six3-1

Overview
Namesix3-1 (AFJ24873.1)
Smed IDSMED30010878
Length (bp)1297
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of six3-1 (SMED30010878) t-SNE clustered cells

Violin plots show distribution of expression levels for six3-1 (SMED30010878) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of six3-1 (SMED30010878) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for six3-1 (SMED30010878) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010878

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010878SMESG000009894.1 SmedASXL_004486SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30010878SMESG000009894.1 SmedASXL_004486SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30010878SMESG000009894.1 SMED30010878smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30010878SMESG000009894.1 SMED30010878smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30010878SMESG000009894.1 SMED30010878smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30010878SMESG000009894.1 SMED30010878smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30010878SMESG000009894.1 SMED30010878smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
headSMED30010878SMESG000009894.1 dd_Smed_v6_15178_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30010878SMESG000009894.1 JX010630.1smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of six3-1 vs. Ensembl Human
Match: SIX6 (SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892])

HSP 1 Score: 260.381 bits (664), Expect = 1.537e-84
Identity = 141/182 (77.47%), Postives = 164/182 (90.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   +  ++L++ ES+ RARA+VAFH GN+RELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Human
Match: SIX3 (SIX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:10889])

HSP 1 Score: 262.692 bits (670), Expect = 2.630e-84
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   87 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 271          
BLAST of six3-1 vs. Ensembl Human
Match: SIX1 (SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887])

HSP 1 Score: 216.853 bits (551), Expect = 4.910e-67
Identity = 111/181 (61.33%), Postives = 144/181 (79.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+++RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Ensembl Human
Match: SIX2 (SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888])

HSP 1 Score: 216.853 bits (551), Expect = 5.224e-67
Identity = 111/181 (61.33%), Postives = 146/181 (80.66%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+I+RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H+KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PR+IWDGE+ ++CFKE++R++LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 193.356 bits (490), Expect = 9.352e-56
Identity = 101/176 (57.39%), Postives = 130/176 (73.86%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDR 683
            FS + +  VCE L++ G++DRL+RFLWSLP    L       ES+ +ARALVAFH G + ELY+++E + F  A+H  LQ LW +A Y EAER RGR LG VDKYR+R+KFP+PRTIWDGE+  +CFKE++RN L+E Y  + YP+P++KR LA  TGL+ TQV NWFKNRRQRDR
Sbjct:  100 FSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRG----NESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 271          
BLAST of six3-1 vs. Ensembl Celegans
Match: ceh-32 (Homeobox protein ceh-32 [Source:UniProtKB/Swiss-Prot;Acc:Q23175])

HSP 1 Score: 216.083 bits (549), Expect = 2.585e-65
Identity = 120/197 (60.91%), Postives = 145/197 (73.60%), Query Frame = 3
Query:  123 LLAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQM 713
            L AP        + +QI K CE LE  GD+D L RF+ ++P   +   +    E+  RARALV FH  +FRELY ++E N+F+   H KLQ +W EAHY+E E+ RG+SL  VDKYRVRKK+PMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP KK++LA+ATGLT  QVGNWFKNRRQRDRAAAAKN + +
Sbjct:   57 LAAPSSPTTSNLTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAG--NEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQNI 251          
BLAST of six3-1 vs. Ensembl Celegans
Match: ceh-33 (Homeobox protein ceh-33 [Source:UniProtKB/Swiss-Prot;Acc:Q94166])

HSP 1 Score: 180.259 bits (456), Expect = 1.079e-53
Identity = 91/195 (46.67%), Postives = 120/195 (61.54%), Query Frame = 3
Query:  114 NSKLLAP--FMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAA 692
            NS    P  F C    +S EQ+  +CE L          R L          D +   + I +A+A +AFH  NF+ELY +IE + F    H  LQ  WL AHY EAE++RGR LG V KYR+R+K+P+PRTIWDGE+ ++CF++++R LLR+ Y  + YP+P +KR+LA  T LT TQV NWFKNRRQRDRA  
Sbjct:    4 NSSSFHPHHFTCDTTRYSEEQVACICEALSNDA------RKLSQFVWTVLERDEMRNNQYILKAQAFLAFHSNNFKELYRIIESHHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRVLLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRAGV 192          
BLAST of six3-1 vs. Ensembl Celegans
Match: ceh-34 (Homeobox protein ceh-34 [Source:UniProtKB/Swiss-Prot;Acc:Q94165])

HSP 1 Score: 153.295 bits (386), Expect = 1.642e-43
Identity = 71/137 (51.82%), Postives = 98/137 (71.53%), Query Frame = 3
Query:  282 ESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAA 692
            ES+ +A+ALV F   N++ LY L+E ++F+  +H+ LQ LWL+AHY+EA + + R LG V KYR+RKK P P TIWDGE+  +CFK ++RN+LR+ Y    YP+   KR+LA  T L+  QV NWFKN+RQR+RAA 
Sbjct:   57 ESVLKAQALVYFTTQNWKMLYKLLECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNPFPNTIWDGEETNYCFKSKSRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKRQRERAAG 193          
BLAST of six3-1 vs. Ensembl Celegans
Match: unc-39 (Homeobox protein unc-39 [Source:UniProtKB/Swiss-Prot;Acc:O17894])

HSP 1 Score: 132.88 bits (333), Expect = 4.673e-35
Identity = 77/218 (35.32%), Postives = 120/218 (55.05%), Query Frame = 3
Query:   39 SKHHRTINEVIDVIDRQIVQMNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXX-XXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLD-DPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRA 686
            S H  T + VI      +   +   +S  +  F C    +S+EQ+  +  +L +A D DRL  F   L S          R E+I  A     +H   F  L++L+    F +  ++ LQ +W  A Y+E++  RG+ L PV+KYR+R+KFP P+TIWDGE+  + FK+ +R  L++ + +   YP   +KR+++ ATGL   Q+ NWFKNRRQRD++
Sbjct:   60 SSHILTPSSVIPTPSPSVASASI--SSPTIPAFGCTMSEYSMEQMEAISTSLFQARDGDRLVAFFKQLESLYGPNAVDHLRSEAIIVAYTYALYHSNEFETLFHLLSNRHFQQRHYNDLQDIWHHARYKESQLKRGKELNPVEKYRLRRKFPAPKTIWDGEEIVYSFKDSSRKFLKQFFRNVSEYPTQEQKREISRATGLKIVQISNWFKNRRQRDKS 275          
BLAST of six3-1 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0088865)

HSP 1 Score: 252.292 bits (643), Expect = 1.195e-78
Identity = 139/188 (73.94%), Postives = 160/188 (85.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQ 719
            FS  Q+  VC+TLE++GDI+RL+RFLWSLP        +   E++ RARA+VA+HVGNFRELY +IE ++FTKAS+ KLQA+WLEAHY EAE+LRGRSLGPVDKYRVRKKFP+P TIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGL PTQVGNWFKNRRQRDRAAAAKN  Q SQ
Sbjct:   37 FSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQ 224          
BLAST of six3-1 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0329885)

HSP 1 Score: 252.292 bits (643), Expect = 1.498e-78
Identity = 139/188 (73.94%), Postives = 160/188 (85.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQ 719
            FS  Q+  VC+TLE++GDI+RL+RFLWSLP        +   E++ RARA+VA+HVGNFRELY +IE ++FTKAS+ KLQA+WLEAHY EAE+LRGRSLGPVDKYRVRKKFP+P TIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGL PTQVGNWFKNRRQRDRAAAAKN  Q SQ
Sbjct:   37 FSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQ 224          
BLAST of six3-1 vs. Ensembl Fly
Match: so (gene:FBgn0003460 transcript:FBtr0088970)

HSP 1 Score: 216.083 bits (549), Expect = 1.542e-65
Identity = 111/183 (60.66%), Postives = 144/183 (78.69%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNG 704
            F+ EQ+  VCE L++AG+I+RL RFLWSLP    L       ES+ +A+A+VAFH G ++ELY L+E + F+  +H+KLQALWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R++LR+ Y  +PYP+P +KR LA ATGLT TQV NWFKNRRQRDRAA  K+G
Sbjct:  103 FTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQL----NESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDG 281          
BLAST of six3-1 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078274)

HSP 1 Score: 202.216 bits (513), Expect = 2.199e-60
Identity = 99/177 (55.93%), Postives = 131/177 (74.01%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRA 686
            FS +QI  +CE L++ GDI++L+ FL SLP            ES+ RARA+VA+++G F ELYNL+E + F+   H  LQ LW +AHY+EAE++RGR LG VDKYR+RKK+P+P+TIWDGE+  +CFKE++RN L++CYL + YP P +K+ LA  TGLT TQV NWFKNRRQRDR 
Sbjct:  181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKT----NESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT 353          
BLAST of six3-1 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078275)

HSP 1 Score: 202.216 bits (513), Expect = 2.199e-60
Identity = 99/177 (55.93%), Postives = 131/177 (74.01%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRA 686
            FS +QI  +CE L++ GDI++L+ FL SLP            ES+ RARA+VA+++G F ELYNL+E + F+   H  LQ LW +AHY+EAE++RGR LG VDKYR+RKK+P+P+TIWDGE+  +CFKE++RN L++CYL + YP P +K+ LA  TGLT TQV NWFKNRRQRDR 
Sbjct:  181 FSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKT----NESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRT 353          
BLAST of six3-1 vs. Ensembl Zebrafish
Match: six7 (SIX homeobox 7 [Source:ZFIN;Acc:ZDB-GENE-990825-28])

HSP 1 Score: 266.159 bits (679), Expect = 8.490e-87
Identity = 131/185 (70.81%), Postives = 153/185 (82.70%), Query Frame = 3
Query:  153 LFSVEQITKVCETLEEAGDIDXXXXX--XXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            +F+ EQ+ +VCE LEE GDI+RL RF          S  + L+R ES+ RARALVAFH GNF  LY +++ +RFT+ SH+KLQ LWL+AHY+EAERLRGR LGPV+KYR+RKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPS+KR LA ATGLTPTQVGNWFKNRRQRDRAA+AKN
Sbjct:    6 MFTPEQVARVCENLEETGDIERLGRFLWSLPAAVPGSAGELLNRHESVMRARALVAFHGGNFEALYQILQSHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKN 190          
BLAST of six3-1 vs. Ensembl Zebrafish
Match: six3b (SIX homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-990415-128])

HSP 1 Score: 263.848 bits (673), Expect = 2.287e-85
Identity = 143/182 (78.57%), Postives = 161/182 (88.46%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS EQ+  VCETLEE GDI+RL RFLWSLP      D++++ ESIQRARA+VA+H G+FRELY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   49 FSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACDAINKHESIQRARAVVAYHTGSFRELYHILETHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 230          
BLAST of six3-1 vs. Ensembl Zebrafish
Match: six6b (SIX homeobox 6b [Source:ZFIN;Acc:ZDB-GENE-050522-308])

HSP 1 Score: 261.536 bits (667), Expect = 2.845e-85
Identity = 143/182 (78.57%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDI+RL RFLWSLP   +  + L+R ES+ RARA+VAFH GNFRELY+++E ++FTK SHSKLQALWLE+HYQEAE+LRGR LGPVDKYRVRKKFP+P+TIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEVLNRNESVLRARAIVAFHTGNFRELYHILENHKFTKESHSKLQALWLESHYQEAEKLRGRPLGPVDKYRVRKKFPLPKTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Zebrafish
Match: six6a (SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1282])

HSP 1 Score: 261.536 bits (667), Expect = 2.939e-85
Identity = 144/182 (79.12%), Postives = 162/182 (89.01%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   S  D L + ES+ RARA+VAFH GNFRELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPSACDVLGKNESVLRARAVVAFHAGNFRELYHILENHKFTKDSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Zebrafish
Match: six6a (SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1282])

HSP 1 Score: 261.536 bits (667), Expect = 2.939e-85
Identity = 144/182 (79.12%), Postives = 162/182 (89.01%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   S  D L + ES+ RARA+VAFH GNFRELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPSACDVLGKNESVLRARAVVAFHAGNFRELYHILENHKFTKDSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Xenopus
Match: tmem136 (transmembrane protein 136 [Source:Xenbase;Acc:XB-GENE-966251])

HSP 1 Score: 263.077 bits (671), Expect = 6.297e-85
Identity = 142/182 (78.02%), Postives = 161/182 (88.46%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   49 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 230          
BLAST of six3-1 vs. Ensembl Xenopus
Match: six6 (SIX homeobox 6 [Source:NCBI gene;Acc:100101705])

HSP 1 Score: 260.766 bits (665), Expect = 9.427e-85
Identity = 143/182 (78.57%), Postives = 164/182 (90.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDI+RL RFLWSLP   +  ++L++ ES+ RARA+VAFH GNFRELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNFRELYHILENHKFTKDSHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Xenopus
Match: six2 (SIX homeobox 2 [Source:NCBI gene;Acc:100101784])

HSP 1 Score: 216.853 bits (551), Expect = 4.195e-67
Identity = 111/181 (61.33%), Postives = 145/181 (80.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+I+RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PR+IWDGE+ ++CFKE++R++LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLH----KNESVLKAKAVVAFHRGNFRELYKILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Ensembl Xenopus
Match: six1 (SIX homeobox 1 [Source:NCBI gene;Acc:100101702])

HSP 1 Score: 216.083 bits (549), Expect = 7.134e-67
Identity = 111/181 (61.33%), Postives = 144/181 (79.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+++RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Ensembl Xenopus
Match: SIX4 (SIX homeobox 4 [Source:NCBI gene;Acc:100498150])

HSP 1 Score: 193.741 bits (491), Expect = 6.998e-54
Identity = 101/176 (57.39%), Postives = 127/176 (72.16%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDR 683
            FS E +  VCE L++ GD+DRLSRFL SLP    L       ESI +ARALV FH G + EL+ L+E + F  ++H+ LQ LW +A Y EAE+ RGR LG VDKYR+R+KFP+PRTIWDGE+  +CFKE++RN L+E Y  + YP+P+ KR LA  TGL+ TQV NWFKNRRQRDR
Sbjct:  150 FSPEHVACVCEALQQGGDLDRLSRFLCSLPHSELLRG----NESILKARALVTFHQGRYSELFLLLESHNFHPSNHAALQELWYKARYIEAEKARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKHNRYPSPAAKRNLAKVTGLSLTQVSNWFKNRRQRDR 321          
BLAST of six3-1 vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 262.692 bits (670), Expect = 1.988e-84
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   88 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 272          
BLAST of six3-1 vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 262.692 bits (670), Expect = 1.988e-84
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   88 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 272          
BLAST of six3-1 vs. Ensembl Mouse
Match: Six3 (sine oculis-related homeobox 3 [Source:MGI Symbol;Acc:MGI:102764])

HSP 1 Score: 263.077 bits (671), Expect = 2.524e-84
Identity = 142/182 (78.02%), Postives = 161/182 (88.46%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   88 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 269          
BLAST of six3-1 vs. Ensembl Mouse
Match: Six6 (sine oculis-related homeobox 6 [Source:MGI Symbol;Acc:MGI:1341840])

HSP 1 Score: 258.84 bits (660), Expect = 4.500e-84
Identity = 141/182 (77.47%), Postives = 164/182 (90.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   +  ++L++ ES+ RARA+VAFH GN+RELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 217.238 bits (552), Expect = 2.745e-67
Identity = 111/181 (61.33%), Postives = 146/181 (80.66%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+I+RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H+KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PR+IWDGE+ ++CFKE++R++LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. UniProt/SwissProt
Match: sp|O93307|SIX6_CHICK (Homeobox protein SIX6 OS=Gallus gallus OX=9031 GN=SIX6 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 3.173e-84
Identity = 142/182 (78.02%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDI+RL RFLWSLP   +  ++L++ ES+ RARA+VAFH GN+RELY+++E ++FTK SH KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNYRELYHILENHKFTKESHGKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. UniProt/SwissProt
Match: sp|O42406|SIX3_CHICK (Homeobox protein SIX3 OS=Gallus gallus OX=9031 GN=SIX3 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 7.260e-84
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   69 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 253          
BLAST of six3-1 vs. UniProt/SwissProt
Match: sp|O95475|SIX6_HUMAN (Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 7.382e-84
Identity = 141/182 (77.47%), Postives = 164/182 (90.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   +  ++L++ ES+ RARA+VAFH GN+RELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. UniProt/SwissProt
Match: sp|O95343|SIX3_HUMAN (Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=SIX3 PE=1 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.263e-83
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   87 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 271          
BLAST of six3-1 vs. UniProt/SwissProt
Match: sp|Q62233|SIX3_MOUSE (Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=Six3 PE=1 SV=2)

HSP 1 Score: 262.692 bits (670), Expect = 1.390e-83
Identity = 143/185 (77.30%), Postives = 162/185 (87.57%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   88 FSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 272          
BLAST of six3-1 vs. TrEMBL
Match: I1ZIL9 (Six3-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 350/350 (100.00%), Postives = 350/350 (100.00%), Query Frame = 3
Query:   96 QMNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSXXXXXXXXXXXXXXXXXXXSLEIVPKTHSKASSIISTNWSTVDNADDTXXXXXXXXXETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM 1145
            QMNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDRLSRFLWSLPSFSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSEDEKFEDEIAEDDDEIAYESLEIVPKTHSKASSIISTNWSTVDNADDTNINNIINNNETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM
Sbjct:    1 QMNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDRLSRFLWSLPSFSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSEDEKFEDEIAEDDDEIAYESLEIVPKTHSKASSIISTNWSTVDNADDTNINNIINNNETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM 350          
BLAST of six3-1 vs. TrEMBL
Match: Q8I9M8 (Six3 (Fragment) OS=Girardia tigrina OX=6162 PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 5.029e-121
Identity = 219/258 (84.88%), Postives = 233/258 (90.31%), Query Frame = 3
Query:   99 MNCKQN--SKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSXXXX-XXXXXXXXXXXXXXXSLEIVPKTHSKASSIISTNWSTVDNADD 863
            MN + N  S LL+PFM H QLFS +QITKVCETLEEAGDIDRLSRFLWSLPSF++LW+SLSR+ESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ+SQSEDEK  +D   + DDE  + SLEIV    SKASS++S NWS  DN +D
Sbjct:    1 MNKQTNKLSNLLSPFMNHTQLFSADQITKVCETLEEAGDIDRLSRFLWSLPSFNALWESLSRRESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQLSQSEDEKFEDDIEEDGDDENVFGSLEIVENNPSKASSLVSANWSNADNTED 258          
BLAST of six3-1 vs. TrEMBL
Match: A0A5S6R1R5 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.210e-92
Identity = 146/188 (77.66%), Postives = 166/188 (88.30%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQ 719
            FS EQ+  VCETLEE+GDIDRL+RFLWSLP     +  L++ E++ RARA+VAFH+GNFRE+Y+++E NRFTKASH+KLQA+WLEAHYQEA +LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGLTPTQVGNWFKNRRQRDRAAA KN  QM Q
Sbjct:   44 FSSEQVASVCETLEESGDIDRLARFLWSLPVAHPNFIELNKNEAVLRARAIVAFHMGNFREMYHILENNRFTKASHAKLQAMWLEAHYQEAAKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAVKNRLQMMQ 231          
BLAST of six3-1 vs. TrEMBL
Match: A0A077Z577 (Homeobox protein SIX3 OS=Trichuris trichiura OX=36087 GN=TTRE_0000353301 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 3.944e-90
Identity = 142/182 (78.02%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDIDRL+RFLWSLP     +  L++ E++ RARA+VAFH+GNFRE+Y+++E NRFTKASH+KLQA+WLEAHYQEA +LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGLTPTQVGNWFKNRRQRDRAAA KN
Sbjct:   44 FSSDQVASVCETLEESGDIDRLARFLWSLPVAHPNFIELNKNEAVLRARAIVAFHMGNFREMYHILENNRFTKASHAKLQAMWLEAHYQEAAKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAVKN 225          
BLAST of six3-1 vs. TrEMBL
Match: A0A0V1A4X6 (Homeobox protein SIX6 (Fragment) OS=Trichinella patagoniensis OX=990121 GN=SIX6 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 4.001e-90
Identity = 142/188 (75.53%), Postives = 163/188 (86.70%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQ 719
            FS EQ+  VCETLEE+GD++RL+RFLWSLP     +  L++ E++ RARALVAFH+ NFRELY+++E NRF K SH+KLQA+WLEAHYQEA +LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGLTPTQVGNWFKNRRQRDRAAA KN  Q+ Q
Sbjct:   38 FSSEQVASVCETLEESGDVERLARFLWSLPVAHPNFLELNKNEAVLRARALVAFHMSNFRELYHILESNRFAKGSHAKLQAMWLEAHYQEAAKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAVKNRMQLIQ 225          
BLAST of six3-1 vs. Ensembl Cavefish
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:103038426])

HSP 1 Score: 264.618 bits (675), Expect = 3.105e-86
Identity = 130/192 (67.71%), Postives = 156/192 (81.25%), Query Frame = 3
Query:  153 LFSVEQITKVCETLEEAGDIDXXXXX--XXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQS 722
            +F+ +Q+ +VCE LEE GD++RL RF          +  ++L+R ES+ RARALVAFH GNF  LY +++ +RFT+ SH+KLQ LWL+AHY+EAERLRGR LGPV+KYR+RKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPS+KR LA ATGLTPTQVGNWFKNRRQRDRAA+AKN  Q   S
Sbjct:    6 MFTPDQVARVCENLEETGDMERLGRFLWSLPAAVPGAAGEALNRHESVMRARALVAFHGGNFEALYQILQNHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKNRLQQDPS 197          
BLAST of six3-1 vs. Ensembl Cavefish
Match: six3a (SIX homeobox 3 [Source:NCBI gene;Acc:103025522])

HSP 1 Score: 263.848 bits (673), Expect = 1.595e-85
Identity = 148/213 (69.48%), Postives = 173/213 (81.22%), Query Frame = 3
Query:   81 DRQIVQMNCKQNSKL---LAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            DR ++  N   +++    L+ F      FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   21 DRPLLLANSAPSARSPEDLSMFQLPTLNFSAEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 233          
BLAST of six3-1 vs. Ensembl Cavefish
Match: six6b (homeobox protein SIX6 [Source:NCBI gene;Acc:103035477])

HSP 1 Score: 261.536 bits (667), Expect = 2.653e-85
Identity = 143/182 (78.57%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDI+RL RFLWSLP   +  + L+R ES+ RARA+VAFH GNFRELY+++E ++FTK SHSKLQALWLE+HYQEAE+LRGR LGPVDKYRVRKKFP+P+TIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEVLNRNESVLRARAIVAFHTGNFRELYHILENHKFTKESHSKLQALWLESHYQEAEKLRGRPLGPVDKYRVRKKFPLPKTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Cavefish
Match: six3b (homeobox protein SIX6-like [Source:NCBI gene;Acc:103035166])

HSP 1 Score: 256.914 bits (655), Expect = 6.567e-83
Identity = 137/183 (74.86%), Postives = 156/183 (85.25%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXX-XXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            F+ EQ+  VCETLEE GD++RL RFL     +     ++L + E+IQRARA+VA+H G+FRELY ++E +RFTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   51 FTAEQVAGVCETLEETGDVERLGRFLWSLPVAPPGACEALDKHEAIQRARAVVAYHTGSFRELYRILESHRFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 233          
BLAST of six3-1 vs. Ensembl Cavefish
Match: six1b (homeobox protein six1b [Source:NCBI gene;Acc:103034839])

HSP 1 Score: 216.853 bits (551), Expect = 2.482e-67
Identity = 111/181 (61.33%), Postives = 144/181 (79.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+++RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002854.1 (pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 gene:ENSPMAG00000002608.1 transcript:ENSPMAT00000002854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 255.373 bits (651), Expect = 8.334e-84
Identity = 140/182 (76.92%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GDI+RL RFLWSLP     W++L+RQE++ RARA+VAFH  N+R+LY ++E ++F+KASH+KLQA+WLEAHY EAERLRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   41 FSPQQVASVCETLEESGDIERLGRFLWSLPVAPGAWEALNRQEAVLRARAVVAFHASNYRDLYAILEGHKFSKASHAKLQAMWLEAHYLEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 222          
BLAST of six3-1 vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 192.2 bits (487), Expect = 2.603e-60
Identity = 88/132 (66.67%), Postives = 107/132 (81.06%), Query Frame = 3
Query:  276 RQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRR 671
            R ESI  A+A+VAFH GNFRELY ++E   F+  +H KLQ LWL+AHY EAERLRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKER+R +LR+ Y  +PYP+P +KR+LA ATGLT TQV NWFKNRR
Sbjct:   19 RSESILMAKAVVAFHQGNFRELYAVLESQPFSARNHPKLQQLWLKAHYTEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKERSRGVLRDWYAHNPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of six3-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 6.408e-37
Identity = 57/63 (90.48%), Postives = 60/63 (95.24%), Query Frame = 3
Query:  483 KFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRR 671
            KFP+P+TIWDGEQKTHCFKERTRNLLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRR
Sbjct:    1 KFPLPKTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of six3-1 vs. Ensembl Sea Lamprey
Match: Six4 (pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 gene:ENSPMAG00000010180.1 transcript:ENSPMAT00000011207.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Six4)

HSP 1 Score: 93.2041 bits (230), Expect = 5.792e-24
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 3
Query:  483 KFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRR 671
            KFP+PRTIWDGE+  +CFKE++RN L++CY    YP P +KR+LA  TGL+  QV NWFKNRR
Sbjct:    1 KFPLPRTIWDGEETVYCFKEKSRNFLKDCYRRTRYPAPDEKRRLAKLTGLSVVQVSNWFKNRR 63          
BLAST of six3-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001924.1 (pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:ENSPMAG00000001748.1 transcript:ENSPMAT00000001924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.374e-9
Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  168 QITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWL 407
            Q+  VCE L++ GD+      L           + SR E++ RARA VAFH G++RELY+++E + F    H+ L AL L
Sbjct:    1 QVACVCEALQQGGDV----ARLARFLWALPGPAAASRDEAVLRARAHVAFHSGSYRELYDVLEGHAFEARHHAALLALSL 76          
BLAST of six3-1 vs. Ensembl Nematostella
Match: EDO33059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST96])

HSP 1 Score: 262.307 bits (669), Expect = 9.349e-87
Identity = 141/182 (77.47%), Postives = 164/182 (90.11%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS  QI +VCETLEE+GD++RL+RFLWSLP      ++L + ES+ RARA+VAFH+GNFR+LY+++E +RFT+ SH+KLQA+WLEAHYQEAERLRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   10 FSAHQIAQVCETLEESGDVERLARFLWSLPVAPGTLEALGKHESVLRARAIVAFHMGNFRDLYHILETHRFTRESHAKLQAMWLEAHYQEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 191          
BLAST of six3-1 vs. Ensembl Nematostella
Match: EDO34334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN4])

HSP 1 Score: 216.468 bits (550), Expect = 5.779e-69
Identity = 110/181 (60.77%), Postives = 144/181 (79.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L+++GDI+RL RFLWSLP   ++     + ES+ +A+A+V+FH  NF+ELY ++E N F+  +H KLQ+LWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++RN+LRE Y  +PYP+P +KR+LA  TGLT TQV NWFKNRRQRDRAA AK
Sbjct:    7 FTPEQVACVCEVLQQSGDIERLGRFLWSLPECETIQ----KNESVLKAKAIVSFHQQNFQELYRILENNNFSPNAHPKLQSLWLKAHYMEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNILREWYSHNPYPSPREKRELAEGTGLTTTQVSNWFKNRRQRDRAAEAK 183          
BLAST of six3-1 vs. Ensembl Nematostella
Match: EDO42933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S005])

HSP 1 Score: 198.749 bits (504), Expect = 3.802e-62
Identity = 104/178 (58.43%), Postives = 135/178 (75.84%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAA 689
            FS+EQI  VCE L+ +G+I+RL+RFLWSLP  S    +    E+I  A+A+VAFH  NF+ELY+++E  +F ++ H KLQ LW  AHY EAER+RGR LG V KYRVR+KFP+PRTIWDGE+ T+CFKE++R++L + Y+D PYP P +K +LA  T LT TQV NWFKN+RQR RAA
Sbjct:    3 FSMEQIISVCECLQNSGNIERLARFLWSLPKDSEEIHAC---ETILVAKAVVAFHQNNFKELYSILESRKFQRSEHEKLQCLWRTAHYIEAERVRGRPLGAVGKYRVRRKFPLPRTIWDGEETTYCFKEKSRSILNKAYVDSPYPTPREKHELAKMTDLTVTQVSNWFKNKRQRVRAA 177          
BLAST of six3-1 vs. Ensembl Nematostella
Match: EDO31034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ27])

HSP 1 Score: 193.356 bits (490), Expect = 3.125e-60
Identity = 102/178 (57.30%), Postives = 130/178 (73.03%), Query Frame = 3
Query:  165 EQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            +Q+  VC+ L +AGDI+RLSRFLWSLP    L       ES+ +ARA+V+FH G +RE+YN++E N F  +SH  LQ LW +AHY EAE+LRGRSLG VDKYR+R+KFP+PRTIWDGE+  +CFKE+ R  L++CY  + YP P +KR +A  T LT  QV NWFKNRRQRDR  + K
Sbjct:    1 DQVACVCDALRQAGDIERLSRFLWSLPPDDLLNG----SESVLKARAIVSFHRGRYREVYNILETNEFDPSSHELLQCLWYKAHYSEAEKLRGRSLGAVDKYRIRRKFPLPRTIWDGEETVYCFKEKARAALKDCYEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKNRRQRDRIPSNK 174          
BLAST of six3-1 vs. Ensembl Nematostella
Match: EDO33407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS98])

HSP 1 Score: 160.229 bits (404), Expect = 1.243e-47
Identity = 79/169 (46.75%), Postives = 111/169 (65.68%), Query Frame = 3
Query:  165 EQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRR 671
            +Q+  +C+ L + GDI    + L          D  ++ ES+ +ARA+VAFH G ++E+YN++E N+F  +SH  LQ LW +AHY E E+LRGRSL  VDK+R+RKK P+P TI DGE+  + FKE+ R +L+ECY    YP   +KR +A+ T LT  QV NWF+NRR
Sbjct:    1 DQVACICDALFQEGDI----KRLSQFLLSIPQEDLQNKSESLLKARAMVAFHRGCYQEVYNILENNKFDTSSHEFLQCLWYKAHYSEGEKLRGRSLSAVDKFRIRKKSPLPNTISDGEKTIYFFKEKVRTVLKECYEHKKYPTLKEKRVIATQTNLTLRQVRNWFRNRR 165          
BLAST of six3-1 vs. Ensembl Medaka
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:101175353])

HSP 1 Score: 268.855 bits (686), Expect = 6.266e-88
Identity = 133/192 (69.27%), Postives = 157/192 (81.77%), Query Frame = 3
Query:  153 LFSVEQITKVCETLEEAGDIDXXXXX--XXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQS 722
            +F+ +Q+ +VCE LEE GDI+RL RF          S  ++L+R ES+ RARALVAFHVGNF  LY +++ +RFT+ SH+KLQ LWL+AHY+EAERLRGR LGPV+KYR+RKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPS+KR LA ATGLTPTQVGNWFKNRRQRDRAA+AKN  Q   S
Sbjct:    6 MFTPDQVARVCENLEETGDIERLGRFLWSLPAAVPGSAGEALNRHESVMRARALVAFHVGNFEALYQILQSHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKNRLQQDPS 197          
BLAST of six3-1 vs. Ensembl Medaka
Match: six3 (SIX homeobox 3 [Source:NCBI gene;Acc:100144381])

HSP 1 Score: 263.077 bits (671), Expect = 8.951e-85
Identity = 148/213 (69.48%), Postives = 172/213 (80.75%), Query Frame = 3
Query:   81 DRQIVQMNCKQNSKL---LAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQ 710
            DR ++  N    ++    L+ F      FS EQ+  VCETLEE GDI+RL RFLWSLP      +++++ ESI RARA+VAFH GNFR+LY+++E ++FTK SH KLQA+WLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN  Q
Sbjct:   50 DRPLLLANSAPTTRSPEDLSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKDSHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQ 262          
BLAST of six3-1 vs. Ensembl Medaka
Match: six6a (SIX homeobox 6 [Source:NCBI gene;Acc:101154821])

HSP 1 Score: 259.996 bits (663), Expect = 1.022e-84
Identity = 142/182 (78.02%), Postives = 163/182 (89.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            FS +Q+  VCETLEE+GD++RL RFLWSLP   +  + L++ ES+ RARA+VAFH GNFRELY+++E ++FTK SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR+LLRE YL DPYPNPSKKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:    9 FSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEVLNKNESVLRARAVVAFHTGNFRELYHILENHKFTKESHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKN 190          
BLAST of six3-1 vs. Ensembl Medaka
Match: six3 (sine oculis homeobox homolog 3 [Source:NCBI gene;Acc:100049355])

HSP 1 Score: 258.455 bits (659), Expect = 9.566e-84
Identity = 146/190 (76.84%), Postives = 163/190 (85.79%), Query Frame = 3
Query:  132 PFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKN 701
            P +C    FS  QI  VCETLEE GDI+RL+RFLWSLP  +   DS+S  ES+QRARA+VAFH G +RELY ++E +RFT+ASHSKLQA+WLEAHY+EAE+LRGR LGPVDKYRVRKKFP+PRTIWDGEQKTHCFKERTR LLRE YL DPYPNP KKR+LA ATGLTPTQVGNWFKNRRQRDRAAAAKN
Sbjct:   46 PGLC----FSATQIASVCETLEETGDIERLARFLWSLPVNTDGRDSISEHESVQRARAVVAFHTGCYRELYRILETHRFTRASHSKLQAMWLEAHYREAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRGLLREWYLQDPYPNPGKKRELAHATGLTPTQVGNWFKNRRQRDRAAAAKN 231          
BLAST of six3-1 vs. Ensembl Medaka
Match: six1b (SIX homeobox 1 [Source:NCBI gene;Acc:101175523])

HSP 1 Score: 216.853 bits (551), Expect = 2.493e-67
Identity = 111/181 (61.33%), Postives = 144/181 (79.56%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK 698
            F+ EQ+  VCE L++ G+++RL RFLWSLP+   L     + ES+ +A+A+VAFH GNFRELY ++E ++F+  +H KLQ LWL+AHY EAE+LRGR LG V KYRVR+KFP+PRTIWDGE+ ++CFKE++R +LRE Y  +PYP+P +KR+LA ATGLT TQV NWFKNRRQRDRAA AK
Sbjct:    9 FTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLH----KNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of six3-1 vs. Planmine SMEST
Match: SMESG000009894.1 (SMESG000009894.1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 349/349 (100.00%), Postives = 349/349 (100.00%), Query Frame = 3
Query:   99 MNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSXXXXXXXXXXXXXXXXXXXSLEIVPKTHSKASSIISTNWSTVDNADDTXXXXXXXXXETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM 1145
            MNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDRLSRFLWSLPSFSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSEDEKFEDEIAEDDDEIAYESLEIVPKTHSKASSIISTNWSTVDNADDTNINNIINNNETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM
Sbjct:    1 MNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDRLSRFLWSLPSFSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQSEDEKFEDEIAEDDDEIAYESLEIVPKTHSKASSIISTNWSTVDNADDTNINNIINNNETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEFLERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM 349          
BLAST of six3-1 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 288.5 bits (737), Expect = 1.041e-92
Identity = 153/220 (69.55%), Postives = 182/220 (82.73%), Query Frame = 3
Query:   66 VIDVIDRQIVQMNCKQNSKLLAPFMCHNQL------FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGR 707
            +I+ I   +  ++  QNS L    + +  L      F+ +QI KVCETLEE+GDI+RL RFLWS+P+ S LW SL+  E++ RARA+VAFH GNFRELY+++EK+ F K+SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LASATGLTPTQVGNWFKNRRQRDRAAA+K+ R
Sbjct:   11 IINNISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRR 230          
BLAST of six3-1 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 288.115 bits (736), Expect = 1.417e-92
Identity = 153/220 (69.55%), Postives = 182/220 (82.73%), Query Frame = 3
Query:   66 VIDVIDRQIVQMNCKQNSKLLAPFMCHNQL------FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGR 707
            +I+ I   +  ++  QNS L    + +  L      F+ +QI KVCETLEE+GDI+RL RFLWS+P+ S LW SL+  E++ RARA+VAFH GNFRELY+++EK+ F K+SH+KLQALWLEAHYQEAE+LRGR LGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTR+LLRE YL DPYPNP+KKR+LASATGLTPTQVGNWFKNRRQRDRAAA+K+ R
Sbjct:    4 IINNISHNLQSISNSQNSTLNPSSLSNPGLQVWPFQFAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHRR 223          
BLAST of six3-1 vs. Planmine SMEST
Match: SMESG000020326.1 (SMESG000020326.1)

HSP 1 Score: 241.121 bits (614), Expect = 2.908e-77
Identity = 123/189 (65.08%), Postives = 152/189 (80.42%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMSQS 722
            FS+ QI +VCE LEE+GDI RL+RFLW L S  S+W+SL   ESI RAR++VAFH GN+ ELY ++E +RF+  SH KLQ+ W +AHY EAE+LRGR+LGPVDKYRVRK+ P+P TIWDG+Q+THCF+ERTR LL++CY  DPYPNP+KKR+LA  TGLT TQVGNWFKNRRQRDRAA  +     ++S
Sbjct:   23 FSLSQICQVCENLEESGDIKRLARFLWCLSSCQSIWNSLLHHESILRARSIVAFHSGNYAELYFILENHRFSSQSHMKLQSFWFDAHYSEAEKLRGRALGPVDKYRVRKRHPLPSTIWDGQQRTHCFQERTRCLLKDCYSKDPYPNPNKKRELAIRTGLTATQVGNWFKNRRQRDRAALGRTDMASTRS 211          
BLAST of six3-1 vs. Planmine SMEST
Match: SMESG000005975.1 (SMESG000005975.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.441e-65
Identity = 111/187 (59.36%), Postives = 145/187 (77.54%), Query Frame = 3
Query:  156 FSVEQITKVCETLEEAGDIDXXXXXXXXXXXXXXXXXXXXRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQALWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAKNGRQMS 716
            F+ EQ+  VCE L++ G IDRL+RFLWSLP+   L     + ES+ +A+A+VAFH GNF+ELY ++E + F+  +H KLQ LWL+AHY E+E++RGR LG V KYRVRKKFP+PRTIWDG++ ++CFKE++RN+LRE Y  +PYP P +KR+LA ATGLT TQV NWFKNRRQRDRA+  K G + S
Sbjct:  103 FTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQ----KNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKEGNEGS 285          
The following BLAST results are available for this feature:
BLAST of six3-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIX61.537e-8477.47SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892][more]
SIX32.630e-8477.30SIX homeobox 3 [Source:HGNC Symbol;Acc:HGNC:10889][more]
SIX14.910e-6761.33SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887][more]
SIX25.224e-6761.33SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888][more]
SIX49.352e-5657.39SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
back to top
BLAST of six3-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ceh-322.585e-6560.91Homeobox protein ceh-32 [Source:UniProtKB/Swiss-P... [more]
ceh-331.079e-5346.67Homeobox protein ceh-33 [Source:UniProtKB/Swiss-P... [more]
ceh-341.642e-4351.82Homeobox protein ceh-34 [Source:UniProtKB/Swiss-P... [more]
unc-394.673e-3535.32Homeobox protein unc-39 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of six3-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Optix1.195e-7873.94gene:FBgn0025360 transcript:FBtr0088865[more]
Optix1.498e-7873.94gene:FBgn0025360 transcript:FBtr0329885[more]
so1.542e-6560.66gene:FBgn0003460 transcript:FBtr0088970[more]
Six42.199e-6055.93gene:FBgn0027364 transcript:FBtr0078274[more]
Six42.199e-6055.93gene:FBgn0027364 transcript:FBtr0078275[more]
back to top
BLAST of six3-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six78.490e-8770.81SIX homeobox 7 [Source:ZFIN;Acc:ZDB-GENE-990825-28... [more]
six3b2.287e-8578.57SIX homeobox 3b [Source:ZFIN;Acc:ZDB-GENE-990415-1... [more]
six6b2.845e-8578.57SIX homeobox 6b [Source:ZFIN;Acc:ZDB-GENE-050522-3... [more]
six6a2.939e-8579.12SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
six6a2.939e-8579.12SIX homeobox 6a [Source:ZFIN;Acc:ZDB-GENE-040426-1... [more]
back to top
BLAST of six3-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1366.297e-8578.02transmembrane protein 136 [Source:Xenbase;Acc:XB-G... [more]
six69.427e-8578.57SIX homeobox 6 [Source:NCBI gene;Acc:100101705][more]
six24.195e-6761.33SIX homeobox 2 [Source:NCBI gene;Acc:100101784][more]
six17.134e-6761.33SIX homeobox 1 [Source:NCBI gene;Acc:100101702][more]
SIX46.998e-5457.39SIX homeobox 4 [Source:NCBI gene;Acc:100498150][more]
back to top
BLAST of six3-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Six31.988e-8477.30sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six31.988e-8477.30sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six32.524e-8478.02sine oculis-related homeobox 3 [Source:MGI Symbol;... [more]
Six64.500e-8477.47sine oculis-related homeobox 6 [Source:MGI Symbol;... [more]
Six22.745e-6761.33sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
back to top
BLAST of six3-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O93307|SIX6_CHICK3.173e-8478.02Homeobox protein SIX6 OS=Gallus gallus OX=9031 GN=... [more]
sp|O42406|SIX3_CHICK7.260e-8477.30Homeobox protein SIX3 OS=Gallus gallus OX=9031 GN=... [more]
sp|O95475|SIX6_HUMAN7.382e-8477.47Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=S... [more]
sp|O95343|SIX3_HUMAN1.263e-8377.30Homeobox protein SIX3 OS=Homo sapiens OX=9606 GN=S... [more]
sp|Q62233|SIX3_MOUSE1.390e-8377.30Homeobox protein SIX3 OS=Mus musculus OX=10090 GN=... [more]
back to top
BLAST of six3-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL90.000e+0100.00Six3-1 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
Q8I9M85.029e-12184.88Six3 (Fragment) OS=Girardia tigrina OX=6162 PE=2 S... [more]
A0A5S6R1R52.210e-9277.66Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A077Z5773.944e-9078.02Homeobox protein SIX3 OS=Trichuris trichiura OX=36... [more]
A0A0V1A4X64.001e-9075.53Homeobox protein SIX6 (Fragment) OS=Trichinella pa... [more]
back to top
BLAST of six3-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six73.105e-8667.71homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six3a1.595e-8569.48SIX homeobox 3 [Source:NCBI gene;Acc:103025522][more]
six6b2.653e-8578.57homeobox protein SIX6 [Source:NCBI gene;Acc:103035... [more]
six3b6.567e-8374.86homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six1b2.482e-6761.33homeobox protein six1b [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of six3-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002854.18.334e-8476.92pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 g... [more]
six1a2.603e-6066.67SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
ENSPMAT00000011157.16.408e-3790.48pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
Six45.792e-2461.90pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 g... [more]
ENSPMAT00000001924.12.374e-938.75pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:... [more]
back to top
BLAST of six3-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of six3-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO330599.349e-8777.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343345.779e-6960.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429333.802e-6258.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310343.125e-6057.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334071.243e-4746.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of six3-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six76.266e-8869.27homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
six38.951e-8569.48SIX homeobox 3 [Source:NCBI gene;Acc:100144381][more]
six6a1.022e-8478.02SIX homeobox 6 [Source:NCBI gene;Acc:101154821][more]
six39.566e-8476.84sine oculis homeobox homolog 3 [Source:NCBI gene;A... [more]
six1b2.493e-6761.33SIX homeobox 1 [Source:NCBI gene;Acc:101175523][more]
back to top
BLAST of six3-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009894.10.000e+0100.00SMESG000009894.1[more]
SMESG000017729.11.041e-9269.55SMESG000017729.1[more]
SMESG000017729.11.417e-9269.55SMESG000017729.1[more]
SMESG000020326.12.908e-7765.08SMESG000020326.1[more]
SMESG000005975.11.441e-6559.36SMESG000005975.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010878
GenBankAFJ24873.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010878 ID=SMED30010878|Name=six3-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1297bp
AACAATTCATGGACCAATGGAATCTCAAACAATGAAATAGCAAGCATCAC
AGAACAATAAATGAAGTAATTGATGTAATTGACCGTCAAATTGTACAAAT
GAATTGTAAGCAAAATAGCAAGTTACTGGCGCCATTTATGTGCCATAATC
AACTGTTTTCAGTGGAACAAATAACCAAGGTTTGTGAAACGCTAGAAGAA
GCCGGGGATATTGATCGTTTGTCTCGGTTTCTATGGTCGCTTCCATCATT
TAGTTCCCTTTGGGATTCTCTCAGTCGCCAGGAATCAATTCAACGAGCTC
GTGCGTTAGTTGCGTTTCATGTTGGCAATTTTCGAGAACTCTACAATTTA
ATCGAAAAGAACCGATTTACGAAAGCGTCTCATTCAAAACTCCAAGCTCT
TTGGTTGGAGGCTCACTACCAAGAAGCTGAGCGATTGCGAGGCCGAAGTC
TTGGTCCGGTTGATAAATATCGTGTCCGGAAAAAGTTTCCAATGCCTCGA
ACGATTTGGGATGGAGAACAAAAAACCCATTGTTTCAAAGAGCGAACTAG
AAATCTGTTAAGAGAATGTTATCTCGACGATCCGTATCCGAATCCATCAA
AGAAACGCCAACTGGCATCAGCTACCGGACTGACGCCAACCCAAGTTGGG
AATTGGTTCAAAAATCGTCGACAAAGAGACAGAGCAGCGGCTGCAAAAAA
CGGTCGTCAAATGAGTCAATCGGAAGATGAAAAGTTTGAAGATGAAATTG
CTGAAGATGATGACGAGATTGCTTACGAGTCTCTTGAAATCGTTCCGAAG
ACCCATTCAAAAGCCTCGTCGATTATTTCAACAAACTGGTCCACAGTTGA
CAATGCCGACGACACCAATATTAATAATATTATTAATAATAATGAGACTG
ATAAAAACAAACCGATTGCTGTGATCCGTAACCTTGTGAAGGACTCAAGA
AAAACCTTTAATGTTGCAGACATCCTCGACACGAGAAAAGGAGAATTTTT
AGAGAGAAAATCCGAATTCGGATTCAATCCGATAAGCCATCCGAATATTC
CGTTGTATTTACTGCCACACTTCAACAATTTCCTTCAGAACTTCGCCAAT
TCTTTGCCTGAATCGAGAAACCCATTCGTTTCCTACGGTCTAATGTAGTG
TGGAGAGGGGGAGGAAGGGGGGGAGAGGAGGCTTGAGAGTAAAAATTGAT
TTTAGATTTTAGATTTTAGTTGTGAAGGATGAAAAAAAAATTTTATTCTT
TCACTGGAAAAAAATTATTGTAAATTAAACTTGAATTTCTGTACAAA
back to top

protein sequence of SMED30010878-orf-1

>SMED30010878-orf-1 ID=SMED30010878-orf-1|Name=SMED30010878-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=350bp
MNCKQNSKLLAPFMCHNQLFSVEQITKVCETLEEAGDIDRLSRFLWSLPS
FSSLWDSLSRQESIQRARALVAFHVGNFRELYNLIEKNRFTKASHSKLQA
LWLEAHYQEAERLRGRSLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERT
RNLLRECYLDDPYPNPSKKRQLASATGLTPTQVGNWFKNRRQRDRAAAAK
NGRQMSQSEDEKFEDEIAEDDDEIAYESLEIVPKTHSKASSIISTNWSTV
DNADDTNINNIINNNETDKNKPIAVIRNLVKDSRKTFNVADILDTRKGEF
LERKSEFGFNPISHPNIPLYLLPHFNNFLQNFANSLPESRNPFVSYGLM*
back to top
Aliases
The feature 'six3-1' has the following synonyms
Synonym
six3-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR031701SIX1_SD
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 140..201
e-value: 2.6E-13
score: 60.2
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 144..195
e-value: 1.7E-12
score: 47.0
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 137..197
score: 14.139
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 141..189
e-value: 1.41128E-9
score: 51.4753
IPR031701Homeobox protein SIX1, N-terminal SD domainPFAMPF16878SIX1_SDcoord: 20..134
e-value: 1.1E-44
score: 151.4
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 138..210
e-value: 4.7E-16
score: 60.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 168..216
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 169..187
NoneNo IPR availablePANTHERPTHR10390HOMEOBOX PROTEIN SIXcoord: 19..276
NoneNo IPR availablePANTHERPTHR10390:SF33PROTEIN OPTIXcoord: 19..276
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 137..200