACTAGATAAATTGATACCAAAATCTGCTAGCTTTT
AATTCACCAATTCGTCTGTTTTTTCAGATGTACAACTTCCTTCAATTGCC
ACTAATCTTAAGTTTATATATTTAGTATCAAAATGAACATTTATATTGAG
GTAGCGCCGGTTTCGTAAACTAGTTCATTCATCTAATGTAAGACTGAATT
TACCACAAAGATATTTATGCAATTGAATTTTTGCTACCACCTCACTTTTT
GCAGATTTAGAAAAGTCATGAATTAATTTCATTACTTTAGTTTTACCCTT
AAGTGTTTGGCGAATAAATTCGCTTTTGAAAATTCCATGGATTGAAAATC
CATCAACAGCCGCAAGTCGTGTCACAATTCGTGTCATTGATTGCTTTCCA
GTAAAGAATGATGATTCGGTAAGATTCGTTCTTAGATATTATTGAAAGTT
TTTCTACGTTGCATGGACCAGCATCTTGATCGTCAACTGAATCTCGTTTC
AACAGATTAATTTTATGAACATGTTGCAAATGTCTTATTAGGCCACTAGT
TGACGATCCTTTGCAACTTAACCATTTATTTTGGACATTTCAAACATTTA
GCTCTTTCGCCTCCTTTCTTTTGTAAAATATTTCCACACAGAATCCGGCA
TCGGGGATATTTTATATTTATTTTGATCTACAAATAAAATAACAGAAAAA
CTGTTATTTAAAGTTTTAAAGAAAATTTTTTAAAAATTAAAATATTAATT
CATATATAATTTATTTTAAAGAGATTCTTTTATATTTTTAAATACATTTT
AATAAATTATTATATTAAAATGTCTCACAAACCTGGGGAGTATGTTATTG
AGAATCTAATGAAATCATTTATCAAAATTTCTTTCAATAAGACTGAATTA
TTTGTTAAAAATGAGAAAGTATTATCTATTCGTAAAGGAATGAGATATAA
TGATGACTGTGAATTTCAAAATCTTCTGTTAGCATTAAATGCTTGTGCCG
AAAATTCCCTGCCGTCATTATTAAAAGCTTTATTAGATTGGCATAACAAC
AACTATAGTCATGGTTTATTCACAAAACCAGCAAATGTTCGAAAATGTGA
TAAAATTAAACTGCCAGACGTTTGTGCGACATCGGATATAACTAATACAG
ACATGAGTGCTAGTACCAATTCGTATTTCGCTTCCGAACCTATGGCAACC
AGTAATCAAATGTCAGATTCTACTACTACTGACAACATACATATATCTGA
AAAACGAGATATCGGAGTTGATTACATATTTTGCCAATCGATAATATCAG
TATTAAAACAATTGTCACTTCATCCAGGTCACGACGAAATGTTGAATGTG
GTTCTATCAATGGCATTTCAACACTTCAAATATCGGGATGATCTCATGGC
CAATCCAAACCATTTATTAATTAATGAAATCGCCGATTTATACGCAGAGG
TTGTCGGTGTGTTGACACAGAGCCGATTTAATCTTGTTCGAATGAAATTC
ACCAGTGAACTTAAATCATTACGCAATAAAGAAGCAAATTCATCGGGATT
TCAGAGTATTATATCTTTACTGATGGGAATGAAGTTTTTTCGCGTCAAAA
TGTATCCCATTGAAGATTTTGTCGACTGCTTCAATTTTCTGACAGAATTG
GCCAATTATTTCATTGAAGTAGATGATAAAAAAATCAAGCACGCATTGGC
CGGACTATTCGTTGAAGTCCTTCTGCCGGTTGCTGCGGTTGTAAAAAACG
AAGTTAATATTCCGGTTTTGAAAAATTTTGTCGAATTTCTCTACAATACT
TGCTCGGATATGTGCTCGAAAAAGAAACATTTTATTGCGTTATCTCCTCT
AGTCACTTGCCTATTATCAATCGGACAGAAACAGTTTTTCCTCGTTAACT
GGCCAGTTTTTATGTTAGCATGTCTCAGTCAGTTAAAAAATCGAGATCCA
AATATTGCCAGAGTTGCATTGGAATCATTGTTCAGATTATTATGGGTCTA
TATAGTTCGAATTAAAGGGGAAAAACACACTGATACACAAAGCAAATTGC
ACAGTATTGTTAATAGTTTATTCCCAAAAGGCTCGAAATTTGTTGTTCCA
CGAGATGCTTCAATTAATATATTTGTAAAAATTATACATTTCATTGCACA
AGAAAAATTAGATTTTGCTATGAAAGAAATTATATTTGATCTCATTGGAG
CAAATCGTAGTCATAAGGTCATCATTCCTGAACGAATGAATATCGGTTTA
TGTGCTTTCTTATTAATTGCACTTAGTTTACAACAGAAGGAAGGTGAACC
ACCCATGCCTCAAAAGTCGAATTCTGAATCTAATCACCCATCAATAGTTT
GTTCTCAATCCATGGATAATAACCAAGCAACAAAATCATCACCTTATCAT
TCTTCACAGGCATCGGGTGGTCGACTTTCGAGATTATCCATTAATAAATT
TAATACCTCAACTCCAGAATGGAACTCACAATCTATCCAATCAAAACCAT
TTCCAGGCAAAAGGAAAACCAGCTATTCATTTATGACTCTTAATGATGCA
AATGCTGCATCTCTTGGCATAAAGGATTATATTAATCCTGTTCGAAAATC
ATTTGATACAATGCTAAGACTTCTTGATCAACAAGTTATTAGAACAATGT
TACTAACAAAGCAAGAAAATATTAACAAAGAATTTGATGATGTTATGACT
GGTCAATCAATTGGAGTGGCATCTGGGTCATTATATCGGAAATCTAAAAG
AAATTCCGTAATCGATGCTGAACGAAAACCGAAAATAGAATTACTTAAAA
CTTGTATTTCCGCTATCCCTCGTCTATTGCCAGCAGAAATGAGTAAATCT
GAACTAGTAGAACTTCTTTCAAGACTCAGTATGCATATAGATGAAGAATT
AAGAATGATGTCACAACAAGCTTTAATTAATATAATCCAAGAATTACCGG
AATGGCGATTCAAGACCATTCAAACATATTTACAATTTGTCCGAAAAGAG
ATTACTGACAGTTCTCCACTGCAATTGGAAAACAACATGAAGATTTTATA
CCATTTGATAAATGCTTGGAAAAATACGTTGATAGCATCCACAAAAGAAA
ATAATCAAAAATCAAAAGCACTTGATAAAACATTGTTGGATGACGTGGAA
GGATTTTGTTTGGTAATGTTATGTCAGTACAGGAGCTCAATTAGACGATT
GTCAGTTCATGTATTGAAAGAAGTAAAATCTCTGATTATCCATATTAATA
TGGATCTTAAATTAAACACATCATCCATTAATGTTTCCCAAGAATCTCCA
AATAGTAATGAAACAAATAAAACTTCGTTTGTCATTGATGTCATTGATTA
TGCTGCTCTGAAAATTCTAGAGAGATGTCTGCCGTTTCTACCAAACAATG
AAAAGGCACATTTAACGATGATGCAAAATATCGACTTTATGACACTGGCA
GAACGAACAAATCCAATCTGGGGTGTAGTTTCAAATACTTATTCAAACAA
TATTAATGACAATCATGGCTCATTGAATTCTGAATCTCATTTATCAACTA
ACCTATGGAGTGAATGCATTGCGACAATATTCAATCGAACATTTCTAATG
AAATCCTGTCAAAATGCAGTTAATAATGCTTGGACAACTCTCATGGATCG
AATAAATCATTTATTTAACATTATTGATCCTAGTGTTCAAATTGCTGAAA
ATCGAACTAGTTCACTTTTAAGAGGTGGCAGTAGTAATAAAAAACCACTG
ACTAGCAATGAAAGAGATCATTGCATGCTTCTATGGAAAAATTATATAAC
AGCTGCTTGTTGCGTTGCTCCTCTTTATATTTCACAATCACAAGGAACGG
TAGGAAAATATCTCAAATCACCAGATCAAAGTGGATCAACTATTGATAGT
TCTCAAATCAAAAATCTTTCGTCAAATAATTCTGCATCCGTAGCTGCATC
ATGTTCTGTAATGAAACCGACCAGCAAGGACCTATTAAAAATTCTCATTT
CATTGATCAAATGTGAAGTATCCGATTTGCGTAATTCTGTTATTGAAGCA
ATGGGACATTTCAATCCAAGTTCATTGAGAGATTTGATGGATGAATTGCA
GATCATTCTCCGAGAATCAGTTGATAAGAAACAAGAAAATGTCAGAAGAA
GAAAACGAAAAGATAGTTTGCGGTTGTATATAGTTAAAATTTTAGAGTTA
CTTGCTTATAACGGCATTTTTGATTACAGCGAAGATCAACTTAGTCAATT
AATCACAGTGATTGATTGGCTTGAACTTCTAAGACCCTACCTGATTCAGG
GTGATTCTGGAGTAAATTTATCAGCCGATATTTCCTTATCAATTTTGAAC
GAGACACGATTGCATTTTTGTAGATTAATTCAGTATCTTGTTCTTCATGC
TCCAAAGGAAAAAAGACAAAATCTTATGACAGAAAATTTTAAGCAAAGTT
TTTTCCTCATGATTGCTCATTGGACTGGGAATTTTGTTAAACCTTTATTA
AAAAAGAAAATAATAAAATCTATTGAGTTGACTAACTGTAAAGTTGAGAG
TGCTGACAAGAAAACCGATGATCTCTGCTATGCTGCTATTACTGCAATGT
GCTCCTTAATATGCTGTGGTCCTATATTTGACCCTCAAGCTCTCCAAGAA
GATGGTTATATTTTACCATGGCTGTTAAACATTATAAATTCTAAAGATGA
AAAATTTATGGCTCTTTGTGAAGAAACGATTACATTGCTATTAGATTACA
ACTCCGAAACTCATACATTTCTAGATGTTATGATTGATTGTTGCTACATG
GCATCTAATTCTACAATGAAAATTGTATTTTTATCTATTGTAAGGACGTT
TAATAACTATCCTGATTATCCATGTGATTATGTTTCAATGATCACTCTTG
CTCTCGCTTTCACATCTAACATCGATACGCAAATTAAAGAAAATGCATAT
CAACTGCTTCAGTTACTTTATTATCGGTTCTTTATTGATTCGTCATTTGT
GTGGTCAGAAAATAATTCAATAAATGTTGAATTAAATTCTGATCAAAATG
TTTCTTCACCGATTGCCAATAATGGTACAAGCACAAAGATATCCATGATT
TCCCGATGGGAACAACTTTCAACATTGAGTCAAGATGAGATATCAAGAGC
ATTGTCTGAAATGCTACCAGACCTAACATTATCTATATTTTCAGAAATAA
CACAAAGGGTTTTGACTGCTAATCCAAATTTGCAATTAATTTTATTGAGT
TGCCTTGTTCCGTGGATGTATAACATTGAATTAATTGATTTCATTTACAC
ATCTATTTCCAATTCAAATTCAAGCGACTCAATTACCCAATCACGCGTAT
CGCGGACCAAGCAATATTCTTCATCCCCTATTCCATTTAATAAAATTGGT
CTCACAGGAAATGGATGGGGCTCAAAACAGGCCACAGATTTAGTTCTTAA
TAATTTATTTTATCTAACGGTTCGATTTGGTCAAGAATTAAGCAAAAGCT
TAGAGAATATTTGGGGTTGTTTGGTTAATTATAGAACAGACAATATGATG
GTGATAATTCACTATTTAATAGTGATTACATCGTTGACTCCGAATTCATT
TCTTTCATATGCAAAACAAATTATTGTGTTTCTTTCTAAAGAAAAACCAA
AGAAATTGTTAGAAAATCTTTTTTCGATTTTACAAACAGTTGATGGCATT
AATTATTCAGTTGAACGAACGCAATCATTACCCTTTTATCGTATTAACAA
TACAACGAACAATAGTAATGTTACTTCACAAACAAAGTTAAATAATAAAC
CAAATTCGAATACGTCAACTCAAATTATGGAAACAAATATAAATTTAAGT
ACTCATGATAAAGGGGTTATGAATGGAAGTCAACAATTACCTGTTGCTTC
TGTCAGGTCTTCAACGCTTGATGGATTGCAAATATCCAATAAATCTCAAT
CAGAAATTATTGATATTGATGAAGTTTCTGTCACAAATTATCCACAAAGC
GCACCCGGAACCCTAAGATTTGATGGTTTAGACACCACATCAATTGTTAT
CGATGAAGACAAGTATGCCACTCTTAGAGCCAAGGATTTGCGTAAAAAAG
AAGTATTTAATAAGCAACCTATCAACATTACTAAAACAAAAGATTTATCA
CCGAGCAATATTCATCCATTACCATTACCAGCATATGGAGGGTTTTCAGC
TCCATTAAATCAATTCTTAAACGAGGACCAGTGTCCTTTGTGGACACATG
GTTATAAAAGCAGCATTGTTTTGATGTTTTTCATCGATATTGTACCTATT
GCCAATACTCGATCCTTTTGGGAACGCGATTTAGAATTATTGCTTCATTG
TATTATATTAGGATTGGATCATAAAGAATCATTAGTATTTCAACAATGCA
AAATCTTGTTGATAAAGATTTTACAGATTCTTTGTCCTGATATAACCGAA
TTTAAAATAATTAATTTACTAATGACCGGTTCGACTACTATGCCCACTAA
ATCTCTTCTCTGTTTAAATGGAGGTGCTTGTCAGTCAATGGTACGAATGC
AAACATGTGACCGTGGATCTAATTGGAACAATATATTTTTTGATGAACCA
GTGAAAACCTCAGAGACTACCAATTTAAATATTACTAACGATGTTGATAC
GAAGTTACAGAGAACATTGTCAAGTTACAGTGTTACTAGTACAGTGACTT
TGATACCATCTGCCAAGGTTTCCACTTCCCAATCGAAACCCAATTCTTGC
ATAATTGAAAACATAGAAACACCAAATGAGCACGATGTCGAAATAATGAG
AAATATCGGTAGACAATCAAAAAACAAAAGTGTTCGGGAATTAATTAAAA
TTATTTCAACATATCGTGATCGGCCTATGTGGGGCTATGAAGACGTAACA
ATTAGTCGCTATATCAACGACGGTATATCTACCATTAATCAAATATCAAA
CAGTAGAGCATCAACTGATAACAATAAATTTCCCAATAGCCGAGAGGACG
ATGAATTGATACTTATTTCTAGCGTAGCGGTTCTGAACACAATTATAAAA
TTAATTTGTAGTTTGATTGATGCCGATGGAACTCTGGTTATAAAATGGGC
TCAACTTGCACTTAATACCGGAGTTAACTGTACTCATAGACATTATGCGA
GCAGATCATTGCAGATATTCAGAGCTTTAGGTACCACATTTGATGGTACG
AAGCTTTCAGCGCTGTATTCTAGATTGCTAGATACGATTGGTGACCTCAA
TGAAGATGTTCAGTGTTATGTAGTTGAATTGTTTCTAACTTTGGAGTCTG
GTATTAAAAATCTTAATCCTCAAGAAATGTTTGCGAATAGTTTAGATGAT
AATTGTTCTGATACAGATGAGGATGATCTGTATCGTTCTACTCCAAATCT
TAAAAATTCATTCTCATCCCCTAAAATAGGATATCATAAAGATATTTCTA
GACAACGTGGAACAACTGTCGGTGGAGGATTTAGAATTTTGAATTCATCA
AATCATCATCAAAGAGCAAGTGCTGTTATAGAATCCACGACATCTACGAA
ACAGCCATCTCCTAGACGACCAGCTAGCTTAAAGGGAAATCTAAAAGATA
ATAAATCAACCGTTTCTTCAAATTTATCATGGGATGAAAGAACTGATTTA
GTTTGTGAAATATTTTGGCTTGCAAATATATTGATGGAATCTGAATTGGA
GCACGAATTTTATGCAGGACTTCGTTTCCTCAGTTTGTTAATGAACTGTT
TGAATAGTTCCCATTTTGACATGCGATCAAAGTTGGAGAAAATTGTTCAA
TTTTGTAATTGGGGCTCATTATTTCCCGGTACAATTCATTTATTAATAAA
GGGATGCTTTAGTCAATCATTTTGGCCAATATCAGCTCAATTATTATCAA
AAATGGTGGTCAATGTTAATTGTTCTTTGGTTGATCCAACTTTGAAAGTT
GGATTTCCATTCACAGTTCTTACATTACTTGTGTCAATATTTGACGAGGA
AACGCAGAATAGTCGTCTCGCCGCAAAAAATATTGCTAGTATTGCTAAAA
TACTCTCACCAGATCGTTTGGGGAATTTGATATTGGTAATGCAGCTTTAT
AGTGGTGGGACATTTAATAAAGATCATACACAATGGACTCGGTGCGTTGT
CAAGTATTTATATGATGCTTATTCAGAGATAAGTGCAGAATTATTAGCTT
TCATCAATAGAATGTTGCTAGAATGTCCATCATTTATGCATAGTGCTATA
TTGCAGGTTTTAGGCAATTTCATTTATTATATCAATATGAATGAGTCTGC
AATCGTTTATCAACTTAATAAAATAATAGAAAGCCTTAGTCAATTATTCA
TAAATAATGTTCAATGGAAAGAAGTTTATCCTATTTTACGATTATTAGTG
TCTAAGAATTCCAGTCTCAGTTTACCGACTAGTAAAGTTATTGAAAGTTC
TGTTCTACTTAGTTTACCAATGGTACCACTGCCGGAAGCCGAAACTCCGC
GTTTAGAATTACCCGGCAGGATACTTGAGTACCAATTTGATGTCAAAAAT
TATTGTATGAAAAATTCTGAAACTGTAGACTCAAAAAAATAATGAACACC
AAGATGATTTGACAATGGGAAACAAAAAGAATAAAACGAAAGAATTATTG
TTACAACTCATTAATTATTTTGGTACTTACGGCTATCGAATTGGTTTCCC
CAAAAGTCCATCGAAAAAGTTATGGGAACAGGTTATTTTTAGTCAATCAA
CTGAAACTTTAGAACATCAAGTTAGTCTTCATTCAAGCAGTGAAACTACT
AGTACTAATGACATTAGTTTAGCGGATGATTTGCGTTTGGATGAAACAAG
TAGTGTTGAGCAAGCTCAGGTTTTTCGCGATCTTGATGAATATTTGGATT
CTCAATTGAAAATGAACTTTCTTGATTTACCTGATAATAAATGGGAAGAT
GATAGGAAACCGTCTTGGGGAGTTCGTAGTCAATCCATTACGCATTATAA
TGAATTTTCCGAATCAATTAATCAAAATCAGTCAACGAATAAAATTCAAA
ATTCATCAACGTTTGCTGAAGGTACAGAAAATTCTCCTAATTTTATCCCA
TCACCTTCTAAAACCCTTCCCTGTCGAAGCCATAAATCGCCCATAAGTAA
AGCCATCGGTGGACCATGTAGTAGTATAACTAGTCCACAGATGTCCAGGT
GTGAATCCACTGTTACGAAACCACAATCATTATCTTTCATTAATAGTACT
CCTAATTCGCAGCATTCATTTTCTTTTAAAACCTATTCAGGCAACTTAAA
AACGAAATATTCTCCGATTTCTTTTAAATATAACTCAGAAAATCTTAAAA
AGAATAAGAATCATAGCAATGAAAAAATTAAAGTTAAAAACAATTCCCTT
TCGTCAGAAGAAGAAACAGACTGGAAAAGAGAAAAAAAATTGGGAACTTA
AATCTAAAATTAAAGATTTATCATCTTCAAGTTCAGATGAAGTTGATGAT
GAAGACGAAGACATTGATGATGATGAATCACTTTGTAGAGATGAAATAAA
TAGTGTAATGCATAAGAACGGAAACCAAAGGCGTCGTCTATATACATCAT
CAATGGAGCGAAGTAGTAGTAATACTTATGAGAAGGAAACTGAATCGGTA
TGGTTTGAAACCTTGACTCGAGCTCTAAATAACAATACTTCATGCGATGA
AACATCTTTTAACAGTTCAATGAATTTGAGTGTTTCTGGTTTGCGAATTA
TTCCTTCATCGGAATGGTTGAGTAATTTGTGGATTAAATTCCCATTGGTG
TTCGAAGATTGTTGTTCCAAATGTCGCGTGTGTATAACCGAAGCTAATTA
CTATTTGTCAACCGTTAATGATTTATCTAGTATTGGCTCGGAATTCGTGG
AAATAATAACTCGAGTCTGCAGAAATCTCACTACACCGCTTTTCCATCTA
GGCAAAAATCATTATATCAGTGCTGATCTATTATTAGAATCCCAAAAATT
GACCTTGATGCAATTACAAGAAACCTATGACAAATTCTGTAATCACATGG
AATATTCTACTGAAATTTTAGATCTTTTAAAACGATCTACTAGAATAAAT
CATCTTGAGCCAATAAAACCGGATGAAAAGAGAATCAACTTATGTCGGCA
TTTGGATAAAATGATGAAGCAATTGTTCCTAATGTACGAGTCTCATTGTC
GTTTACTCAGTGACTTGAAAAATTCTATCGAAACATCTAATAATTCCATT
ACTGATCTCTCTGATTTTGTCAAGAACGTTGCTAACCAATTATCTCCGAG
AATATTGTTTTCTGTTAACAATAAGTCTTCTCCGACAGAAGATCTCGAAC
CCGGTTATATAACTAATGTTTTTGAAATGGAGAAAGTGGAAGAAGAACTC
TATAACGCTTTGGTTGTCGAAGATATCGGAAAAGTTATCAATATCTGGCG
ATTAAATCGAGTCGGTCTTGTCGTGTTCAACAAAGCTCTAGAATCAAACA
ATCCGGCATTCTATTTAATGCAAATGTTCTGTTTGTTGTATGCGAAAGAC
AGTCCTGATTTACTCGTTTATGTCAGTTCACAAGATATTGGGAATTCTAC
AGATCGTTCTCAGCAAGTTTCATCACTCGCTGCTGCGTTGGTTCCGATCT
CGTCGAAAATATCAAGCCTAGAAAAAAATCTGCAAATCGATTGTCCAAAG
AAAACTACCTTAATCAGTCCTATTGATACGGAGCAATCCGTTGTTCACAT
TACTTCGGACTCCAGTGTGATGTAATTATGGATTTTATAAATTATTATTT
TACTGTTTGAAATATTTTCTTGTAATAAATCATTAAATATATTGAAAAAA
AAATCGGTTGGTTTTATGATTCTATATATTTCACACTTGATTGATTTTTG
CAACTGTATAATCCAATACAGCTAATTTGCTGCATTCGTATTCTACTAAG
CTAATTTATGTTCCATGTCTAGGAGGAAAGTAATATTCGTAAT
back to top

protein sequence of SMED30010898-orf-1

>SMED30010898-orf-1 ID=SMED30010898-orf-1|Name=SMED30010898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MIERFLKIIDSVRKALNVLGSTTLLNENNISILSNIYNAIQPVKLAVEAL
GTGDANLVTADAILKFVFDSLHENNNNISKELLNVLIIRIKERRNQHLVT
FIKYLQALDLQSTLGLPSSSIATIILCANEIFIRLFEKENEGAGVDEDIL
CEEHSSALKTV*
back to top

protein sequence of SMED30010898-orf-2

>SMED30010898-orf-2 ID=SMED30010898-orf-2|Name=SMED30010898-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=469bp
MKKLKLKTIPFRQKKKQTGKEKKNWELKSKIKDLSSSSSDEVDDEDEDID
DDESLCRDEINSVMHKNGNQRRRLYTSSMERSSSNTYEKETESVWFETLT
RALNNNTSCDETSFNSSMNLSVSGLRIIPSSEWLSNLWIKFPLVFEDCCS
KCRVCITEANYYLSTVNDLSSIGSEFVEIITRVCRNLTTPLFHLGKNHYI
SADLLLESQKLTLMQLQETYDKFCNHMEYSTEILDLLKRSTRINHLEPIK
PDEKRINLCRHLDKMMKQLFLMYESHCRLLSDLKNSIETSNNSITDLSDF
VKNVANQLSPRILFSVNNKSSPTEDLEPGYITNVFEMEKVEEELYNALVV
EDIGKVINIWRLNRVGLVVFNKALESNNPAFYLMQMFCLLYAKDSPDLLV
YVSSQDIGNSTDRSQQVSSLAAALVPISSKISSLEKNLQIDCPKKTTLIS
PIDTEQSVVHITSDSSVM*
back to top

protein sequence of SMED30010898-orf-3

>SMED30010898-orf-3 ID=SMED30010898-orf-3|Name=SMED30010898-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=279bp
MGNKKNKTKELLLQLINYFGTYGYRIGFPKSPSKKLWEQVIFSQSTETLE
HQVSLHSSSETTSTNDISLADDLRLDETSSVEQAQVFRDLDEYLDSQLKM
NFLDLPDNKWEDDRKPSWGVRSQSITHYNEFSESINQNQSTNKIQNSSTF
AEGTENSPNFIPSPSKTLPCRSHKSPISKAIGGPCSSITSPQMSRCESTV
TKPQSLSFINSTPNSQHSFSFKTYSGNLKTKYSPISFKYNSENLKKNKNH
SNEKIKVKNNSLSSEEETDWKREKKLGT*
back to top

protein sequence of SMED30010898-orf-4

>SMED30010898-orf-4 ID=SMED30010898-orf-4|Name=SMED30010898-orf-4|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2591bp
MSHKPGEYVIENLMKSFIKISFNKTELFVKNEKVLSIRKGMRYNDDCEFQ
NLLLALNACAENSLPSLLKALLDWHNNNYSHGLFTKPANVRKCDKIKLPD
VCATSDITNTDMSASTNSYFASEPMATSNQMSDSTTTDNIHISEKRDIGV
DYIFCQSIISVLKQLSLHPGHDEMLNVVLSMAFQHFKYRDDLMANPNHLL
INEIADLYAEVVGVLTQSRFNLVRMKFTSELKSLRNKEANSSGFQSIISL
LMGMKFFRVKMYPIEDFVDCFNFLTELANYFIEVDDKKIKHALAGLFVEV
LLPVAAVVKNEVNIPVLKNFVEFLYNTCSDMCSKKKHFIALSPLVTCLLS
IGQKQFFLVNWPVFMLACLSQLKNRDPNIARVALESLFRLLWVYIVRIKG
EKHTDTQSKLHSIVNSLFPKGSKFVVPRDASINIFVKIIHFIAQEKLDFA
MKEIIFDLIGANRSHKVIIPERMNIGLCAFLLIALSLQQKEGEPPMPQKS
NSESNHPSIVCSQSMDNNQATKSSPYHSSQASGGRLSRLSINKFNTSTPE
WNSQSIQSKPFPGKRKTSYSFMTLNDANAASLGIKDYINPVRKSFDTMLR
LLDQQVIRTMLLTKQENINKEFDDVMTGQSIGVASGSLYRKSKRNSVIDA
ERKPKIELLKTCISAIPRLLPAEMSKSELVELLSRLSMHIDEELRMMSQQ
ALINIIQELPEWRFKTIQTYLQFVRKEITDSSPLQLENNMKILYHLINAW
KNTLIASTKENNQKSKALDKTLLDDVEGFCLVMLCQYRSSIRRLSVHVLK
EVKSLIIHINMDLKLNTSSINVSQESPNSNETNKTSFVIDVIDYAALKIL
ERCLPFLPNNEKAHLTMMQNIDFMTLAERTNPIWGVVSNTYSNNINDNHG
SLNSESHLSTNLWSECIATIFNRTFLMKSCQNAVNNAWTTLMDRINHLFN
IIDPSVQIAENRTSSLLRGGSSNKKPLTSNERDHCMLLWKNYITAACCVA
PLYISQSQGTVGKYLKSPDQSGSTIDSSQIKNLSSNNSASVAASCSVMKP
TSKDLLKILISLIKCEVSDLRNSVIEAMGHFNPSSLRDLMDELQIILRES
VDKKQENVRRRKRKDSLRLYIVKILELLAYNGIFDYSEDQLSQLITVIDW
LELLRPYLIQGDSGVNLSADISLSILNETRLHFCRLIQYLVLHAPKEKRQ
NLMTENFKQSFFLMIAHWTGNFVKPLLKKKIIKSIELTNCKVESADKKTD
DLCYAAITAMCSLICCGPIFDPQALQEDGYILPWLLNIINSKDEKFMALC
EETITLLLDYNSETHTFLDVMIDCCYMASNSTMKIVFLSIVRTFNNYPDY
PCDYVSMITLALAFTSNIDTQIKENAYQLLQLLYYRFFIDSSFVWSENNS
INVELNSDQNVSSPIANNGTSTKISMISRWEQLSTLSQDEISRALSEMLP
DLTLSIFSEITQRVLTANPNLQLILLSCLVPWMYNIELIDFIYTSISNSN
SSDSITQSRVSRTKQYSSSPIPFNKIGLTGNGWGSKQATDLVLNNLFYLT
VRFGQELSKSLENIWGCLVNYRTDNMMVIIHYLIVITSLTPNSFLSYAKQ
IIVFLSKEKPKKLLENLFSILQTVDGINYSVERTQSLPFYRINNTTNNSN
VTSQTKLNNKPNSNTSTQIMETNINLSTHDKGVMNGSQQLPVASVRSSTL
DGLQISNKSQSEIIDIDEVSVTNYPQSAPGTLRFDGLDTTSIVIDEDKYA
TLRAKDLRKKEVFNKQPINITKTKDLSPSNIHPLPLPAYGGFSAPLNQFL
NEDQCPLWTHGYKSSIVLMFFIDIVPIANTRSFWERDLELLLHCIILGLD
HKESLVFQQCKILLIKILQILCPDITEFKIINLLMTGSTTMPTKSLLCLN
GGACQSMVRMQTCDRGSNWNNIFFDEPVKTSETTNLNITNDVDTKLQRTL
SSYSVTSTVTLIPSAKVSTSQSKPNSCIIENIETPNEHDVEIMRNIGRQS
KNKSVRELIKIISTYRDRPMWGYEDVTISRYINDGISTINQISNSRASTD
NNKFPNSREDDELILISSVAVLNTIIKLICSLIDADGTLVIKWAQLALNT
GVNCTHRHYASRSLQIFRALGTTFDGTKLSALYSRLLDTIGDLNEDVQCY
VVELFLTLESGIKNLNPQEMFANSLDDNCSDTDEDDLYRSTPNLKNSFSS
PKIGYHKDISRQRGTTVGGGFRILNSSNHHQRASAVIESTTSTKQPSPRR
PASLKGNLKDNKSTVSSNLSWDERTDLVCEIFWLANILMESELEHEFYAG
LRFLSLLMNCLNSSHFDMRSKLEKIVQFCNWGSLFPGTIHLLIKGCFSQS
FWPISAQLLSKMVVNVNCSLVDPTLKVGFPFTVLTLLVSIFDEETQNSRL
AAKNIASIAKILSPDRLGNLILVMQLYSGGTFNKDHTQWTRCVVKYLYDA
YSEISAELLAFINRMLLECPSFMHSAILQVLGNFIYYINMNESAIVYQLN
KIIESLSQLFINNVQWKEVYPILRLLVSKNSSLSLPTSKVIESSVLLSLP
MVPLPEAETPRLELPGRILEYQFDVKNYCMKNSETVDSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000902cell morphogenesis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039867Furry/Tao3/Mor2
IPR011528NERD
IPR012337RNaseH-like_sf
IPR011989ARM-like
IPR029473MOR2-PAG1_mid
IPR025481Cell_Morphogen_C
IPR025614Cell_morpho_N
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025481Cell morphogenesis protein C-terminalPFAMPF14225MOR2-PAG1_Ccoord: 2280..2529
e-value: 2.4E-34
score: 119.3
IPR025614Cell morphogenesis protein N-terminalPFAMPF14222MOR2-PAG1_Ncoord: 144..750
e-value: 8.0E-149
score: 497.1
IPR029473Cell morphogenesis central regionPFAMPF14228MOR2-PAG1_midcoord: 2066..2123
e-value: 5.2E-5
score: 21.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2234..2258
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2234..2250
IPR039867Protein furry/Tao3/Mor2PANTHERPTHR12295UNCHARACTERIZEDcoord: 2..2533
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 662..1384
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 1428..2526