Gln-synt_C domain-containing protein

Overview
NameGln-synt_C domain-containing protein
Smed IDSMED30010872
Length (bp)1518
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gln-synt_C domain-containing protein (SMED30010872) t-SNE clustered cells

Violin plots show distribution of expression levels for Gln-synt_C domain-containing protein (SMED30010872) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gln-synt_C domain-containing protein (SMED30010872) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gln-synt_C domain-containing protein (SMED30010872) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010872

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30010872SMESG000003829.1 dd_Smed_v4_2247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30010872SMESG000003829.1 dd_Smed_v4_2247_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010872SMESG000003829.1 dd_Smed_v4_2247_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30010872SMESG000003829.1 dd_Smed_v4_2247_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Match: LGSN (lengsin, lens protein with glutamine synthetase domain [Source:HGNC Symbol;Acc:HGNC:21016])

HSP 1 Score: 140.198 bits (352), Expect = 1.474e-35
Identity = 122/450 (27.11%), Postives = 201/450 (44.67%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICII-GMIGT--NXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTD---KKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRI---QSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNK---LQLPEHGNGSH---CERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYF 1433
            +QF++    D++G+SR K  P     +   K    +C+  G +    N +        +   N+ +VL  + ST RV PW+     A V  D +   G  PL  +PR +AK +++ L+A    L+     +F IF   +    K +      +   H       +++EL   L      ++S++     GQ+EI  L   GI   D  +  +   K VA K   +AS+       +SG    ++HSLW    K   N        ++L+  GK WLAG+LKHS  LS + +P+V+C +R    +  L      +W Y D S    +K     EK   IEN++ S+  N YL +A  + AG+DG+ +    L  P+     +      +P  L +AL AL++D+ L + LG  F+ ++V          +K  +L N        +F++YF
Sbjct:   85 LQFVRFEATDLHGVSRSKTIPAHFFQE---KVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWAD--RTARVICDTFTVTGE-PLLTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHD----QPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSG---ILSHSLWDVDRK--KNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHG--EKGTRIENKLGSATANPYLVLAATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFV---------AMKKYELENEEIAAERNKFLEYF 508          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 58.5362 bits (140), Expect = 1.791e-8
Identity = 48/183 (26.23%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +      +  E +++LS+  +Y +      G L ++R L+  +  T N            +  S    +RS ++R+  +   EK  Y E+R PS+ C+ +     +I
Sbjct:  322 VKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 490          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 58.151 bits (139), Expect = 1.792e-8
Identity = 48/183 (26.23%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +      +  E +++LS+  +Y +      G L ++R L+  +  T N            +  S    +RS ++R+  +   EK  Y E+R PS+ C+ +     +I
Sbjct:  188 VKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 58.151 bits (139), Expect = 1.792e-8
Identity = 48/183 (26.23%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +      +  E +++LS+  +Y +      G L ++R L+  +  T N            +  S    +RS ++R+  +   EK  Y E+R PS+ C+ +     +I
Sbjct:  188 VKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 58.151 bits (139), Expect = 1.792e-8
Identity = 48/183 (26.23%), Postives = 82/183 (44.81%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +      +  E +++LS+  +Y +      G L ++R L+  +  T N            +  S    +RS ++R+  +   EK  Y E+R PS+ C+ +     +I
Sbjct:  188 VKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 69.3218 bits (168), Expect = 5.069e-13
Identity = 58/197 (29.44%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDE-LSEIGKYWLAGILKHSRGLSAIYSP--TVNCYRRIQS--ALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI-VAGIDGIKNKLQL 1211
            I I   N E   GQ E  +   EGI+  D+ W+ + + + VA++ G++AS+   PI  + +G GCH N S         T+ M  P  +DE +S I K  L     H + + A Y P    +  RR+       + DK S+    R+ ++R+  S D +   Y E+R PSS C+ Y     ++    ++G + KL +
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFS---------TDKMRNPGGIDEIMSAINKLSLV----HPQHI-AYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSM 250          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 69.3218 bits (168), Expect = 5.069e-13
Identity = 58/197 (29.44%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDE-LSEIGKYWLAGILKHSRGLSAIYSP--TVNCYRRIQS--ALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI-VAGIDGIKNKLQL 1211
            I I   N E   GQ E  +   EGI+  D+ W+ + + + VA++ G++AS+   PI  + +G GCH N S         T+ M  P  +DE +S I K  L     H + + A Y P    +  RR+       + DK S+    R+ ++R+  S D +   Y E+R PSS C+ Y     ++    ++G + KL +
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFS---------TDKMRNPGGIDEIMSAINKLSLV----HPQHI-AYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSM 250          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 69.3218 bits (168), Expect = 5.069e-13
Identity = 58/197 (29.44%), Postives = 94/197 (47.72%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDE-LSEIGKYWLAGILKHSRGLSAIYSP--TVNCYRRIQS--ALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI-VAGIDGIKNKLQL 1211
            I I   N E   GQ E  +   EGI+  D+ W+ + + + VA++ G++AS+   PI  + +G GCH N S         T+ M  P  +DE +S I K  L     H + + A Y P    +  RR+       + DK S+    R+ ++R+  S D +   Y E+R PSS C+ Y     ++    ++G + KL +
Sbjct:   68 IQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFS---------TDKMRNPGGIDEIMSAINKLSLV----HPQHI-AYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSM 250          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 70.8626 bits (172), Expect = 5.175e-13
Identity = 74/292 (25.34%), Postives = 126/292 (43.15%), Query Frame = 3
Query:  381 MVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKF--VQNSMK--HYSQFHQITESYSYIKEL-NKDLKKC---DILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDE-LSEIGKYWLAGILKHSRGLSAIYSP--TVNCYRRIQS--ALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI-VAGIDGIKNKLQL 1211
            +V  + YD   N   P       +CK    +A D     G+E E+ + +     F   +N         +  +  +  Y +++     + C    I I   N E   GQ E  +   EGI+  D+ W+ + + + VA++ G++AS+   PI  + +G GCH N S         T+ M  P  +DE +S I K  L     H + + A Y P    +  RR+       + DK S+    R+ ++R+  S D +   Y E+R PSS C+ Y     ++    ++G + KL +
Sbjct:   98 LVMCETYD---NKKKPTATNYRQRCKEVMEKAADQHPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHYRACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFS---------TDKMRNPGGIDEIMSAINKLSLV----HPQHI-AYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSM 372          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 70.8626 bits (172), Expect = 6.017e-13
Identity = 74/292 (25.34%), Postives = 126/292 (43.15%), Query Frame = 3
Query:  381 MVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKF--VQNSMK--HYSQFHQITESYSYIKEL-NKDLKKC---DILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDE-LSEIGKYWLAGILKHSRGLSAIYSP--TVNCYRRIQS--ALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI-VAGIDGIKNKLQL 1211
            +V  + YD   N   P       +CK    +A D     G+E E+ + +     F   +N         +  +  +  Y +++     + C    I I   N E   GQ E  +   EGI+  D+ W+ + + + VA++ G++AS+   PI  + +G GCH N S         T+ M  P  +DE +S I K  L     H + + A Y P    +  RR+       + DK S+    R+ ++R+  S D +   Y E+R PSS C+ Y     ++    ++G + KL +
Sbjct:  101 LVMCETYD---NKKKPTATNYRQRCKEVMEKAADQHPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHYRACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFS---------TDKMRNPGGIDEIMSAINKLSLV----HPQHI-AYYDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALVRTVCLEGAERKLSM 375          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0078115)

HSP 1 Score: 60.077 bits (144), Expect = 1.854e-9
Identity = 76/316 (24.05%), Postives = 124/316 (39.24%), Query Frame = 3
Query:  303 HYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEF-------RIFNKTDKKFVQNSMKHYS-------------QFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPT--VNCYRRIQSALFAP--DKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIV 1175
            H EN+   L    I   P+    +  +V  D Y   G  P   N R   +  I+ +   D +   GIE E+       R F   +  F      +Y              + H +   Y+ I     +    +++   W F+ G            GI+  D  W+ + I + +A++ G+V ++   P+  + +G G H N S       G   A+   E +++LS+          +H R + A Y P    +  RR+   L     DK SW   +R+V++RV          Y+E+R PSS C+ Y AV   IV
Sbjct:  107 HGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGK-PTASNKRAAFQAAIDLIS--DQEPWFGIEQEYTLLDVDGRPFGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTN---AEVMPAQWEFQIGPA----------GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAI--EEAIEKLSK----------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0078114)

HSP 1 Score: 60.077 bits (144), Expect = 1.854e-9
Identity = 76/316 (24.05%), Postives = 124/316 (39.24%), Query Frame = 3
Query:  303 HYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEF-------RIFNKTDKKFVQNSMKHYS-------------QFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPT--VNCYRRIQSALFAP--DKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIV 1175
            H EN+   L    I   P+    +  +V  D Y   G  P   N R   +  I+ +   D +   GIE E+       R F   +  F      +Y              + H +   Y+ I     +    +++   W F+ G            GI+  D  W+ + I + +A++ G+V ++   P+  + +G G H N S       G   A+   E +++LS+          +H R + A Y P    +  RR+   L     DK SW   +R+V++RV          Y+E+R PSS C+ Y AV   IV
Sbjct:  107 HGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGK-PTASNKRAAFQAAIDLIS--DQEPWFGIEQEYTLLDVDGRPFGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTN---AEVMPAQWEFQIGPA----------GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAI--EEAIEKLSK----------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0300568)

HSP 1 Score: 60.077 bits (144), Expect = 1.854e-9
Identity = 76/316 (24.05%), Postives = 124/316 (39.24%), Query Frame = 3
Query:  303 HYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEF-------RIFNKTDKKFVQNSMKHYS-------------QFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPT--VNCYRRIQSALFAP--DKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIV 1175
            H EN+   L    I   P+    +  +V  D Y   G  P   N R   +  I+ +   D +   GIE E+       R F   +  F      +Y              + H +   Y+ I     +    +++   W F+ G            GI+  D  W+ + I + +A++ G+V ++   P+  + +G G H N S       G   A+   E +++LS+          +H R + A Y P    +  RR+   L     DK SW   +R+V++RV          Y+E+R PSS C+ Y AV   IV
Sbjct:  107 HGENSDTTLKPRAIYRDPFKPGKNDVIVLCDTYSADGK-PTASNKRAAFQAAIDLIS--DQEPWFGIEQEYTLLDVDGRPFGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTN---AEVMPAQWEFQIGPA----------GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAI--EEAIEKLSK----------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:ZFIN;Acc:ZDB-GENE-060312-26])

HSP 1 Score: 122.865 bits (307), Expect = 2.547e-29
Identity = 105/370 (28.38%), Postives = 174/370 (47.03%), Query Frame = 3
Query:  321 LVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYS-----YIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNY-------RDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQ----LPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSD 1382
            LV D ST ++ PW+     A +  D     G  PL  +PRL+AK  + +L++M   L      E  IF   +       +   + F   T   S     ++++L K +    + ++S++   G GQ+EI      G++  D  + F+   K +A K   +A++ T      SG    ++HSLW  S +    +++      ELSEIG+ WL+G+L HS  LS + +P ++C  +I        K S N+        D S    VK     E   +I+N++ S+  N Y+ +A  I AG+DGIK  L     L    N      +P  L +AL AL +D V+   LG  FV +++ +K + +++  +D+D
Sbjct:  313 LVPDLSTFQILPWADQT--ARLICDPCTITG-VPLRTSPRLIAKMMLGQLQSMGFSLHSSFTYECCIFGSPEH------VGPKAVFFPATTLLSNNDQPFLQQLVKGMYNMGVDVESFSSANGPGQMEICFKPRFGMDAADNAYTFRTGIKEMARKYDYIATFFTYENIQNSG---LLSHSLWDASGR---RSLFHSGN-GELSEIGRKWLSGLLHHSAALSCLLAPGISCRTQISKG----KKDSKNHVYATCGCNDNSCDFNVKIHGGRE--THIDNKLASAMANPYIVLAATIAAGLDGIKRNLNAEQVLSRAPNQQKQFVIPVKLDDALLALAEDSVICGALGEPFVQYFIAMK-QIEMESQEDAD 659          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-9
Identity = 49/177 (27.68%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGIE  D  W+ + +   V +  G+VAS+   PIP   +G GCH N S     E+G    +   E +++L +  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHI--EESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-9
Identity = 49/177 (27.68%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGIE  D  W+ + +   V +  G+VAS+   PIP   +G GCH N S     E+G    +   E +++L +  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHI--EESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-9
Identity = 49/177 (27.68%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGIE  D  W+ + +   V +  G+VAS+   PIP   +G GCH N S     E+G    +   E +++L +  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHI--EESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 58.9214 bits (141), Expect = 6.183e-9
Identity = 49/177 (27.68%), Postives = 79/177 (44.63%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGIE  D  W+ + +   V +  G+VAS+   PIP   +G GCH N S     E+G    +   E +++L +  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHI--EESIEKLGKRHQYHIRAYDPKGGLDNARRLTGHHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Xenopus
Match: pkn2 (protein kinase N2 [Source:Xenbase;Acc:XB-GENE-995298])

HSP 1 Score: 140.198 bits (352), Expect = 9.668e-36
Identity = 108/364 (29.67%), Postives = 172/364 (47.25%), Query Frame = 3
Query:  306 YENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTD----KKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDK---ISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHC------ERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEE 1352
            Y N+ +VL  D ST RV PW++      V  D Y  +G+S L   PR LAK  + +L+     L      EF IF   +    KK V  +    +   Q+     +++EL   +      I+S+      GQ+EI      G+   D  + F+   K VA K G ++S+    +     +G   +HSLW  S  G  N   +  ++ EL++IG+ WL+G+L HS  LS + +P V+C +        P +    ++ + D S +  VK         YIEN++ S+A N YL +A  + AG+DGI+  L L    N            +P  + +ALSALK+D+ +   LG  F+ +++ VK+ 
Sbjct:  100 YFNSDIVLKPDLSTFRVLPWAE--KTGKVICDAYTIMGDSLLTY-PRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAETVDSKKVVFPAATLVTDNDQL-----FLQELFDGMYYIGGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCN-DVGGIYNSGV-FSHSLWDSS--GTKNLFIDGNQIQELTDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHC--SSGTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDLFIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVKQH 449          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Xenopus
Match: avpr1b (arginine vasopressin receptor 1B [Source:Xenbase;Acc:XB-GENE-481094])

HSP 1 Score: 139.813 bits (351), Expect = 1.213e-35
Identity = 109/367 (29.70%), Postives = 172/367 (46.87%), Query Frame = 3
Query:  306 YENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTD----KKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESG---NGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDK---ISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHC------ERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEE 1352
            Y N+ +VL  D ST RV PW++      V  D Y  +G+S L  +PR LAK  + +L+     L      EF IF   +    KK V  +    +   Q+     +++EL   +      I+S+      GQ+EI      G+   D  + F+   K VA K G ++S+       + G   N    +HSLW  S  G  N   +  ++ EL +IG+ WL+G+L HS  LS + +P V+C +        P +    ++ + D S +  VK         YIEN++ S+A N YL +A  + AG+DGI+  L L    N            +P  + +ALSALK+D+ +   LG  F+ +++ VK+ 
Sbjct:  100 YFNSDIVLKPDLSTFRVLPWAE--KTGKVICDAYTIMGDSLL-TSPRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAETVDSKKVVFPAATLVTDNDQL-----FLQELFDGMYYIGGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCN-----DVGGIYNSGVFSHSLWDSS--GTKNLFIDGNQIQELPDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHC--SSGTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDLFIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVKQH 449          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Xenopus
Match: c8a (complement component 8, alpha polypeptide [Source:Xenbase;Acc:XB-GENE-980231])

HSP 1 Score: 54.299 bits (129), Expect = 2.406e-7
Identity = 46/183 (25.14%), Postives = 77/183 (42.08%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLA-----GILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGIE  D  W+ + I   + +  G++ S+   PI    +G GCH N S  +  E+G    +   E ++ LS+   Y +      G   ++R L+  +  +            +  + S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     MI
Sbjct:  188 VKIAGTNAEVMPAQWEFQIGPCEGIEMGDHLWIARFILHRICEDFGIIVSFDPKPITGNWNGAGCHTNFSTKSMREEGGLKDI--EESIERLSKRHDYHIRMYDPRGGKDNARRLTGFHETS------------SIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEAMI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Mouse
Match: Lgsn (lengsin, lens protein with glutamine synthetase domain [Source:MGI Symbol;Acc:MGI:2672844])

HSP 1 Score: 142.51 bits (358), Expect = 2.942e-36
Identity = 122/459 (26.58%), Postives = 211/459 (45.97%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGM------IGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIF-------NKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESG--NGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRR-IQSALFAPDKI--SWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSH------CERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYF 1433
            +QF++    D++G+SR K  P          +E++I  + M      +  N +        +   N+ +VL  + ST RV PW++    A V  D +   G  PL  +PR +AK ++ +L+     L+     +F IF       +KT        + ++ Q         +++EL + L +    ++S++     GQ+EI  L   GI   D  +  +   + VA +   +AS +      E+G  N   ++HS+W     G TN       V+ L+  GK WLAG+LKHS  LS + +P VNC +R  + +    D +  +W Y D S A+ +K     EK   IEN++ S+  N YL +A  + AG+DG+++        + S          +P  + +AL+AL+ D+ L + LG  F+ ++V          +K  +L N   +    +F++YF
Sbjct:  139 LQFVRFEATDLHGVSRSKSIPAQFF------QEKVIHGVFMPRGYLELMPNPKDNEVNHIRATCFNSDIVLMPELSTFRVLPWAE--RTARVICDTFTVTGE-PLLTSPRYIAKRQLRQLQDAGFCLLSAFIYDFCIFGVPEVINSKTISFPASTLLSNHDQ--------PFMQELVEGLYQTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGLQEVARRYNYIASLVI-----ETGFCNSGILSHSIWDVG--GKTNMFCSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCKDSRDLKDSVPTTWGYNDNSCALNIKCHG--EKGTQIENKLGSATANPYLVLAATVAAGLDGLQSSDGAAAGSDESQDLYQPEPSEIPLKMEDALAALEQDECLKQALGETFIRYFV---------AMKKYELENEETDAEGNKFLEYF 562          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 58.151 bits (139), Expect = 1.220e-8
Identity = 48/183 (26.23%), Postives = 80/183 (43.72%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +         E +D+LS+  +Y +      G L ++R L+  +  T N            +  S    +R  ++R+  +   EK  Y E+R PS+ C+ Y     ++
Sbjct:  188 VKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIV 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 58.151 bits (139), Expect = 1.220e-8
Identity = 48/183 (26.23%), Postives = 80/183 (43.72%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGI   D  W+ + I   V +  G++A++   PIP   +G GCH N S  TK+ +         E +D+LS+  +Y +      G L ++R L+  +  T N            +  S    +R  ++R+  +   EK  Y E+R PS+ C+ Y     ++
Sbjct:  188 VKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFS--TKAMREENGLKCIEEAIDKLSKRHQYHIRAYDPKGGLDNARRLTGFHE-TSNI-----------NDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIV 356          
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q05907|GLN1A_PYRFU (Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=glnA PE=3 SV=2)

HSP 1 Score: 173.326 bits (438), Expect = 2.207e-47
Identity = 137/451 (30.38%), Postives = 222/451 (49.22%), Query Frame = 3
Query:  132 EVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQ-NSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKL-----------QLPEHGNGS-HCERLPTTLSEALSALKDDKVLVEGLGAKFVDWY-VKVKE-ETDVKVLKDSDLHNNTEEGISQEFIKYF 1433
            +++F+Q++ +DING+ +G   P  +L      +E +   I   G++      I      E++ LV   D  T    PW    ++A V+  +Y    N P   +PR + K  + ELE    K  IG E EF +F K     ++   +  Y     + ++    +E+ + +    ++ +  + E G  Q EI     E ++  D    FK I+K VA+  GL A++M  P+    GNG H++ SLW   E    N     E    LSEI  +++ GILKH++ L+A+ +PTVN Y+R+  +  AP  ISW YR+RS  +RV     + K   IE R P  + N Y A A ++ AG+DGIK+K+           ++ E        E LP +L EAL  L+ DKV+ E LG  + ++   K KE E+ ++ L++  +  +T++    E  +YF
Sbjct:   13 KIKFVQLVFVDINGMPKGMEIPASRL------EEAVTDGISFDGSSVPGFQGI------EDSDLVFKADPDTYVEVPWD---NVARVYGFIYKD--NKPYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGYFDILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISLWKDGE----NVFMGEEG---LSEIALHFIGGILKHAKALTAVTNPTVNSYKRLVPSYEAPVYISWGYRNRSALIRVPAF--WGKGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALGDAYKNFINYKWKEWESYLEYLEEKHMPKDTKKVTEWELERYF 437          
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Match: sp|O58097|GLN1A_PYRHO (Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=glnA PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.884e-47
Identity = 136/452 (30.09%), Postives = 222/452 (49.12%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQ-NSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCE------------RLPTTLSEALSALKDDKVLVEGLGAKFVDW--YVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            ++F+Q+I +DING+ +G   PI +L + +   EE I   G         SS+      E++ LV   D ST    PW    ++A V+  +Y      P   +PR + +  +  LE + +K+ IG E EF +F K     ++   +  Y     + ++    +E+ + +    +  +  + E G  Q EI     E ++  D    FK I K VA+  GL A++M  PI    GNG H++ SLW   E      +++ E  + LSE   Y++ G+LKH++ L+A+ +PTVN Y+R+     AP  ISW Y++RS  +RV     +     IE R P  + N YLA A +++AG+DGIK+K++   +   +  E             LP  L EAL  L+ DKV+ E LG  + ++  Y + + E  +  L+  +L  +T+     E  +YF I
Sbjct:   18 IKFVQLIFVDINGMPKGMEVPITRLEEAI---EEGIAFDG---------SSVPGFQGIEDSDLVFKADPSTYVEVPWD---NVARVYGYIYKD--GKPYEADPRGVLRRTLERLEKLGIKVYIGPEPEFYLFKKNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPYFGLTPEVLHHEVGKAQHEIDFRHDEALKTADNIVSFKYIVKAVAEMHGLYATFMPKPIYGMPGNGMHLHISLWKDGEN-----IFKGE--EGLSETALYFIGGLLKHAKALAAVTNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAF--WGNGARIEYRCPDPSANSYLAFAAILMAGLDGIKHKIEPFAYVEENVYEMDEKRREEIGIDMLPENLGEALDELERDKVVKEALGGAYRNFVGYKRKEWEEYLDYLEAKNLPKDTKNVTEWELERYFFI 443          
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Match: sp|P36687|GLN1A_PYRWO (Glutamine synthetase OS=Pyrococcus woesei OX=2262 GN=glnA PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 9.607e-46
Identity = 137/451 (30.38%), Postives = 222/451 (49.22%), Query Frame = 3
Query:  132 EVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQ-NSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKL-----------QLPEHGNGS-HCERLPTTLSEALSALKDDKVLVEGLGAKFVDWY-VKVKE-ETDVKVLKDSDLHNNTEEGISQEFIKYF 1433
            +++F+Q++ +DING+ +G   P  +L      +E +   I   G++      I      E++ LV   D  T    PW    ++A V+  +Y    N P   +PR + K  + ELE    K  IG E EF +F K     ++   +  Y     + ++    +E+ + +    ++ +  + E G  Q EI     E ++  D    FK I+K VA+  GL A++M  P+    GNG H++ SL   S+ G    M E    + LSEI  +++ GILKH++ L A+ +PTVN Y+R+     AP  ISW YR+RS  +RV     + K   IE R P  + N Y A A ++ AG+DGIK+K+           ++ E        E LP +L EAL  L+ DKV+ E LG  + ++   K KE E+ ++ L++  +  +T++    E  +YF
Sbjct:   13 KIKFVQLVFVDINGMPKGMEIPASRL------EEAVTDGISFDGSSVPGFQGI------EDSDLVFKADPDTYVEVPWD---NVARVYGFIYKD--NKPYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGYFDILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISL---SKDGENVFMGE----EGLSEIALHFIGGILKHAKALIAVTNPTVNSYKRLVPGYEAPVYISWGYRNRSALIRVPAF--WGKGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALGDAYKNFINYKWKEWESYLEYLEEKHMPKDTKKVTEWELERYF 437          
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UY99|GLN1A_PYRAB (Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=glnA PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.143e-45
Identity = 135/451 (29.93%), Postives = 222/451 (49.22%), Query Frame = 3
Query:  138 QFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQ-NSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQ--------LPEHGNGSHCE----RLPTTLSEALSALKDDKVLVEGLGAKFVDW--YVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            +F+Q+I +DING+ +G   P  +L + +   E+ I   G         SS+      E++ L+   D  T    PW    ++A V+  +Y      P   +PR + K  I +L  M +K  IG E EF +F K     ++   +  Y     + ++    +E+ + +    ++ +  + E G  Q EI     E ++  D    FK I K VA+  GL A++M  PI    GNG H++ SLW + E      +++ E  + LSE   +++ G+LKH++ L+AI +PTVN Y+R+     AP  ISW Y++RS  +RV     +     IE R P  + N Y A A +++AG+DGIK+K++        + E   G   E     LP +L EAL  L+ DKV+ E LG  + ++  Y + + E+ ++ L+   L  +T+     E  +YF I
Sbjct:   15 KFVQLIFVDINGMPKGMEIPASRLQEAI---EDGISFDG---------SSVPGFQGIEDSDLIFKADPDTYVEVPWD---NVARVYGYIYKD--GKPYGADPRGVLKRVIEKLAEMGIKAYIGPEPEFYLFKKNGSWELEIPDVGGYFDILTLDKAKDIKREIAEYMPSFGLVPEVLHHEVGKAQHEIDFRYDEALKTADNIISFKYIVKAVAEVHGLYATFMPKPIYGMPGNGMHLHISLWKEGEN-----IFKGE--EGLSETALHFIGGLLKHAKALTAITNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAF--WGNGARIEYRCPDPSANPYFAFAAILMAGLDGIKHKVEPFAYVEENVYEMDEGKRKELGIDTLPGSLGEALDELEKDKVVREALGEAYKNFIEYKRKEWESYLEYLEAKHLPKDTKRVTEWELERYFFI 439          
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Match: sp|O08467|GLN1A_THEKO (Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=glnA PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 3.676e-42
Identity = 135/454 (29.74%), Postives = 211/454 (46.48%), Query Frame = 3
Query:  129 PEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIF--NKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEH-------GNGSHCER-----LPTTLSEALSALKDDKVLVEGLGA---KFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYF 1433
            P  +F+ +   DING  +G   P      + R +E +   +   G++      I      E++ L+   D ST    PW     +  V+  +Y   G+ P   +PR + K  +  LE   LK  IG E EF IF  N T +  + +S   Y     + ++    +E+   +    +  +  + E G  Q EI     E +   D    FK + K VA+  G  A++M  PI    GNG H++ SLW   E             D LS+   +++ GILKH++ L+A+ +PTVN Y+R+     AP  ISW YR+RS  +RV   +       IE R P  + N YLA+AG+++ G+DGIK K++   +        + +  ER     LP +L EAL  LK DK + E LG     F+D+  +  EE  ++ L   D+  +T++    E  +YF
Sbjct:   16 PRPRFLLLAFTDINGSLKGMEIP------MERYEEAVEDGVSFDGSSIPGFEGI------EDSDLIFKADPSTYAEIPWE---GIGRVYGYIYK--GDEPYQADPRGILKRVLERLEKEGLKAHIGPEPEFYIFKKNGTWELHIPDS-GGYFDLVGLDKAREIRREIALYMPYLGLKPEVLHHEVGKAQHEIDFRYDEALRTADNIVSFKHVVKAVAELHGYYATFMPKPIYGFPGNGMHLHISLWKDGENVFIGE-------DGLSDTALHFIGGILKHAKALAALTNPTVNSYKRLVPGYEAPVYISWGYRNRSALIRVPAFKG--SGARIEYRCPDPSANPYLALAGILMVGLDGIKKKVEPDSYVETNVYEMDDAERERLGIDTLPGSLGEALEELKKDKTVREALGGAYKNFIDYKEREWEEY-IEYLSSRDIPIDTKKVTEWELERYF 441          
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Match: A0A5J4NYP7 (Gln-synt_C domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002093 PE=3 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 6.359e-71
Identity = 158/468 (33.76%), Postives = 252/468 (53.85%), Query Frame = 3
Query:  141 FIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXX-XXXXXHYENARLVLDKSTIRVAPWS---QDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINEL-EAMDLKLVIGIENEFRIF--------------NKTDKK-FVQ-NSMKHYSQFHQITESYS------YIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGS----HCE----RLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            F+++   D+NGI   KV P      +L    EI   +  +G   EI          +EN  LV D ST    PW+   Q+ ++  +  ++  + G + +  +PR +A+  ++EL +  +L+L  G E EFR+F              N +DK+  VQ  S K YS    +  S +      ++ +L++ LK   +  + +  E G+ Q+EIPL+   GI   D  ++FK+  + VA    +  S+MT+PI  E+ +GCH NHSLW +  K   N +++ E  ++LS++ +YW+ G++ H   L+A+ SPTVNCYRR     F P  I W+  DR VA+RVK     E   YIENR+ SSA   Y  +A  + AG+DGI+ KL+ P+ G  +     CE    +LP TL EA+ +LK DK+LV  LG +FVDW+++ K+  D++ L D D+ +++E  ++ E  +Y + 
Sbjct:   25 FVRLYLADMNGIQLSKVVPSRHADKILSNHCEIYSGVLQMGPRFEINLVPEILEKKHENGYLVPDISTCHPCPWACRHQNINVCGIVCEINWQDG-TVVQGHPRTVARRLLSELAQKHNLELFSGFEPEFRVFRSEGFQEACAFPTANSSDKQDSVQFKSPKPYSNVFDMYRSGALSVYEPFLFDLDQQLKAARVDAEEFTHEHGTAQLEIPLIPQYGIRSADSYFIFKQAVREVAKGHNMRVSFMTMPILNEAASGCHFNHSLWDR--KTGRNVLFDAENDEKLSQLSRYWIGGLIAHMPALTALCSPTVNCYRRFNGN-FTPTSIDWDINDRFVALRVKNVD--ENRTYIENRLCSSASCSYHVLAATVAAGMDGIERKLEPPKRGKKTVAEEGCEPDRLKLPKTLREAIESLKADKILVNRLGTQFVDWFIRTKQYGDLQTLADVDIESDSERILAYERYEYLEF 486          
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Match: R7VIP4 (Gln-synt_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219831 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 5.093e-69
Identity = 147/437 (33.64%), Postives = 236/437 (54.00%), Query Frame = 3
Query:  132 EVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVLDKSTIRVAPWSQDC--SLAMVFADV-YDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFN-KTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKY 1430
            +  FI+    D +GISR ++ P   ++  ++    +   I  +G +S +   +   + + N+  + D  T+R  PW  D    +  +  D+     G  P+P  PR +AK ++  L  M L+L    E E  +F+  T K  V ++   ++   Q+++  + + E++  LK   + ++S+  E G+ Q E+PL    GIE  D  ++F+   K +  K G+ A++MT P P+   NG H NHSLWT  ++   +A    +  D LS+I + WL G++KH+  L AIY PTVNCYRR+    +AP+K  W   +R  + RVK         +IENRIPS+ACN YLA+A  I AGIDGI+     P   + S  ++ P TL EAL  L++DKV+ + LG  F+ WYV +K+E ++K L ++D+  +  E I+ E   Y
Sbjct:   10 DFDFIRFCWSDTHGISRARMIPRRNVAKFMQSGVGVFQGILALGADSGLYIDLPHNNGWPNSYAMPDLKTLRPIPWVNDGVHRVGQMLCDLTLPNTGGMPMPNCPRSMAKKQVERLRTMGLELYSSFETEMTLFDLATGKPKVPDA--GFTTTFQMSKEENLLMEIDDLLKAASVDVESYQIEYGASQFEMPLAPCFGIEPADMMFVFRNGLKEICHKRGVDATFMTKPCPSNICNGGHYNHSLWTAGDR--KSAFASADDSDGLSQIFRQWLGGLIKHAPALCAIYCPTVNCYRRLNQP-WAPNKADWGIDNRLPSFRVKVGSS----PFIENRIPSAACNPYLAIAATIAAGIDGIQTGSTCPPAMDPS-AQKFPRTLQEALEFLQEDKVMTDALGEPFMQWYVPMKQELEIKRLPNTDVSFDDAEAIAAEVTVY 436          
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Match: A0A430Q458 (Gln-synt_C domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0002391 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 2.904e-67
Identity = 137/383 (35.77%), Postives = 207/383 (54.05%), Query Frame = 3
Query:  372 SLAMVFADVYDRVGNSPLPINPRLLAKCKINELE-AMDLKLVIGIENEFRIFNK--TDKKFVQNSMKHYSQFHQITESY------------------SYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHG----NGS--HCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            S   V  D+Y    N P+   PR +A+  I ELE   +L+L    E EFR F K   +   ++      +QF  + +                    +Y  +++ +++   I I  ++ E G GQ+E PL+ + G+   D  ++ K+  K +  K G+  S+MT P+   S +GCH NHSLW        NA ++ +  D LS + ++W+ GIL+H   + AI  PTVNCYRR+   L AP  ++W++ DR V++RVK     EK  YIENRIPSSA   Y  +A  I AG+DG++ ++  P  G    NG    C+ LP T+ +AL +L DDK+LV  LGA FVDWY++VK   D+  L   ++H+NTEE ++ E  +YF+ 
Sbjct:   54 SFCSVLCDIY-WPNNQPMYAYPRFVAQRLIKELEDKYNLRLYSAFEPEFRAFVKGSYESSCLEPKSNDVTQFIDLKKPIPWTNFRDMYRTSLLSVYENYFADIDYNMQLAGIDIQDYSNEDGEGQLECPLIPTWGLSAADNYFILKQAVKEIGTKHGMEISFMTTPLLDSSSSGCHYNHSLWYSDNN--RNAFYDDKDPDRLSTLARHWIGGILEHLPAMLAISCPTVNCYRRLHKHL-APSCVNWDFHDRYVSIRVKNFN--EKQTYIENRIPSSASCSYHVLAATIAAGLDGLERQIHPPPSGLKLANGQIGVCKVLPNTIQQALHSLMDDKILVNKLGADFVDWYIQVKRNGDLSSLGHLNIHDNTEETLAYERYEYFNF 430          
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Match: A0A095ACE5 (Glutamine synthetase OS=Schistosoma haematobium OX=6185 GN=MS3_10953 PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 4.753e-67
Identity = 135/383 (35.25%), Postives = 206/383 (53.79%), Query Frame = 3
Query:  372 SLAMVFADVYDRVGNSPLPINPRLLAKCKINELE-AMDLKLVIGIENEFRIFNKTD--------------------KKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHG----NGS--HCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            S   V  D+Y    N P+   PR +A+  I ELE   +L+L    E EFR F K                      K     + +   +   ++   +Y  +++ +++   I I  ++ E G GQ+E PL+ + G+   D  ++ K+  K +  K G+  S+MT P+   S +GCH NHSLW        NA ++ +  D LS + ++W+ GIL+H   + A+  PTVNCYRR+   L AP  ++W++ DR V++RVK     EK  YIENRIPSSA   Y  +A  I AG+DG++ ++  P  G    NG    C+ LP T+ +AL +L DDK+LV  LGA FVDWY++VK+  D+  L   ++H+NTEE ++ E  +YF+ 
Sbjct:   55 SFCSVLCDIY-WPNNQPMYAYPRFVAQRLIKELEDKYNLRLYSAFEPEFRAFVKGSYESSCLEPKSNDVIQFIDLKKPIPWTNFRDMYRTSLLSVYENYFADIDYNMQLAGIDIQDYSNEDGEGQLECPLIPTWGLSAADNYFILKQAVKEIGTKHGMEISFMTTPLLDSSSSGCHYNHSLWYSDNN--RNAFYDDKDPDRLSTLARHWIGGILEHLPAMLAVSCPTVNCYRRLHKHL-APSCVNWDFHDRYVSVRVKNFN--EKQTYIENRIPSSASCSYHVLAATIAAGLDGLERQIHPPPSGLKLANGQIGACKVLPNTIQQALHSLMDDKILVNKLGADFVDWYIQVKKNGDLSSLGHLNIHDNTEETLAYERYEYFNF 431          
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Match: A0A430PZL0 (Gln-synt_C domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0004373 PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 9.619e-67
Identity = 137/383 (35.77%), Postives = 207/383 (54.05%), Query Frame = 3
Query:  372 SLAMVFADVYDRVGNSPLPINPRLLAKCKINELE-AMDLKLVIGIENEFRIFNK--TDKKFVQNSMKHYSQFHQITESY------------------SYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHG----NGS--HCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            S   V  D+Y    N P+   PR +A+  I ELE   +L+L    E EFR F K   +   ++      +QF  + +                    +Y  +++ +++   I I  ++ E G GQ+E PL+ + G+   D  ++ K+  K +  K G+  S+MT P+   S +GCH NHSLW        NA ++ +  D LS + ++W+ GIL+H   + AI  PTVNCYRR+   L AP  ++W++ DR V++RVK     EK  YIENRIPSSA   Y  +A  I AG+DG++ ++  P  G    NG    C+ LP T+ +AL +L DDK+LV  LGA FVDWY++VK   D+  L   ++H+NTEE ++ E  +YF+ 
Sbjct:   98 SFCSVLCDIY-WPNNQPMYAYPRFVAQRLIKELEDKYNLRLYSAFEPEFRAFVKGSYESSCLEPKSNDVTQFIDLKKPIPWTNFRDMYRTSLLSVYENYFADIDYNMQLAGIDIQDYSNEDGEGQLECPLIPTWGLSAADNYFILKQAVKEIGTKHGMEISFMTTPLLDSSSSGCHYNHSLWYSDNN--RNAFYDDKDPDRLSTLARHWIGGILEHLPAMLAISCPTVNCYRRLHKHL-APSCVNWDFHDRYVSIRVKNFN--EKQTYIENRIPSSASCSYHVLAATIAAGLDGLERQIHPPPSGLKLANGQIGVCKVLPNTIQQALHSLMDDKILVNKLGADFVDWYIQVKRNGDLSSLGHLNIHDNTEETLAYERYEYFNF 474          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 130.183 bits (326), Expect = 1.112e-31
Identity = 111/421 (26.37%), Postives = 190/421 (45.13%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSD-------LLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDK---KFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGC-HINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFA--PDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCER----LPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVK 1346
            V F++    D++G+SR K+ P     +       + R   E+      +      +      +   +  LV D ST RV PWS+    A V  D     G  PL  +PRL+AK  + +L++M   L      E  I    ++   K V          H +     ++++L + +      +D++    G GQ+EI      GIE  D  + F+   K +A K   + +++T     E+ N    ++HSLW  + +    +++      ELS+IGK WL G+L HS  LS + +P + C  ++     +  P   +    D S +  VK     E   +I+NR+ S+  N Y+ +A  I AG+DGIK  L + +  N +  ++    +P  L +AL AL +D V+   LG  F+ +++ +K
Sbjct:  286 VGFVRFEATDLHGVSRSKMVPARYFHEKAVYGVPMPRSYLELT-----LSPKDNEVDHPSAANFSSDVLLVPDLSTFRVLPWSEQT--ARVICDPCTVTG-VPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCILGAPERLGPKVVFFPATTLLSNHDL----PFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLT----DETLNNLGQLSHSLWDANGR---KSLFH-SSTGELSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAPNQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMK 684          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 129.798 bits (325), Expect = 1.251e-31
Identity = 111/421 (26.37%), Postives = 190/421 (45.13%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSD-------LLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDK---KFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGC-HINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFA--PDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCER----LPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVK 1346
            V F++    D++G+SR K+ P     +       + R   E+      +      +      +   +  LV D ST RV PWS+    A V  D     G  PL  +PRL+AK  + +L++M   L      E  I    ++   K V          H +     ++++L + +      +D++    G GQ+EI      GIE  D  + F+   K +A K   + +++T     E+ N    ++HSLW  + +    +++      ELS+IGK WL G+L HS  LS + +P + C  ++     +  P   +    D S +  VK     E   +I+NR+ S+  N Y+ +A  I AG+DGIK  L + +  N +  ++    +P  L +AL AL +D V+   LG  F+ +++ +K
Sbjct:  252 VGFVRFEATDLHGVSRSKMVPARYFHEKAVYGVPMPRSYLELT-----LSPKDNEVDHPSAANFSSDVLLVPDLSTFRVLPWSEQT--ARVICDPCTVTG-VPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCILGAPERLGPKVVFFPATTLLSNHDL----PFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLT----DETLNNLGQLSHSLWDANGR---KSLFH-SSTGELSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAPNQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMK 650          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 56.225 bits (134), Expect = 3.347e-8
Identity = 49/177 (27.68%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGI   D  WM + I   V +  G+V S+   PI    +G GCH N S     E+G    +   E +++LS+  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQI--EEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGRHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 56.225 bits (134), Expect = 3.850e-8
Identity = 49/177 (27.68%), Postives = 77/177 (43.50%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGI   D  WM + I   V +  G+V S+   PI    +G GCH N S     E+G    +   E +++LS+  +Y +      G L ++R L+  +  T N            ++ S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  210 NAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQI--EEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGRHE-TSNI-----------NEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALI 372          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Match: glula (glutamine synthetase [Source:NCBI gene;Acc:103046209])

HSP 1 Score: 56.225 bits (134), Expect = 4.150e-8
Identity = 50/183 (27.32%), Postives = 79/183 (43.17%), Query Frame = 3
Query:  642 ILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSE-----IGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            + I   N E    Q E  +   EGIE  D  W+ + I   V +  G+V S+   PIP   +G GCH N S  TK+ +      +  E ++ L +     I  Y   G L ++R L+  +  T N +           + S    +R  ++R+  +   EK  Y E+R PS+ C+ Y     +I
Sbjct:  188 VQICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFILHRVCEDFGVVVSFDPKPIPGNWNGAGCHTNFS--TKAMREDGGLKYIEESIERLGKRHSYHIRAYDPKGGLDNARRLTGHHE-TSNIH-----------EFSAGVANRGASIRIPRAVGQEKKGYFEDRRPSANCDPYAVTQALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008530.1 (pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-1 gene:ENSPMAG00000007702.1 transcript:ENSPMAT00000008530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.143e-8
Identity = 46/183 (25.14%), Postives = 79/183 (43.17%), Query Frame = 3
Query:  639 DILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPT--VNCYRRIQSA--LFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            +++   W F+ G           EGI+  D  W+ + I   V +  G+VA++   PIP   +G GCH N S     E G    + E      + ++GK       +HS  + A Y P   ++  RR+  +    +  + S    +R  ++R+      +   Y+E+R PS+ CN Y     +I
Sbjct:  196 EVMPSQWEFQVGP---------CEGIDMGDHLWVARFILHRVCEDFGVVATFDPKPIPGNWNGAGCHTNFSTLPMREDGGLQHIEE-----AIEKLGK-------RHSYHIRA-YDPRGGLDNARRLTGSHETSSIHEFSAGVANRGASIRIPRQVGQDGCGYMEDRRPSANCNPYAVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Nematostella
Match: EDO25869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH3])

HSP 1 Score: 82.8037 bits (203), Expect = 1.510e-17
Identity = 67/291 (23.02%), Postives = 130/291 (44.67%), Query Frame = 3
Query:  336 STIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKT-----------DKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSS-EGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
             ++ + PW +      +   ++   G    P +PR +    I+ L+A     V+ +E EF + +K                V+         +++ +   ++ +L    +   + + +   E   GQ+E+ L    + ++ +D+   +K + K VA+K G+ A +M  P   ++G+G H++ SL    E G  N M   +     + + K+ + G++       AI+ P  N YRR Q+  +AP   SW   +R+V+ RV       K  ++E+RI  +  N YLA A ++
Sbjct:   14 GSLTLQPW-RSTPTGQLQVSMHPTQGLPAAPADPRHVLVRAIDRLKADGYHPVMAVELEFYLLDKNRDANGRPQPALQANGVRPQAPQVYGVYELEQLQPFLDDLYSACEVQGLPVRTAISEYAPGQVELTLEHRFDALQAVDEGVRYKRLVKGVANKHGMQACFMAKPFGDQAGSGMHMHVSL--ADEHG-NNLMASEDP--HGTPLLKHAIGGMMATLNDALAIFCPNANSYRRFQANSYAPLAKSWGVNNRTVSFRVPGGP--AKSRHVEHRICGADANPYLAAAAIL 296          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Medaka
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:101162898])

HSP 1 Score: 133.265 bits (334), Expect = 7.063e-33
Identity = 109/431 (25.29%), Postives = 196/431 (45.48%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSD-------LLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESG--NGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISW---NYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCER----LPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKE-ETDVKVLKD 1376
            + F++    D++G+SR K  P+    +       + R   E+      +   S  +      +   +  L+ D ST ++ PW++    A V  D     G SPL  +PRL+AK  + +L+++   L      E  +    ++   +  +   +          + ++L   +      IDS     G GQ+EI L    GI   D  + F+   K +A K+  +AS+ T     + G  N   ++HSLW     G  +     EK  ELSEIG+ WLAG+L HS  LS + SP + C   +   +  P ++ +      D S +  +K+    E   +++N++ S+  N Y+ +A  + AG+DGI+  L +      +  ++    +P  + +AL AL++D V+   LG  FV +++ +K+ E + + L D
Sbjct:  214 INFVRFEATDLHGVSRSKTVPVRHFHEKAVYGVPMPRSYLELT-----LSPKSNEVDHASTANFSSDVLLIPDLSTFKLLPWAEQT--ARVICDPCTVTG-SPLWTSPRLIAKQLLGQLQSLGFSLHSSFTYECCVLGAPERIGPKTLLFPATTLLS-NHDLPFFQQLVDSMYCMGADIDSIASASGPGQMEINLRPEFGISAADSAFTFRTGIKEMARKLSYIASFFT-----DDGLYNAGVLSHSLW--DANGRRSLFHGGEKPGELSEIGRKWLAGLLTHSAALSCLMSPGLGCRNHMAKTIKDPKRLLYATCGCNDNSSSFNIKSHGGRE--THVDNKLGSAMANPYIVLAATVAAGLDGIRRNLTVESSLTKAPSQQKDFSIPIKMDDALEALEEDHVIRSALGEPFVQYFIAMKKFEIETQELDD 626          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 58.151 bits (139), Expect = 8.799e-9
Identity = 49/177 (27.68%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGI+  D  W+ + I   V +  G+VAS+   PIP   +G GCH N S     E+G   A+   + +++L +  +Y +      G L ++R L+  +  T N +           + S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAI--EDAIEKLGKRHRYHIRAYDPKGGLDNARRLTGHHE-TSNIH-----------EFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 58.151 bits (139), Expect = 8.799e-9
Identity = 49/177 (27.68%), Postives = 80/177 (45.20%), Query Frame = 3
Query:  660 NFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAE-SGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWL-----AGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMI 1172
            N E    Q E  +   EGI+  D  W+ + I   V +  G+VAS+   PIP   +G GCH N S     E+G   A+   + +++L +  +Y +      G L ++R L+  +  T N +           + S    +R  ++R+  S   EK  Y E+R PS+ C+ Y     +I
Sbjct:  194 NAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAI--EDAIEKLGKRHRYHIRAYDPKGGLDNARRLTGHHE-TSNIH-----------EFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALI 356          
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Match: SMESG000003829.1 (SMESG000003829.1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 448/448 (100.00%), Postives = 448/448 (100.00%), Query Frame = 3
Query:   96 MSNSPPTDIVPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            MSNSPPTDIVPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNSEIISSIKEISHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI
Sbjct:    1 MSNSPPTDIVPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNSEIISSIKEISHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 448          
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 260/442 (58.82%), Postives = 332/442 (75.11%), Query Frame = 3
Query:  123 VPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXX--XXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQ-EFIKYFDI 1439
            +P EV+FIQ I +DI+G SRGK+FP  KL+DL + KEE++ ++ ++GT  E     +    +HY N  +  +KS++RVAPWS+D SLAMVF D YD++ NSP P NPRLLAK KI ELE M +KL+IG+ENEFR+F K  +K + +S++  SQFHQ T    + +EL K  K  DI  DSWN E GSGQIEIPL + EGI G+DK WMF+E SKYVAD++ L A+YMT+PI  E+ NG HINHSLW+  +KG +N  W+ +  + LS++GK+WLAGILKH+R LSA +SPTVNCYRR+ +A +AP+ ISWNY DRSVAMRVKTS   EK NYIENR+PSSACNIY+A+A MIVAGIDGIKNKL L E GNG HCE+LP TL+E+L  LK DKVL EGLG KFVDWYVKVK+ET+V + K  ++H   + G+++ EF KYF +
Sbjct:    7 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIH---DVGLTELEFHKYFHL 445          
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 260/442 (58.82%), Postives = 332/442 (75.11%), Query Frame = 3
Query:  123 VPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXX--XXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQ-EFIKYFDI 1439
            +P EV+FIQ I +DI+G SRGK+FP  KL+DL + KEE++ ++ ++GT  E     +    +HY N  +  +KS++RVAPWS+D SLAMVF D YD++ NSP P NPRLLAK KI ELE M +KL+IG+ENEFR+F K  +K + +S++  SQFHQ T    + +EL K  K  DI  DSWN E GSGQIEIPL + EGI G+DK WMF+E SKYVAD++ L A+YMT+PI  E+ NG HINHSLW+  +KG +N  W+ +  + LS++GK+WLAGILKH+R LSA +SPTVNCYRR+ +A +AP+ ISWNY DRSVAMRVKTS   EK NYIENR+PSSACNIY+A+A MIVAGIDGIKNKL L E GNG HCE+LP TL+E+L  LK DKVL EGLG KFVDWYVKVK+ET+V + K  ++H   + G+++ EF KYF +
Sbjct:   18 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIH---DVGLTELEFHKYFHL 456          
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Match: SMESG000003836.1 (SMESG000003836.1)

HSP 1 Score: 509.22 bits (1310), Expect = 1.543e-178
Identity = 246/437 (56.29%), Postives = 319/437 (73.00%), Query Frame = 3
Query:  135 VQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXX--XXXXXXXXXHYENARLVLDKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            V+FIQ I +DINGI+RGKV+P+ KLSDLL  K+E++ ++ ++GT SE     S    +H+EN  LV D+++IR  PWS D SLAM F D YDRV N P P NPRL A+ ++NELE M  K  IG+ENEFR+F+K  +K     +    QF Q T +  Y+K L K LK+ +I +DSW+ E G GQIE+PL    G+EG+D  W FKE+SKYVA+  G++ASYM VP+  ++GNG HINHSLW K+ +  TNAMW     DE+SEI ++WLAG+LKHS+ L A ++PTVNCYRRI  A +AP+KISWNYRDR+VA RVK S + EK+NYIENR+PSSACNIYLA+AGMIVAGIDGIKNK++LP+  N  H E LP +L EAL  L  D+VL+ G+G KF+DW++K K ETDV VL++ DL + TEE + QEF KYF++
Sbjct:   14 VEFIQAITVDINGIARGKVYPVEKLSDLLEGKQEVVGLLEILGTKSEIPQTISELTRNHFENELLVPDQTSIRGCPWSDDSSLAMFFYDTYDRVKNVPWPFNPRLAARKQLNELEKMGFKFFIGVENEFRLFDKHTRKPFTQEICFDHQFTQSTTALPYMKGLCKILKRMNIEMDSWHLEYGLGQIEVPLKVYSGMEGVDNAWFFKELSKYVANDFGMIASYMCVPLARDAGNGLHINHSLWIKTNESFTNAMWAKSDKDEMSEIAQHWLAGLLKHSKALCAFFNPTVNCYRRILMANWAPNKISWNYRDRTVAFRVKASSNQEKVNYIENRLPSSACNIYLAIAGMIVAGIDGIKNKIKLPDPANIFHGEDLPRSLPEALDELSKDQVLINGMGEKFIDWFIKAKLETDVFVLRNVDLESQTEEALQQEFDKYFNL 450          
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Match: SMESG000003832.1 (SMESG000003832.1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.095e-149
Identity = 219/438 (50.00%), Postives = 305/438 (69.63%), Query Frame = 3
Query:  132 EVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNXXXXXXXXXXXHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 1439
            ++QFIQ + +DINGI RGK+F I KL+DL+  +EEI  +I + GTNSE+  SI + S+  N  +++  D+ T+++ PW ++ ++ MVF D+YD+    P P NPRL+ K K+ EL  +  +++IG+E+EF +F+K  K+   +       F Q T +  Y   + +      I  +S+N E G GQIE PL +  GIE +DK W+FKE+SKYVA+ +GL+ASYMT P+  +  NG HINHSLW +++    N   E  K +ELSE+GK+WLAG+LKHS+ LS I+SPTVNCYRRI++A+    +I+WNY DR VAMRVK S+D EKMN+IENR+PSSA NIYLAVAGMIVAG+DGIKN L+LP   N ++ E+LP +LSEAL   + DKVLVEGLG  FVD+++K K +TDV +LKD D+++ T  G  +E  KYF +
Sbjct:   17 KIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPI-NNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 453          
The following BLAST results are available for this feature:
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LGSN1.474e-3527.11lengsin, lens protein with glutamine synthetase do... [more]
GLUL1.791e-826.23glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.792e-826.23glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.792e-826.23glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL1.792e-826.23glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gln-35.069e-1329.44Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-35.069e-1329.44Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-35.069e-1329.44Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-35.175e-1325.34Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-36.017e-1325.34Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gs11.854e-924.05gene:FBgn0001142 transcript:FBtr0078115[more]
Gs11.854e-924.05gene:FBgn0001142 transcript:FBtr0078114[more]
Gs11.854e-924.05gene:FBgn0001142 transcript:FBtr0300568[more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgsn2.547e-2928.38lengsin, lens protein with glutamine synthetase do... [more]
glulb5.937e-927.68glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb5.937e-927.68glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb5.937e-927.68glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb6.183e-927.68glutamate-ammonia ligase (glutamine synthase) b [S... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pkn29.668e-3629.67protein kinase N2 [Source:Xenbase;Acc:XB-GENE-9952... [more]
avpr1b1.213e-3529.70arginine vasopressin receptor 1B [Source:Xenbase;A... [more]
c8a2.406e-725.14complement component 8, alpha polypeptide [Source:... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lgsn2.942e-3626.58lengsin, lens protein with glutamine synthetase do... [more]
Glul1.220e-826.23glutamate-ammonia ligase (glutamine synthetase) [S... [more]
Glul1.220e-826.23glutamate-ammonia ligase (glutamine synthetase) [S... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05907|GLN1A_PYRFU2.207e-4730.38Glutamine synthetase OS=Pyrococcus furiosus (strai... [more]
sp|O58097|GLN1A_PYRHO2.884e-4730.09Glutamine synthetase OS=Pyrococcus horikoshii (str... [more]
sp|P36687|GLN1A_PYRWO9.607e-4630.38Glutamine synthetase OS=Pyrococcus woesei OX=2262 ... [more]
sp|Q9UY99|GLN1A_PYRAB1.143e-4529.93Glutamine synthetase OS=Pyrococcus abyssi (strain ... [more]
sp|O08467|GLN1A_THEKO3.676e-4229.74Glutamine synthetase OS=Thermococcus kodakarensis ... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NYP76.359e-7133.76Gln-synt_C domain-containing protein OS=Paragonimu... [more]
R7VIP45.093e-6933.64Gln-synt_C domain-containing protein OS=Capitella ... [more]
A0A430Q4582.904e-6735.77Gln-synt_C domain-containing protein OS=Schistosom... [more]
A0A095ACE54.753e-6735.25Glutamine synthetase OS=Schistosoma haematobium OX... [more]
A0A430PZL09.619e-6735.77Gln-synt_C domain-containing protein OS=Schistosom... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgsn1.112e-3126.37lengsin, lens protein with glutamine synthetase do... [more]
lgsn1.251e-3126.37lengsin, lens protein with glutamine synthetase do... [more]
glulb3.347e-827.68glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
glulb3.850e-827.68glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
glula4.150e-827.32glutamine synthetase [Source:NCBI gene;Acc:1030462... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008530.13.143e-825.14pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO258691.510e-1723.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lgsn7.063e-3325.29lengsin, lens protein with glutamine synthetase do... [more]
glula8.799e-927.68glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
glula8.799e-927.68glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Gln-synt_C domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003829.10.000e+0100.00SMESG000003829.1[more]
SMESG000003831.10.000e+058.82SMESG000003831.1[more]
SMESG000003831.10.000e+058.82SMESG000003831.1[more]
SMESG000003836.11.543e-17856.29SMESG000003836.1[more]
SMESG000003832.12.095e-14950.00SMESG000003832.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010872 ID=SMED30010872|Name=Gln-synt_C domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1518bp
GTAAAATCAAAGTGCACAGCAGCCTACACAATTGATGCTCACTGATATTG
ATTTTAATTCACATTTCACATTTAAATATACACAAATAATACCTAATGTC
TAACTCTCCCCCGACGGATATTGTACCCCCTGAAGTTCAATTTATTCAAG
TTATACATATCGACATTAATGGAATATCTCGTGGAAAGGTTTTCCCAATC
GGAAAGTTAAGTGATCTTTTGCGGAAGAAAGAAGAAATAATTTGTATTAT
TGGAATGATTGGAACGAATTCTGAAATAATTTCGTCCATCAAAGAAATAT
CACATTATGAGAATGCTCGCCTCGTCCTTGATAAGTCGACAATTAGAGTA
GCTCCTTGGAGCCAGGATTGTTCCCTTGCAATGGTTTTTGCGGACGTATA
TGACAGGGTTGGCAATTCTCCACTACCTATAAACCCTCGGTTATTGGCCA
AATGCAAAATTAATGAGCTGGAGGCTATGGATTTGAAATTAGTTATTGGA
ATTGAAAATGAGTTTAGAATCTTTAACAAAACTGACAAGAAATTTGTCCA
AAACAGTATGAAGCATTACAGTCAGTTCCACCAAATTACTGAATCCTATT
CATATATTAAAGAATTGAACAAAGACTTAAAGAAATGCGATATATTAATT
GACAGCTGGAATTTTGAATGTGGATCTGGACAAATTGAAATTCCATTATT
GTCTTCTGAAGGAATAGAAGGACTTGACAAAACTTGGATGTTTAAAGAAA
TTTCAAAATATGTAGCTGATAAAATGGGATTAGTGGCTAGTTATATGACC
GTTCCGATTCCGGCGGAATCCGGTAATGGATGTCATATTAATCATTCTTT
ATGGACGAAATCCGAAAAAGGACCTACGAATGCCATGTGGGAACCCGAAA
AAGTAGATGAGTTATCGGAAATAGGAAAATACTGGCTTGCCGGAATTTTA
AAACACTCTCGGGGTCTATCTGCCATTTATTCTCCAACCGTGAATTGTTA
TAGAAGAATTCAATCCGCTCTTTTTGCTCCAGACAAAATTTCATGGAACT
ATAGAGATAGATCAGTTGCTATGAGAGTGAAAACATCACAAGATTATGAG
AAAATGAATTATATAGAAAACCGAATTCCAAGCTCAGCTTGCAATATTTA
TTTGGCAGTGGCAGGAATGATTGTAGCTGGCATTGACGGTATTAAGAACA
AACTTCAACTTCCAGAGCATGGGAATGGAAGTCATTGTGAAAGGCTACCC
ACGACGCTTTCAGAAGCTTTAAGTGCTTTAAAAGACGATAAAGTATTGGT
TGAAGGATTGGGGGCAAAATTTGTAGATTGGTATGTCAAAGTGAAAGAAG
AAACTGATGTTAAAGTCCTGAAAGATTCTGATTTACATAATAATACCGAG
GAAGGAATATCTCAAGAATTTATAAAATATTTTGATATTTAACTAAACGT
TTACATATATTTTATTCTTTTGTTTACTTTGCTTGTTAAATTATAGTTTT
CTAATTCTTCTAAAAAAA
back to top

protein sequence of SMED30010872-orf-1

>SMED30010872-orf-1 ID=SMED30010872-orf-1|Name=SMED30010872-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MSNSPPTDIVPPEVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIIC
IIGMIGTNSEIISSIKEISHYENARLVLDKSTIRVAPWSQDCSLAMVFAD
VYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKF
VQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIP
LLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINH
SLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVN
CYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACN
IYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKV
LVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036651Gln_synt_N
IPR008146Gln_synth_cat_dom
IPR014746Gln_synth/guanido_kin_cat_dom
IPR008147Gln_synt_b-grasp
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0006542glutamine biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004356glutamate-ammonia ligase activity
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008146Glutamine synthetase, catalytic domainSMARTSM01230Gln_synt_C_2coord: 111..362
e-value: 7.5E-61
score: 218.2
IPR008146Glutamine synthetase, catalytic domainPFAMPF00120Gln-synt_Ccoord: 113..419
e-value: 6.1E-73
score: 245.8
NoneNo IPR availableGENE3DG3DSA:3.30.590.10coord: 108..436
e-value: 2.8E-83
score: 281.4
NoneNo IPR availablePANTHERPTHR43407FAMILY NOT NAMEDcoord: 11..431
NoneNo IPR availablePANTHERPTHR43407:SF1LENGSINcoord: 11..431
IPR036651Glutamine synthetase, N-terminal domain superfamilySUPERFAMILYSSF54368Glutamine synthetase, N-terminal domaincoord: 12..106
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 111..419