Y box binding protein 1

Overview
NameY box binding protein 1
Smed IDSMED30010890
Length (bp)861
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Y box binding protein 1 (SMED30010890) t-SNE clustered cells

Violin plots show distribution of expression levels for Y box binding protein 1 (SMED30010890) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Y box binding protein 1 (SMED30010890) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Y box binding protein 1 (SMED30010890) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010890

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30010890SMESG000008704.1 dd_Smed_v4_347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30010890SMESG000008704.1 dd_Smed_v4_347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010890SMESG000008704.1 dd_Smed_v4_347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010890SMESG000008704.1 dd_Smed_v4_347_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Y box binding protein 1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 114.005 bits (284), Expect = 1.012e-28
Identity = 56/93 (60.22%), Postives = 70/93 (75.27%), Query Frame = 1
Query:   97 NNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            + +DK +LA +V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI R  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++AP
Sbjct:   83 SQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175          
BLAST of Y box binding protein 1 vs. Ensembl Human
Match: YBX2 (Y-box binding protein 2 [Source:HGNC Symbol;Acc:HGNC:17948])

HSP 1 Score: 114.005 bits (284), Expect = 1.012e-28
Identity = 56/93 (60.22%), Postives = 70/93 (75.27%), Query Frame = 1
Query:   97 NNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            + +DK +LA +V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI R  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++AP
Sbjct:   83 SQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175          
BLAST of Y box binding protein 1 vs. Ensembl Human
Match: YBX1 (Y-box binding protein 1 [Source:HGNC Symbol;Acc:HGNC:8014])

HSP 1 Score: 111.694 bits (278), Expect = 3.979e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   51 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 139          
BLAST of Y box binding protein 1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 108.997 bits (271), Expect = 3.119e-27
Identity = 54/91 (59.34%), Postives = 70/91 (76.92%), Query Frame = 1
Query:  100 NSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            +++K++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++A
Sbjct:   81 DAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYA 171          
BLAST of Y box binding protein 1 vs. Ensembl Human
Match: YBX3 (Y-box binding protein 3 [Source:HGNC Symbol;Acc:HGNC:2428])

HSP 1 Score: 109.768 bits (273), Expect = 5.103e-27
Identity = 54/91 (59.34%), Postives = 70/91 (76.92%), Query Frame = 1
Query:  100 NSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            +++K++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++A
Sbjct:   81 DAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYA 171          
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Match: cey-1 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62213])

HSP 1 Score: 108.612 bits (270), Expect = 2.168e-28
Identity = 55/97 (56.70%), Postives = 70/97 (72.16%), Query Frame = 1
Query:  103 SDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYN 390
            +DK + A KV G VKWFNVK GYGFI+R D +ED+FVHQ+AI    P K  +SLG++E+V FD+V+G KG EA +VTGP G  V GSK+A   D+ N
Sbjct:   12 ADKPVKATKVKGTVKWFNVKNGYGFINRTDTNEDIFVHQTAIINNNPNKYLRSLGDNEEVMFDIVEGSKGLEAASVTGPDGGPVQGSKYAADRDAEN 108          
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Match: cey-2 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91306])

HSP 1 Score: 92.0485 bits (227), Expect = 9.333e-22
Identity = 44/88 (50.00%), Postives = 64/88 (72.73%), Query Frame = 1
Query:  109 KEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK--QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKF 366
            K  +   + GKVKW++V + YGFI R+D ++D+FVHQ+AI++    K   ++LG+DE+V FD+V+G  G EA NVTGP GD VIGS++
Sbjct:   59 KTAITTGLQGKVKWYSVLRRYGFISRNDGEKDIFVHQTAIAKSATEKFYLRTLGDDEEVLFDLVEGKNGPEAANVTGPNGDNVIGSRY 146          
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 87.8113 bits (216), Expect = 5.125e-20
Identity = 47/94 (50.00%), Postives = 65/94 (69.15%), Query Frame = 1
Query:  103 SDKEILAHKVTGKVKWFNVKKGYGFIHRD---DVDEDVFVHQSAISRCQPGK--QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            + K+++   V G VKWF+V+  YGF+ RD   D +ED FVHQ+AI++    K   ++L +DE V FD+V+GLKG EA NVTGP G+ V GS+FA
Sbjct:   80 ASKKVIETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173          
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Match: cey-4 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5EDV3])

HSP 1 Score: 87.8113 bits (216), Expect = 5.125e-20
Identity = 47/94 (50.00%), Postives = 65/94 (69.15%), Query Frame = 1
Query:  103 SDKEILAHKVTGKVKWFNVKKGYGFIHRD---DVDEDVFVHQSAISRCQPGK--QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            + K+++   V G VKWF+V+  YGF+ RD   D +ED FVHQ+AI++    K   ++L +DE V FD+V+GLKG EA NVTGP G+ V GS+FA
Sbjct:   80 ASKKVIETGVKGHVKWFSVRGRYGFVARDKPTDENEDFFVHQTAITKSSTIKFYLRTLDDDEPVVFDIVEGLKGPEAANVTGPDGENVRGSRFA 173          
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Match: cey-3 (C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91398])

HSP 1 Score: 83.9593 bits (206), Expect = 9.278e-19
Identity = 44/88 (50.00%), Postives = 60/88 (68.18%), Query Frame = 1
Query:  109 KEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK--QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKF 366
            K +L   + GKVKW++V + YGFI R D ++DVFVHQ+AIS+    K   ++L ++E+V FD+V G  G EA NVTGP G  V GSK+
Sbjct:   57 KIVLTAGLQGKVKWYSVLRRYGFISRSDGEKDVFVHQTAISKSDTEKFYLRTLADEEEVLFDLVDGKNGPEAANVTGPAGVNVSGSKY 144          
BLAST of Y box binding protein 1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0076027)

HSP 1 Score: 119.398 bits (298), Expect = 4.066e-31
Identity = 61/98 (62.24%), Postives = 73/98 (74.49%), Query Frame = 1
Query:   79 GEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            G+  +     KE++A KVTG VKWFNVK GYGFI+R+D  EDVFVHQSAI+R  P K  +S+G+ E VEFDVV G KGNEA NVTGP G+ V GS+FA
Sbjct:   45 GQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFA 142          
BLAST of Y box binding protein 1 vs. Ensembl Fly
Match: yps (gene:FBgn0022959 transcript:FBtr0305992)

HSP 1 Score: 118.627 bits (296), Expect = 6.066e-31
Identity = 61/98 (62.24%), Postives = 73/98 (74.49%), Query Frame = 1
Query:   79 GEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            G+  +     KE++A KVTG VKWFNVK GYGFI+R+D  EDVFVHQSAI+R  P K  +S+G+ E VEFDVV G KGNEA NVTGP G+ V GS+FA
Sbjct:   45 GQQGQPAPPTKEVIATKVTGTVKWFNVKSGYGFINRNDTREDVFVHQSAIARNNPKKAVRSVGDGEVVEFDVVIGEKGNEAANVTGPSGEPVRGSQFA 142          
BLAST of Y box binding protein 1 vs. Ensembl Fly
Match: lin-28 (gene:FBgn0035626 transcript:FBtr0077090)

HSP 1 Score: 67.781 bits (164), Expect = 2.324e-13
Identity = 35/77 (45.45%), Postives = 48/77 (62.34%), Query Frame = 1
Query:  136 GKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKF 366
            GK KWFNV KG+GF+  +D  ++VFVHQS I   Q    +SLGE E+VEF+  +  +G EA  V+   G +  GS +
Sbjct:   41 GKCKWFNVAKGWGFLTPNDGGQEVFVHQSVI---QMSGFRSLGEQEEVEFECQRTSRGLEATRVSSRHGGSCQGSTY 114          
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 111.309 bits (277), Expect = 2.576e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 119          
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 111.309 bits (277), Expect = 2.576e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 119          
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Match: ybx1 (Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-000629-3])

HSP 1 Score: 110.923 bits (276), Expect = 3.485e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   31 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 119          
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 62.3882 bits (150), Expect = 2.329e-11
Identity = 37/87 (42.53%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFI---HRD----DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +G  KWFNV+ G+GF+   HR+    D   DVFVHQS +        +SL E E VEF   +  KG E++ VTGP G   +GS+  P
Sbjct:   29 SGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHM---EGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKP 112          
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Match: lin28a (lin-28 homolog A (C. elegans) [Source:NCBI gene;Acc:394066])

HSP 1 Score: 62.3882 bits (150), Expect = 3.478e-11
Identity = 37/87 (42.53%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFI---HRD----DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +G  KWFNV+ G+GF+   HR+    D   DVFVHQS +        +SL E E VEF   +  KG E++ VTGP G   +GS+  P
Sbjct:   35 SGVCKWFNVRMGFGFLSMTHREGICLDSPVDVFVHQSKLHM---EGFRSLKEGEAVEFTFKRSSKGLESLQVTGPGGAPCVGSEKKP 118          
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 112.079 bits (279), Expect = 1.757e-28
Identity = 58/117 (49.57%), Postives = 77/117 (65.81%), Query Frame = 1
Query:   79 GEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNY 426
            G++      +K+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A   + +   +      RNY
Sbjct:   20 GQEPAATVGEKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHFRRYQRRRGPPRNY 136          
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Match: ybx3 (Y-box binding protein 3 [Source:NCBI gene;Acc:548572])

HSP 1 Score: 108.997 bits (271), Expect = 8.197e-28
Identity = 53/88 (60.23%), Postives = 67/88 (76.14%), Query Frame = 1
Query:  109 KEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            +++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV G KG EA NVTGP+G  V GS++A
Sbjct:   29 RKVLATKVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGEVVEFDVVAGEKGAEAANVTGPKGAPVQGSRYA 116          
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Match: hmgcs1 (3-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:Xenbase;Acc:XB-GENE-942074])

HSP 1 Score: 105.145 bits (261), Expect = 7.597e-26
Identity = 55/105 (52.38%), Postives = 69/105 (65.71%), Query Frame = 1
Query:  115 ILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNY 426
             +  KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A   + +   +      RNY
Sbjct:   40 CVTTKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHFRRYQRRRGPPRNY 144          
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Match: usp20 (ubiquitin specific peptidase 20 [Source:Xenbase;Acc:XB-GENE-966528])

HSP 1 Score: 60.4622 bits (145), Expect = 1.664e-10
Identity = 45/123 (36.59%), Postives = 58/123 (47.15%), Query Frame = 1
Query:   94 INNSDKEILAHKVTGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGW 441
            I+ SD E L  + +G  KWFNV+ G+GF+          +   DVFVHQS +        +SL E E VEF   K  KG E+  VTGP G   IGS+  P       R    +  R Y+  G 
Sbjct:   16 IHKSD-ESLIFQGSGVCKWFNVRMGFGFLTMTKKEGTDLETPVDVFVHQSKLHM---EGFRSLKEGESVEFTFKKSSKGLESTRVTGPGGAPCIGSERRPKVKGQQKRRQKGD--RCYNCGGL 132          
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Match: usp20 (ubiquitin specific peptidase 20 [Source:Xenbase;Acc:XB-GENE-966528])

HSP 1 Score: 60.4622 bits (145), Expect = 1.967e-10
Identity = 41/100 (41.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:   94 INNSDKEILAHKVTGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            I+ SD E L  + +G  KWFNV+ G+GF+          +   DVFVHQS +        +SL E E VEF   K  KG E+  VTGP G   IGS+  P
Sbjct:   23 IHKSD-ESLIFQGSGVCKWFNVRMGFGFLTMTKKEGTDLETPVDVFVHQSKLHM---EGFRSLKEGESVEFTFKKSSKGLESTRVTGPGGAPCIGSERRP 118          
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 114.39 bits (285), Expect = 4.979e-29
Identity = 56/93 (60.22%), Postives = 70/93 (75.27%), Query Frame = 1
Query:   97 NNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            + +DK +LA +V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI R  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++AP
Sbjct:   84 SQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYAP 176          
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 112.464 bits (280), Expect = 8.172e-29
Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 1
Query:   64 SMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            S  + GED     ++K++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++A
Sbjct:   66 SAPAGGED-----AEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYA 163          
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Match: Ybx3 (Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670])

HSP 1 Score: 112.464 bits (280), Expect = 2.511e-28
Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 1
Query:   64 SMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            S  + GED     ++K++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++A
Sbjct:   66 SAPAGGED-----AEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYA 163          
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Match: Ybx1 (Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146])

HSP 1 Score: 111.694 bits (278), Expect = 3.111e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   49 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 137          
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Match: Ybx2 (Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372])

HSP 1 Score: 107.457 bits (267), Expect = 4.307e-27
Identity = 54/86 (62.79%), Postives = 65/86 (75.58%), Query Frame = 1
Query:  118 LAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            LA +V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI R  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++AP
Sbjct:   14 LAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVKGSRYAP 99          
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Match: sp|P41824|YBOXH_APLCA (Y-box factor homolog OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 2.206e-29
Identity = 57/89 (64.04%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            +K+I+A +V+G VKWFNVK GYGFI+RDD  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KGNEA NVTGP G  V GSK+A
Sbjct:   25 EKKIIASQVSGTVKWFNVKSGYGFINRDDTKEDVFVHQTAIVKNNPRKYLRSVGDGEKVEFDVVEGEKGNEAANVTGPEGSNVQGSKYA 113          
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Match: sp|P21573|YBOX1_XENLA (Y-box-binding protein 1 OS=Xenopus laevis OX=8355 GN=ybx1 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.614e-28
Identity = 56/98 (57.14%), Postives = 71/98 (72.45%), Query Frame = 1
Query:   79 GEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            G++      DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   20 GQEPAATVGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPEGVPVQGSKYA 117          
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y2T7|YBOX2_HUMAN (Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN=YBX2 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 4.862e-28
Identity = 56/93 (60.22%), Postives = 70/93 (75.27%), Query Frame = 1
Query:   97 NNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            + +DK +LA +V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI R  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++AP
Sbjct:   83 SQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAP 175          
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Match: sp|Q9JKB3|YBOX3_MOUSE (Y-box-binding protein 3 OS=Mus musculus OX=10090 GN=Ybx3 PE=1 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 1.756e-27
Identity = 58/103 (56.31%), Postives = 74/103 (71.84%), Query Frame = 1
Query:   64 SMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            S  + GED     ++K++LA KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GS++A
Sbjct:   66 SAPAGGED-----AEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYA 163          
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Match: sp|Q28618|YBOX1_RABIT (Y-box-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=YBX1 PE=1 SV=3)

HSP 1 Score: 111.694 bits (278), Expect = 1.778e-27
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   51 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 139          
BLAST of Y box binding protein 1 vs. TrEMBL
Match: D5JG64 (Cold shock domain-containing protein A (Fragment) OS=Dugesia japonica OX=6161 GN=CSDA PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.436e-61
Identity = 127/168 (75.60%), Postives = 142/168 (84.52%), Query Frame = 1
Query:   88 HRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSND--SYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRDN--XXXXXXXXXXQGARFDSSRED 579
            HRINNS+KE+L HKVTGKVKW+NVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDV FDVVKG KGNEAMNVTGP GDAV+GSKFAP+ND  + N+R+NANNSYR  DSRG GRG+     + RNEGSR +D ++DN    S  S GGYQG RFDS+R+D
Sbjct:    1 HRINNSEKEVLVHKVTGKVKWYNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVLFDVVKGSKGNEAMNVTGPNGDAVLGSKFAPNNDFQNRNNRDNANNSYRQGDSRGRGRGLGRGRSYFRNEGSRDNDSYKDNFLNRSGSSGGGYQGNRFDSNRDD 168          
BLAST of Y box binding protein 1 vs. TrEMBL
Match: A4V6J7 (Y-Box factor protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 1.937e-50
Identity = 114/152 (75.00%), Postives = 127/152 (83.55%), Query Frame = 1
Query:  136 GKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSND--SYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRDN--XXXXXXXXXXQGARFDSSRED 579
            GKVKW+NVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDV FDVVKG KGNEAMNVTGP GDAV+GSKFAP+ND  + N+R+NANNSYR  DSRG GRG+     + RNEGSR +D ++DN    S  S GGYQG RFDS+R+D
Sbjct:    5 GKVKWYNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVLFDVVKGSKGNEAMNVTGPNGDAVLGSKFAPNNDFQNRNNRDNANNSYRQGDSRGRGRGLGRGRSYFRNEGSRDNDSYKDNFLNRSGSSGGGYQGNRFDSNRDD 156          
BLAST of Y box binding protein 1 vs. TrEMBL
Match: A0A2P2IG98 (Cold shock Y-box protein (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.317e-30
Identity = 64/111 (57.66%), Postives = 78/111 (70.27%), Query Frame = 1
Query:   40 FKISQ*KLSMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            F I     +  +  E+ +    +KE+LA KVTG VKWFNVK GYGFI+R D  EDVFVHQSAI++  P K  +S+G+ EDVEFDVV G KGNEA NVTGP G+AV GS +A
Sbjct:   15 FTIMSDPENTVTSPEEPKAPVKEKEVLATKVTGTVKWFNVKSGYGFINRHDTKEDVFVHQSAITKNNPRKYVRSVGDGEDVEFDVVVGEKGNEAANVTGPGGEAVKGSPYA 125          
BLAST of Y box binding protein 1 vs. TrEMBL
Match: M4Y9F7 (Y-Box binding protein OS=Cerebratulus lacteus OX=6221 PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 5.786e-30
Identity = 62/105 (59.05%), Postives = 79/105 (75.24%), Query Frame = 1
Query:   61 LSMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQ-KSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +S S    + +    +K+++A KVTG VKWFNVK GYGFI+RDD  EDVFVHQ+AI++  P K  +S+G+ E VEFDVV+G KGNEA NVTGP G+AV GSK+AP
Sbjct:    1 MSDSEKSAEKQPAAVEKKLIAEKVTGTVKWFNVKSGYGFINRDDTKEDVFVHQTAITKNNPRKYLRSVGDGEKVEFDVVEGEKGNEASNVTGPEGNAVQGSKYAP 105          
BLAST of Y box binding protein 1 vs. TrEMBL
Match: W4XI83 (CSD_1 domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 1.526e-29
Identity = 62/104 (59.62%), Postives = 75/104 (72.12%), Query Frame = 1
Query:   61 LSMSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            +S   + +   I   +K +LA KV+G VKWFNVK GYGFI+RDD  EDVFVHQSAI R  P K Q+S+G+ E VEFDVV+G KGNEA  VTGP G  V+GSK+A
Sbjct:    1 MSEGQEEQPQTIEAPEKIVLATKVSGTVKWFNVKNGYGFINRDDTKEDVFVHQSAIVRNNPRKYQRSVGDGEVVEFDVVEGTKGNEAARVTGPEGAPVVGSKYA 104          
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:103040011])

HSP 1 Score: 110.538 bits (275), Expect = 5.337e-28
Identity = 55/89 (61.80%), Postives = 68/89 (76.40%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G  V GSK+A
Sbjct:   32 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYA 120          
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 105.531 bits (262), Expect = 3.669e-26
Identity = 51/90 (56.67%), Postives = 68/90 (75.56%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +++++A  V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+  KG+EA NVTGP G  V GS++AP
Sbjct:   23 ERKVIATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYAP 112          
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Match: YBX2 (Y-box-binding protein 2-A-like [Source:NCBI gene;Acc:103036193])

HSP 1 Score: 104.375 bits (259), Expect = 1.020e-25
Identity = 52/87 (59.77%), Postives = 65/87 (74.71%), Query Frame = 1
Query:  115 ILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            I+A  V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+  KG+EA NVTGP G  V GS++AP
Sbjct:   19 IVATLVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEIVEFDVVEATKGSEAANVTGPGGVPVKGSRYAP 105          
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 61.2326 bits (147), Expect = 1.098e-10
Identity = 41/110 (37.27%), Postives = 51/110 (46.36%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGW 441
            +G  KWFNV+ G+GFI          D   DVFVHQS +        +SL E E VEF   K  KG E + VTGP G   +GS+  P   S   +       R Y+  G 
Sbjct:   30 SGHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHM---EGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVGSERRPKGKSVQQKRKPKGD-RCYNCGGL 135          
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Match: LIN28B (protein lin-28 homolog A [Source:NCBI gene;Acc:103022253])

HSP 1 Score: 61.2326 bits (147), Expect = 1.163e-10
Identity = 38/95 (40.00%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHR 396
            +G  KWFNV+ G+GFI          D   DVFVHQS +        +SL E E VEF   K  KG E + VTGP G   +GS+  P   S   +
Sbjct:   38 SGHCKWFNVRMGFGFISMTSRGGNPIDPPLDVFVHQSKLHM---EGFRSLKEGEAVEFTFKKSSKGLECVRVTGPGGAHCVGSERRPKGKSVQQK 129          
BLAST of Y box binding protein 1 vs. Ensembl Nematostella
Match: EDO41469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S475])

HSP 1 Score: 110.923 bits (276), Expect = 6.297e-31
Identity = 58/95 (61.05%), Postives = 70/95 (73.68%), Query Frame = 1
Query:  115 ILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHR 396
            I A KVTG VKWFNVK GYGFI+RDD  ED+FVHQ+AI++  P K  +S+G+ E VEF+VV G KG EA NVTGP G+ V GSK+AP     N+R
Sbjct:    3 IAATKVTGTVKWFNVKNGYGFINRDDNKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEFNVVSGTKGLEASNVTGPDGEPVQGSKYAPDRRRRNNR 97          
BLAST of Y box binding protein 1 vs. Ensembl Nematostella
Match: EDO44703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV03])

HSP 1 Score: 68.1662 bits (165), Expect = 5.891e-13
Identity = 39/77 (50.65%), Postives = 47/77 (61.04%), Query Frame = 1
Query:  130 VTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGS 360
             TG VKWFN+ KG+GFI RDD  EDVFVHQSAI   +    +SL E E V+  +    KG  A+ VT P G  V G+
Sbjct:  483 CTGSVKWFNLIKGFGFITRDDGGEDVFVHQSAI---KASGYRSLEEGEHVQLTISNSDKGKVAICVTSPGGGNVKGA 556          
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Match: ybx1 (Y-box binding protein 1 [Source:NCBI gene;Acc:100049221])

HSP 1 Score: 112.079 bits (279), Expect = 1.017e-28
Identity = 56/89 (62.92%), Postives = 69/89 (77.53%), Query Frame = 1
Query:  106 DKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFA 369
            DK+++A KV G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDVV+G KG EA NVTGP G AV GSK+A
Sbjct:   33 DKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVAVQGSKYA 121          
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007880.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 106.686 bits (265), Expect = 4.335e-26
Identity = 51/91 (56.04%), Postives = 69/91 (75.82%), Query Frame = 1
Query:  103 SDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            S+++++A  V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDV++  KG+EA NVTGP G  V GS++AP
Sbjct:  103 SERKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYAP 193          
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Match: ENSORLT00000007875.2 (Y-box binding protein 2 [Source:NCBI gene;Acc:100049372])

HSP 1 Score: 106.686 bits (265), Expect = 4.725e-26
Identity = 51/91 (56.04%), Postives = 69/91 (75.82%), Query Frame = 1
Query:  103 SDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            S+++++A  V G VKWFNV+ GYGFI+R+D  EDVFVHQ+AI +  P K  +S+G+ E VEFDV++  KG+EA NVTGP G  V GS++AP
Sbjct:  103 SERKVIATAVQGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKFLRSVGDGEVVEFDVIEAAKGSEAANVTGPGGIPVKGSRYAP 193          
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 59.3066 bits (142), Expect = 5.149e-10
Identity = 36/87 (41.38%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +G  KWFNV+ G+GFI          +   DVFVHQS +        +SL E E VEF   K  KG E++ VTGP G   +GS+  P
Sbjct:   34 SGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVM---EGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSERRP 117          
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Match: lin28b (lin-28 homolog B [Source:NCBI gene;Acc:101160951])

HSP 1 Score: 59.3066 bits (142), Expect = 5.374e-10
Identity = 36/87 (41.38%), Postives = 46/87 (52.87%), Query Frame = 1
Query:  133 TGKVKWFNVKKGYGFIHRD-------DVDEDVFVHQSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAP 372
            +G  KWFNV+ G+GFI          +   DVFVHQS +        +SL E E VEF   K  KG E++ VTGP G   +GS+  P
Sbjct:   41 SGFCKWFNVRMGFGFISMTNSEGSPVEPPLDVFVHQSKLVM---EGFRSLKEGEQVEFTYKKSSKGLESLRVTGPGGGPCVGSERRP 124          
BLAST of Y box binding protein 1 vs. Planmine SMEST
Match: SMESG000008704.1 (SMESG000008704.1)

HSP 1 Score: 146.747 bits (369), Expect = 4.393e-44
Identity = 87/149 (58.39%), Postives = 92/149 (61.74%), Query Frame = 1
Query:  319 MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRDNXXXXXXXXXXQGARFDSSREDYXX--XXXXXXXXXXXXXXXXXXV*FGVI*IYFKLFYMENDLLKYNVLLLAYQLMLEYDEFV 759
            MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRN DSRGWGRGITSRGRFIRNEGSR                     R +    D          R            V  G I +++    MENDLLKYN+LLLAYQLMLEYDEFV
Sbjct:    1 MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNDDSRGWGRGITSRGRFIRNEGSR------------VVMNIEIIIRVEEVEGDIKVRGLILHVRTIVLHHIEVEEVVQEGQIKLFY----MENDLLKYNILLLAYQLMLEYDEFV 133          
BLAST of Y box binding protein 1 vs. Planmine SMEST
Match: SMESG000008704.1 (SMESG000008704.1)

HSP 1 Score: 120.168 bits (300), Expect = 4.828e-34
Identity = 57/58 (98.28%), Postives = 57/58 (98.28%), Query Frame = 1
Query:  319 MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSR 492
            MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRN DSRGWGRGITSRGRFIRNEGSR
Sbjct:    1 MNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNDDSRGWGRGITSRGRFIRNEGSR 58          
BLAST of Y box binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 122.479 bits (306), Expect = 3.334e-32
Identity = 72/141 (51.06%), Postives = 90/141 (63.83%), Query Frame = 1
Query:   94 INNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRD 513
            I+ ++K+ILA K+ GKVKWFNVK GYGFI+R+D  ED+FVHQ+AI +  P K Q+S+G+ E+VEFDVV+G KG EA NVTGP G  V GSK+A     Y  R            R  GRG   R R +RN G RG    R+
Sbjct:   13 IHPTEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYAADKRHYRSRSFG---------RAVGRGFGGRVRSLRN-GPRGRSLSRE 143          
BLAST of Y box binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 122.479 bits (306), Expect = 4.311e-32
Identity = 72/141 (51.06%), Postives = 90/141 (63.83%), Query Frame = 1
Query:   94 INNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRD 513
            I+ ++K+ILA K+ GKVKWFNVK GYGFI+R+D  ED+FVHQ+AI +  P K Q+S+G+ E+VEFDVV+G KG EA NVTGP G  V GSK+A     Y  R            R  GRG   R R +RN G RG    R+
Sbjct:   13 IHPTEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYAADKRHYRSRSFG---------RAVGRGFGGRVRSLRN-GPRGRSLSRE 143          
BLAST of Y box binding protein 1 vs. Planmine SMEST
Match: SMESG000076962.1 (SMESG000076962.1)

HSP 1 Score: 122.094 bits (305), Expect = 4.560e-32
Identity = 72/141 (51.06%), Postives = 90/141 (63.83%), Query Frame = 1
Query:   94 INNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVHQSAISRCQPGK-QKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKFAPSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRD 513
            I+ ++K+ILA K+ GKVKWFNVK GYGFI+R+D  ED+FVHQ+AI +  P K Q+S+G+ E+VEFDVV+G KG EA NVTGP G  V GSK+A     Y  R            R  GRG   R R +RN G RG    R+
Sbjct:   13 IHPTEKKILATKINGKVKWFNVKSGYGFINRNDNQEDIFVHQTAILKNNPRKWQRSVGDGEEVEFDVVEGEKGLEAANVTGPDGIPVQGSKYAADKRHYRSRSFG---------RAVGRGFGGRVRSLRN-GPRGRSLSRE 143          
The following BLAST results are available for this feature:
BLAST of Y box binding protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YBX21.012e-2860.22Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX21.012e-2860.22Y-box binding protein 2 [Source:HGNC Symbol;Acc:HG... [more]
YBX13.979e-2861.80Y-box binding protein 1 [Source:HGNC Symbol;Acc:HG... [more]
YBX33.119e-2759.34Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
YBX35.103e-2759.34Y-box binding protein 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cey-12.168e-2856.70C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:O62... [more]
cey-29.333e-2250.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
cey-45.125e-2050.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-45.125e-2050.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
cey-39.278e-1950.00C. Elegans Y-box [Source:UniProtKB/TrEMBL;Acc:P91... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
yps4.066e-3162.24gene:FBgn0022959 transcript:FBtr0076027[more]
yps6.066e-3162.24gene:FBgn0022959 transcript:FBtr0305992[more]
lin-282.324e-1345.45gene:FBgn0035626 transcript:FBtr0077090[more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx12.576e-2861.80Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx12.576e-2861.80Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ybx13.485e-2861.80Y box binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
lin28a2.329e-1142.53lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
lin28a3.478e-1142.53lin-28 homolog A (C. elegans) [Source:NCBI gene;Ac... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmgcs11.757e-2849.573-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
ybx38.197e-2860.23Y-box binding protein 3 [Source:NCBI gene;Acc:5485... [more]
hmgcs17.597e-2652.383-hydroxy-3-methylglutaryl-CoA synthase 1 [Source:... [more]
usp201.664e-1036.59ubiquitin specific peptidase 20 [Source:Xenbase;Ac... [more]
usp201.967e-1041.00ubiquitin specific peptidase 20 [Source:Xenbase;Ac... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ybx24.979e-2960.22Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
Ybx38.172e-2956.31Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx32.511e-2856.31Y box protein 3 [Source:MGI Symbol;Acc:MGI:2137670... [more]
Ybx13.111e-2861.80Y box protein 1 [Source:MGI Symbol;Acc:MGI:99146][more]
Ybx24.307e-2762.79Y box protein 2 [Source:MGI Symbol;Acc:MGI:1096372... [more]
back to top
BLAST of Y box binding protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41824|YBOXH_APLCA2.206e-2964.04Y-box factor homolog OS=Aplysia californica OX=650... [more]
sp|P21573|YBOX1_XENLA2.614e-2857.14Y-box-binding protein 1 OS=Xenopus laevis OX=8355 ... [more]
sp|Q9Y2T7|YBOX2_HUMAN4.862e-2860.22Y-box-binding protein 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9JKB3|YBOX3_MOUSE1.756e-2756.31Y-box-binding protein 3 OS=Mus musculus OX=10090 G... [more]
sp|Q28618|YBOX1_RABIT1.778e-2761.80Y-box-binding protein 1 OS=Oryctolagus cuniculus O... [more]
back to top
BLAST of Y box binding protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5JG641.436e-6175.60Cold shock domain-containing protein A (Fragment) ... [more]
A4V6J71.937e-5075.00Y-Box factor protein (Fragment) OS=Dugesia japonic... [more]
A0A2P2IG982.317e-3057.66Cold shock Y-box protein (Fragment) OS=Hirondellea... [more]
M4Y9F75.786e-3059.05Y-Box binding protein OS=Cerebratulus lacteus OX=6... [more]
W4XI831.526e-2959.62CSD_1 domain-containing protein OS=Strongylocentro... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx15.337e-2861.80Y-box binding protein 1 [Source:NCBI gene;Acc:1030... [more]
YBX23.669e-2656.67Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
YBX21.020e-2559.77Y-box-binding protein 2-A-like [Source:NCBI gene;A... [more]
LIN28B1.098e-1037.27protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
LIN28B1.163e-1040.00protein lin-28 homolog A [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box binding protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Y box binding protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO414696.297e-3161.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447035.891e-1350.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Y box binding protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ybx11.017e-2862.92Y-box binding protein 1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007880.24.335e-2656.04Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000007875.24.725e-2656.04Y-box binding protein 2 [Source:NCBI gene;Acc:1000... [more]
lin28b5.149e-1041.38lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
lin28b5.374e-1041.38lin-28 homolog B [Source:NCBI gene;Acc:101160951][more]
back to top
BLAST of Y box binding protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008704.14.393e-4458.39SMESG000008704.1[more]
SMESG000008704.14.828e-3498.28SMESG000008704.1[more]
SMESG000076962.13.334e-3251.06SMESG000076962.1[more]
SMESG000076962.14.311e-3251.06SMESG000076962.1[more]
SMESG000076962.14.560e-3251.06SMESG000076962.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010890 ID=SMED30010890|Name=Y box binding protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=861bp
CGCATTGTTTCAATTACTAGATACAAGAATTTTTAAATATTTAAAATTAG
TCAATAAAAGTTAAGTATGTCTTCTGATGGTGAAGACCACCGAATTAATA
ATTCGGATAAAGAGATTTTAGCCCATAAGGTAACTGGTAAAGTGAAATGG
TTCAATGTTAAAAAGGGATATGGATTTATTCATAGAGACGATGTTGATGA
AGATGTATTTGTTCACCAATCTGCAATTAGCAGATGTCAACCTGGAAAAC
AAAAGTCATTAGGAGAAGATGAAGATGTTGAATTTGATGTTGTCAAAGGT
TTGAAAGGAAATGAAGCAATGAATGTTACTGGTCCTCGAGGTGATGCAGT
GATTGGTAGTAAATTTGCTCCAAGTAATGATTCATACAATCATAGAGAAA
ATGCTAATAATTCATATCGAAATTATGACTCTCGTGGCTGGGGTAGAGGA
ATAACTAGTCGTGGTAGGTTTATTAGAAATGAAGGTTCGCGAGGTAGTGA
TGAACATAGAGATAATTATTCGAGTAGAGGAAGTAGAGGGGGATATCAAG
GTGCGAGGTTTGATTCTTCACGTGAGGACTATAGTGCTCCATCATATAGA
GGTAGAGGAGGTCGTTCAAGAAGGCCAAATCAAAGTAGAGGTGTATAGTT
TGGTGTGATATAAATATATTTTAAGTTATTTTATATGGAAAATGATCTTT
TGAAGTACAATGTTTTGTTATTAGCTTACCAGTTGATGCTGGAATACGAT
GAATTTGTCTAGTGGCTAATACATGATTAAATCACGTGACTCATAAAACA
GTTCACATGCACACTTGTATAAAACTTGTGATAATTAAATGTTTATTATT
TTCTAATTAGG
back to top

protein sequence of SMED30010890-orf-1

>SMED30010890-orf-1 ID=SMED30010890-orf-1|Name=SMED30010890-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MSSDGEDHRINNSDKEILAHKVTGKVKWFNVKKGYGFIHRDDVDEDVFVH
QSAISRCQPGKQKSLGEDEDVEFDVVKGLKGNEAMNVTGPRGDAVIGSKF
APSNDSYNHRENANNSYRNYDSRGWGRGITSRGRFIRNEGSRGSDEHRDN
YSSRGSRGGYQGARFDSSREDYSAPSYRGRGGRSRRPNQSRGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002059CSP_DNA-bd
IPR011129CSD
IPR012340NA-bd_OB-fold
IPR019844CSD_1
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006351transcription, DNA-templated
GO:0006397mRNA processing
GO:0008380RNA splicing
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0071204histone pre-mRNA 3'end processing complex