CCR4-NOT transcription complex subunit 6

Overview
NameCCR4-NOT transcription complex subunit 6
Smed IDSMED30010856
Length (bp)3375
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCR4-NOT transcription complex subunit 6 (SMED30010856) t-SNE clustered cells

Violin plots show distribution of expression levels for CCR4-NOT transcription complex subunit 6 (SMED30010856) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCR4-NOT transcription complex subunit 6 (SMED30010856) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCR4-NOT transcription complex subunit 6 (SMED30010856) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010856

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30010856SMESG000023679.1 SmedASXL_017262SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30010856SMESG000023679.1 dd_Smed_v4_13816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010856SMESG000023679.1 dd_Smed_v4_5045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010856SMESG000023679.1 dd_Smed_v4_5045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30010856SMESG000023679.1 dd_Smed_v4_5045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010856SMESG000023679.1 dd_Smed_v4_5045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010856SMESG000023679.1 dd_Smed_v4_5045_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Match: CNOT6 (CCR4-NOT transcription complex subunit 6 [Source:HGNC Symbol;Acc:HGNC:14099])

HSP 1 Score: 315.849 bits (808), Expect = 5.482e-95
Identity = 176/413 (42.62%), Postives = 241/413 (58.35%), Query Frame = 1
Query: 1342 TNDIFDSLKTCLIPQRFLNYY---------KIVA--PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGP-CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            T DI +  +     +R LNY          +I    PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADI+ LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    ++     LG    +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S        N  + H F    AY    ESGL  +TNYT+DF+GIIDYIF+SK  L  LG L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  133 TQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAY----ESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Match: CNOT6 (CCR4-NOT transcription complex subunit 6 [Source:HGNC Symbol;Acc:HGNC:14099])

HSP 1 Score: 315.849 bits (808), Expect = 5.482e-95
Identity = 176/413 (42.62%), Postives = 241/413 (58.35%), Query Frame = 1
Query: 1342 TNDIFDSLKTCLIPQRFLNYY---------KIVA--PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGP-CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            T DI +  +     +R LNY          +I    PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADI+ LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    ++     LG    +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S        N  + H F    AY    ESGL  +TNYT+DF+GIIDYIF+SK  L  LG L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  133 TQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAY----ESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Match: CNOT6 (CCR4-NOT transcription complex subunit 6 [Source:HGNC Symbol;Acc:HGNC:14099])

HSP 1 Score: 315.849 bits (808), Expect = 5.482e-95
Identity = 176/413 (42.62%), Postives = 241/413 (58.35%), Query Frame = 1
Query: 1342 TNDIFDSLKTCLIPQRFLNYY---------KIVA--PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGP-CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            T DI +  +     +R LNY          +I    PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADI+ LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    ++     LG    +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S        N  + H F    AY    ESGL  +TNYT+DF+GIIDYIF+SK  L  LG L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  133 TQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAY----ESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Match: CNOT6L (CCR4-NOT transcription complex subunit 6 like [Source:HGNC Symbol;Acc:HGNC:18042])

HSP 1 Score: 312.383 bits (799), Expect = 6.520e-94
Identity = 165/371 (44.47%), Postives = 220/371 (59.30%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S           + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +
Sbjct:  165 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQ 530          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Match: CNOT6L (CCR4-NOT transcription complex subunit 6 like [Source:HGNC Symbol;Acc:HGNC:18042])

HSP 1 Score: 312.383 bits (799), Expect = 6.520e-94
Identity = 165/371 (44.47%), Postives = 220/371 (59.30%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S           + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +
Sbjct:  165 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQ 530          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Match: ccr-4 (CCR (Yeast CCR4/NOT complex component) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD13])

HSP 1 Score: 293.508 bits (750), Expect = 1.045e-86
Identity = 156/380 (41.05%), Postives = 224/380 (58.95%), Query Frame = 1
Query: 1417 PPNRNWHII-----EKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPE-LLNRVMNRDNVALSIILEVKDP------------KMN----KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            PP RNW +I     E+P    +FT++CYNVLC KYAT + Y YCP++AL+WEYRK  I++EI  Y+AD+I LQE+ET Q+  +F  EL++  Y G+F  KSR++TM E + K VDGCAIFWKV+ F+       EF  S + + K    E +LNRVM RDN+ L  +L++K+              MN       L V+T HIHWDPE+ DVKL+Q++  + E+   + +  K   +       +PV++CGDFNSLP SGV +YL KG++ R H+D + F D     +++   D+    +V+ H    D A      + + +TNYT DF+G+IDYIF + + L  LG L      W +  KI+G PH H  SDH  ++ +
Sbjct:  200 PPERNWVMIRHADPERPI--ATFTVLCYNVLCDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEF--SSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQ---QQVPVLICGDFNSLPDSGVFEYLSKGQITRRHMDLKSFRDDSCLEKFTNSTDK----NVISHPLRLDSACDI---NSIPFTNYTLDFKGMIDYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQ 565          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Match: ccr-4 (CCR (Yeast CCR4/NOT complex component) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD13])

HSP 1 Score: 293.123 bits (749), Expect = 1.103e-86
Identity = 156/380 (41.05%), Postives = 224/380 (58.95%), Query Frame = 1
Query: 1417 PPNRNWHII-----EKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPE-LLNRVMNRDNVALSIILEVKDP------------KMN----KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            PP RNW +I     E+P    +FT++CYNVLC KYAT + Y YCP++AL+WEYRK  I++EI  Y+AD+I LQE+ET Q+  +F  EL++  Y G+F  KSR++TM E + K VDGCAIFWKV+ F+       EF  S + + K    E +LNRVM RDN+ L  +L++K+              MN       L V+T HIHWDPE+ DVKL+Q++  + E+   + +  K   +       +PV++CGDFNSLP SGV +YL KG++ R H+D + F D     +++   D+    +V+ H    D A      + + +TNYT DF+G+IDYIF + + L  LG L      W +  KI+G PH H  SDH  ++ +
Sbjct:  191 PPERNWVMIRHADPERPI--ATFTVLCYNVLCDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEF--SSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQ---QQVPVLICGDFNSLPDSGVFEYLSKGQITRRHMDLKSFRDDSCLEKFTNSTDK----NVISHPLRLDSACDI---NSIPFTNYTLDFKGMIDYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQ 556          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Match: ccr-4 (CCR (Yeast CCR4/NOT complex component) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD13])

HSP 1 Score: 293.123 bits (749), Expect = 1.103e-86
Identity = 156/380 (41.05%), Postives = 224/380 (58.95%), Query Frame = 1
Query: 1417 PPNRNWHII-----EKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPE-LLNRVMNRDNVALSIILEVKDP------------KMN----KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            PP RNW +I     E+P    +FT++CYNVLC KYAT + Y YCP++AL+WEYRK  I++EI  Y+AD+I LQE+ET Q+  +F  EL++  Y G+F  KSR++TM E + K VDGCAIFWKV+ F+       EF  S + + K    E +LNRVM RDN+ L  +L++K+              MN       L V+T HIHWDPE+ DVKL+Q++  + E+   + +  K   +       +PV++CGDFNSLP SGV +YL KG++ R H+D + F D     +++   D+    +V+ H    D A      + + +TNYT DF+G+IDYIF + + L  LG L      W +  KI+G PH H  SDH  ++ +
Sbjct:  191 PPERNWVMIRHADPERPI--ATFTVLCYNVLCDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEF--SSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQ---QQVPVLICGDFNSLPDSGVFEYLSKGQITRRHMDLKSFRDDSCLEKFTNSTDK----NVISHPLRLDSACDI---NSIPFTNYTLDFKGMIDYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQ 556          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Match: ccr-4 (CCR (Yeast CCR4/NOT complex component) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD13])

HSP 1 Score: 292.352 bits (747), Expect = 2.981e-86
Identity = 156/380 (41.05%), Postives = 224/380 (58.95%), Query Frame = 1
Query: 1417 PPNRNWHII-----EKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPE-LLNRVMNRDNVALSIILEVKDP------------KMN----KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            PP RNW +I     E+P    +FT++CYNVLC KYAT + Y YCP++AL+WEYRK  I++EI  Y+AD+I LQE+ET Q+  +F  EL++  Y G+F  KSR++TM E + K VDGCAIFWKV+ F+       EF  S + + K    E +LNRVM RDN+ L  +L++K+              MN       L V+T HIHWDPE+ DVKL+Q++  + E+   + +  K   +       +PV++CGDFNSLP SGV +YL KG++ R H+D + F D     +++   D+    +V+ H    D A      + + +TNYT DF+G+IDYIF + + L  LG L      W +  KI+G PH H  SDH  ++ +
Sbjct:  207 PPERNWVMIRHADPERPI--ATFTVLCYNVLCDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEF--SSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQ---QQVPVLICGDFNSLPDSGVFEYLSKGQITRRHMDLKSFRDDSCLEKFTNSTDK----NVISHPLRLDSACDI---NSIPFTNYTLDFKGMIDYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQ 572          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Match: ccr-4 (CCR (Yeast CCR4/NOT complex component) homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AD13])

HSP 1 Score: 283.493 bits (724), Expect = 1.176e-85
Identity = 148/359 (41.23%), Postives = 214/359 (59.61%), Query Frame = 1
Query: 1465 SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPE-LLNRVMNRDNVALSIILEVKDP------------KMN----KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            +FT++CYNVLC KYAT + Y YCP++AL+WEYRK  I++EI  Y+AD+I LQE+ET Q+  +F  EL++  Y G+F  KSR++TM E + K VDGCAIFWKV+ F+       EF  S + + K    E +LNRVM RDN+ L  +L++K+              MN       L V+T HIHWDPE+ DVKL+Q++  + E+   + +  K   +       +PV++CGDFNSLP SGV +YL KG++ R H+D + F D     +++   D+    +V+ H    D A      + + +TNYT DF+G+IDYIF + + L  LG L      W +  KI+G PH H  SDH  ++ +
Sbjct:   13 TFTVLCYNVLCDKYATVNQYSYCPSWALNWEYRKGLIIKEIRTYEADVITLQEVETEQFRTLFQPELKQLGYAGIFEAKSRAKTMGEEERKYVDGCAIFWKVDKFDMDKQYLFEF--SSVAMKKASTSENMLNRVMPRDNIGLCAVLKIKESVYANKFLGRMQIPMNDNVVGNPLVVATAHIHWDPEFCDVKLVQSMMLTHEVSRVLEEVSKKYQITQQ---QVPVLICGDFNSLPDSGVFEYLSKGQITRRHMDLKSFRDDSCLEKFTNSTDK----NVISHPLRLDSACDI---NSIPFTNYTLDFKGMIDYIFATPQSLARLGILGPFDPQWVQSNKILGFPHPHVASDHIPIMAQ 359          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Match: twin (gene:FBgn0011725 transcript:FBtr0084567)

HSP 1 Score: 306.605 bits (784), Expect = 3.700e-92
Identity = 172/396 (43.43%), Postives = 234/396 (59.09%), Query Frame = 1
Query: 1384 QRFLNY------YKIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN--------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV--LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSG 2511
            Q+ L Y      + +  PP R W  + KP+       FT+MCYNVLC KYAT  MY YCP++AL WEYRK+ I++EI  Y ADII LQE+ET Q+ + F  EL+   Y+G+F PKSR++TM E + K VDGCAIF++   F  +     EF    +  ++  +  +LNRVM +DN+ L+ +L+VK+             + L V T HIHWDPE+ DVKLIQT+  S+EL   I +   S    H    + + ++LCGDFNSLP SGVV++L KG V   H+DF++ G K      S +Q   + ND     H F    AY   +E  +  TNYT+DF+GIIDYIF++K  +  LG L  +   W  + K+VG PH H  SDHF LLVELEL ++ 
Sbjct:  148 QKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEG-SDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYK------SCLQ-RLLSNDTNEFTHSFKLASAY---NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTA 532          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Match: twin (gene:FBgn0011725 transcript:FBtr0084566)

HSP 1 Score: 306.605 bits (784), Expect = 5.491e-92
Identity = 172/396 (43.43%), Postives = 234/396 (59.09%), Query Frame = 1
Query: 1384 QRFLNY------YKIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN--------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV--LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSG 2511
            Q+ L Y      + +  PP R W  + KP+       FT+MCYNVLC KYAT  MY YCP++AL WEYRK+ I++EI  Y ADII LQE+ET Q+ + F  EL+   Y+G+F PKSR++TM E + K VDGCAIF++   F  +     EF    +  ++  +  +LNRVM +DN+ L+ +L+VK+             + L V T HIHWDPE+ DVKLIQT+  S+EL   I +   S    H    + + ++LCGDFNSLP SGVV++L KG V   H+DF++ G K      S +Q   + ND     H F    AY   +E  +  TNYT+DF+GIIDYIF++K  +  LG L  +   W  + K+VG PH H  SDHF LLVELEL ++ 
Sbjct:  155 QKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEG-SDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYK------SCLQ-RLLSNDTNEFTHSFKLASAY---NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTA 539          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Match: twin (gene:FBgn0011725 transcript:FBtr0084568)

HSP 1 Score: 306.605 bits (784), Expect = 5.491e-92
Identity = 172/396 (43.43%), Postives = 234/396 (59.09%), Query Frame = 1
Query: 1384 QRFLNY------YKIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN--------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV--LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSG 2511
            Q+ L Y      + +  PP R W  + KP+       FT+MCYNVLC KYAT  MY YCP++AL WEYRK+ I++EI  Y ADII LQE+ET Q+ + F  EL+   Y+G+F PKSR++TM E + K VDGCAIF++   F  +     EF    +  ++  +  +LNRVM +DN+ L+ +L+VK+             + L V T HIHWDPE+ DVKLIQT+  S+EL   I +   S    H    + + ++LCGDFNSLP SGVV++L KG V   H+DF++ G K      S +Q   + ND     H F    AY   +E  +  TNYT+DF+GIIDYIF++K  +  LG L  +   W  + K+VG PH H  SDHF LLVELEL ++ 
Sbjct:  155 QKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEG-SDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYK------SCLQ-RLLSNDTNEFTHSFKLASAY---NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTA 539          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Match: twin (gene:FBgn0011725 transcript:FBtr0084571)

HSP 1 Score: 306.605 bits (784), Expect = 5.491e-92
Identity = 172/396 (43.43%), Postives = 234/396 (59.09%), Query Frame = 1
Query: 1384 QRFLNY------YKIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN--------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV--LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSG 2511
            Q+ L Y      + +  PP R W  + KP+       FT+MCYNVLC KYAT  MY YCP++AL WEYRK+ I++EI  Y ADII LQE+ET Q+ + F  EL+   Y+G+F PKSR++TM E + K VDGCAIF++   F  +     EF    +  ++  +  +LNRVM +DN+ L+ +L+VK+             + L V T HIHWDPE+ DVKLIQT+  S+EL   I +   S    H    + + ++LCGDFNSLP SGVV++L KG V   H+DF++ G K      S +Q   + ND     H F    AY   +E  +  TNYT+DF+GIIDYIF++K  +  LG L  +   W  + K+VG PH H  SDHF LLVELEL ++ 
Sbjct:  155 QKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEG-SDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYK------SCLQ-RLLSNDTNEFTHSFKLASAY---NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTA 539          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Match: twin (gene:FBgn0011725 transcript:FBtr0084569)

HSP 1 Score: 306.22 bits (783), Expect = 8.587e-92
Identity = 172/396 (43.43%), Postives = 234/396 (59.09%), Query Frame = 1
Query: 1384 QRFLNY------YKIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN--------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV--LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSG 2511
            Q+ L Y      + +  PP R W  + KP+       FT+MCYNVLC KYAT  MY YCP++AL WEYRK+ I++EI  Y ADII LQE+ET Q+ + F  EL+   Y+G+F PKSR++TM E + K VDGCAIF++   F  +     EF    +  ++  +  +LNRVM +DN+ L+ +L+VK+             + L V T HIHWDPE+ DVKLIQT+  S+EL   I +   S    H    + + ++LCGDFNSLP SGVV++L KG V   H+DF++ G K      S +Q   + ND     H F    AY   +E  +  TNYT+DF+GIIDYIF++K  +  LG L  +   W  + K+VG PH H  SDHF LLVELEL ++ 
Sbjct:  170 QKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTRPACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETEQFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQLAMANAEG-SDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPEFCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGKGRVSMDHLDFKDMGYK------SCLQ-RLLSNDTNEFTHSFKLASAY---NEDIMPHTNYTFDFKGIIDYIFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTA 554          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Match: cnot6b (CCR4-NOT transcription complex, subunit 6b [Source:ZFIN;Acc:ZDB-GENE-071004-97])

HSP 1 Score: 318.546 bits (815), Expect = 3.131e-96
Identity = 169/378 (44.71%), Postives = 228/378 (60.32%), Query Frame = 1
Query: 1417 PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLG--PCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            PP R+W ++++P         T+MCYNVLC KYAT  +Y YCP++AL+W YRK+ I++EI    ADII LQE+ET QY N F +EL K+ YDG F PKSR+RTM ESD K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE+K              M K+ L V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     +      +P++LC D NSLP SGVV+YL  G V+ +H DF+E         ++        N  + H F    AY    E+GL  +TNYT+DFRG+IDYIF+S+  L +LG L  +  +W  +  I G PH    SDHFSL  +LEL
Sbjct:  169 PPPRSWIVLQEPERSRPTALLTVMCYNVLCDKYATRQLYGYCPSWALNWSYRKKSIMQEILNCNADIISLQEVETEQYFNFFLLELSKQGYDGFFSPKSRARTMSESDRKHVDGCAIFYKTEKFNVVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELKKELIEVSSGKSIHAMEKQLLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKHSSVSGETSSIPLVLCADLNSLPDSGVVEYLSTGGVDCTHKDFKELRYSDSLTNFNCNGKNSTSNGRITHAFKLKSAY----ENGLMPYTNYTFDFRGVIDYIFYSRPQLNVLGVLGPLDTNWLLENNISGCPHPLIPSDHFSLFAQLEL 541          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Match: cnot6a (CCR4-NOT transcription complex, subunit 6a [Source:ZFIN;Acc:ZDB-GENE-030131-2768])

HSP 1 Score: 314.309 bits (804), Expect = 1.059e-94
Identity = 169/399 (42.36%), Postives = 239/399 (59.90%), Query Frame = 1
Query: 1384 QRFLNYY----------KIVAPPNRNWHIIEKPS---DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            +R LNY            I  PP R+W  +++P        F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    ADII LQE+ET QY N F +EL+++ Y+G F PKSR+RTM ESD K VDGCA+F+K + F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++              M K+ L V+  H+HWDPEYSDVKL+QT+ + SE+ N +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E         ++        +  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+S+  L +LG L  +   W  +  + G PH H  SDHFSL  +LEL
Sbjct:  147 RRLLNYLLDNLAGTKRAPIEQPPPRSWIPLQEPDRTRPAALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIMQEILSCSADIISLQEVETEQYYNYFLLELKEQGYEGFFSPKSRARTMSESDRKHVDGCAVFYKTDKFSLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKEMMELSAGKPLHGMEKQLLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDGAHKDFKELRYIDSLTNFNCNGKNGTSSTRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSQPLLNVLGVLGPLEHHWLLENNVTGCPHPHIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Match: cnot6a (CCR4-NOT transcription complex, subunit 6a [Source:ZFIN;Acc:ZDB-GENE-030131-2768])

HSP 1 Score: 314.309 bits (804), Expect = 1.059e-94
Identity = 169/399 (42.36%), Postives = 239/399 (59.90%), Query Frame = 1
Query: 1384 QRFLNYY----------KIVAPPNRNWHIIEKPS---DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            +R LNY            I  PP R+W  +++P        F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    ADII LQE+ET QY N F +EL+++ Y+G F PKSR+RTM ESD K VDGCA+F+K + F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++              M K+ L V+  H+HWDPEYSDVKL+QT+ + SE+ N +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E         ++        +  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+S+  L +LG L  +   W  +  + G PH H  SDHFSL  +LEL
Sbjct:  147 RRLLNYLLDNLAGTKRAPIEQPPPRSWIPLQEPDRTRPAALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIMQEILSCSADIISLQEVETEQYYNYFLLELKEQGYEGFFSPKSRARTMSESDRKHVDGCAVFYKTDKFSLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKEMMELSAGKPLHGMEKQLLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDGAHKDFKELRYIDSLTNFNCNGKNGTSSTRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSQPLLNVLGVLGPLEHHWLLENNVTGCPHPHIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Match: cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:NCBI gene;Acc:553665])

HSP 1 Score: 309.686 bits (792), Expect = 5.347e-93
Identity = 166/372 (44.62%), Postives = 219/372 (58.87%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK--------DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSEN--MPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELE 2496
            P R W  + +    M    FT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY   F   L+ R YDG F PKSR++ + E + K VDGC +F+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEVK         P   K+ L V+  H+HWDPEYSDVKLIQT+ + SEL +       S N   P      +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY+    + + +TNYTYDF+G+IDYIFFSK H+ +LG L  +   W +   I G PH H  SDHFSLL +LE
Sbjct:  165 PQRPWITLRERDQMMPTAVFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEITNCDADIISLQEVETEQYYTFFLETLKDRGYDGFFCPKSRAKLVSEQERKHVDGCGVFFKTEKFALVQKHTVEFNQVAMANSEG-SEVMLNRVMTKDNIGVAVLLEVKKDLFATGLKPPPEKQLLLVANAHMHWDPEYSDVKLIQTMMFLSELKSIAERASGSINSSSPTSETSSIPIVLCADLNSLPDSGVVEYLSNGGVAENHKDFKELRYSDCLTNFSCNGKNGKPDGSITHSFQLKSAYEG---NLMPYTNYTYDFKGVIDYIFFSKTHMSVLGVLGPLETQWLKDNNITGCPHPHIPSDHFSLLAQLE 532          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Match: cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:NCBI gene;Acc:553665])

HSP 1 Score: 309.686 bits (792), Expect = 5.347e-93
Identity = 166/372 (44.62%), Postives = 219/372 (58.87%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK--------DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSEN--MPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELE 2496
            P R W  + +    M    FT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY   F   L+ R YDG F PKSR++ + E + K VDGC +F+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEVK         P   K+ L V+  H+HWDPEYSDVKLIQT+ + SEL +       S N   P      +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY+    + + +TNYTYDF+G+IDYIFFSK H+ +LG L  +   W +   I G PH H  SDHFSLL +LE
Sbjct:  165 PQRPWITLRERDQMMPTAVFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEITNCDADIISLQEVETEQYYTFFLETLKDRGYDGFFCPKSRAKLVSEQERKHVDGCGVFFKTEKFALVQKHTVEFNQVAMANSEG-SEVMLNRVMTKDNIGVAVLLEVKKDLFATGLKPPPEKQLLLVANAHMHWDPEYSDVKLIQTMMFLSELKSIAERASGSINSSSPTSETSSIPIVLCADLNSLPDSGVVEYLSNGGVAENHKDFKELRYSDCLTNFSCNGKNGKPDGSITHSFQLKSAYEG---NLMPYTNYTYDFKGVIDYIFFSKTHMSVLGVLGPLETQWLKDNNITGCPHPHIPSDHFSLLAQLE 532          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:Xenbase;Acc:XB-GENE-487527])

HSP 1 Score: 314.694 bits (805), Expect = 1.231e-94
Identity = 167/375 (44.53%), Postives = 228/375 (60.80%), Query Frame = 1
Query: 1420 PNRNWHIIEK-----PSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEV-KD-------PKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            P R W  +++     PS  +SFT+MC+NVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M + + K VDGCAIF++ E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE+ KD       P  +  K  L V+  H+HWDPEYSDVKLIQT+ + SEL + I         P   P  +P +LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +LEL
Sbjct:  172 PQRPWITLKERDQILPS--VSFTVMCFNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVSCDADIISLQEVETEQYYTLFMPALKERGYDGFFSPKSRAKIMSDQEKKHVDGCAIFFRTEKFSLVQKHTVEFNQIAMANSEG-SEAMLNRVMTKDNIGVTVLLELHKDLSGAGMKPHHSSEKQLLMVANAHMHWDPEYSDVKLIQTMMFVSELKSIIEKAASRPGSPTPDPNSIPFVLCADLNSLPDSGVVEYLTNGGVADNHKDFKELRYNECLTNFSCNGKNGTPDGRITHGFQLRSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMDVLGVLGPLDPQWMVENNITGCPHPHIPSDHFSLLTQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:Xenbase;Acc:XB-GENE-487527])

HSP 1 Score: 313.153 bits (801), Expect = 3.732e-94
Identity = 167/379 (44.06%), Postives = 228/379 (60.16%), Query Frame = 1
Query: 1420 PNRNWHIIEK-----PSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEV-KD-----------PKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            P R W  +++     PS  +SFT+MC+NVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M + + K VDGCAIF++ E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE+ KD           P  +  K  L V+  H+HWDPEYSDVKLIQT+ + SEL + I         P   P  +P +LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +LEL
Sbjct:  165 PQRPWITLKERDQILPS--VSFTVMCFNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVSCDADIISLQEVETEQYYTLFMPALKERGYDGFFSPKSRAKIMSDQEKKHVDGCAIFFRTEKFSLVQKHTVEFNQIAMANSEG-SEAMLNRVMTKDNIGVTVLLELHKDLSGIFISIGMKPHHSSEKQLLMVANAHMHWDPEYSDVKLIQTMMFVSELKSIIEKAASRPGSPTPDPNSIPFVLCADLNSLPDSGVVEYLTNGGVADNHKDFKELRYNECLTNFSCNGKNGTPDGRITHGFQLRSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMDVLGVLGPLDPQWMVENNITGCPHPHIPSDHFSLLTQLEL 537          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:Xenbase;Acc:XB-GENE-487527])

HSP 1 Score: 313.923 bits (803), Expect = 4.353e-94
Identity = 167/375 (44.53%), Postives = 228/375 (60.80%), Query Frame = 1
Query: 1420 PNRNWHIIEK-----PSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEV-KD-------PKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            P R W  +++     PS  +SFT+MC+NVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M + + K VDGCAIF++ E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE+ KD       P  +  K  L V+  H+HWDPEYSDVKLIQT+ + SEL + I         P   P  +P +LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +LEL
Sbjct:  165 PQRPWITLKERDQILPS--VSFTVMCFNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVSCDADIISLQEVETEQYYTLFMPALKERGYDGFFSPKSRAKIMSDQEKKHVDGCAIFFRTEKFSLVQKHTVEFNQIAMANSEG-SEAMLNRVMTKDNIGVTVLLELHKDLSGAGMKPHHSSEKQLLMVANAHMHWDPEYSDVKLIQTMMFVSELKSIIEKAASRPGSPTPDPNSIPFVLCADLNSLPDSGVVEYLTNGGVADNHKDFKELRYNECLTNFSCNGKNGTPDGRITHGFQLRSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMDVLGVLGPLDPQWMVENNITGCPHPHIPSDHFSLLTQLEL 533          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:Xenbase;Acc:XB-GENE-487527])

HSP 1 Score: 290.812 bits (743), Expect = 2.789e-86
Identity = 155/358 (43.30%), Postives = 215/358 (60.06%), Query Frame = 1
Query: 1420 PNRNWHIIEK-----PSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEV-KD-------PKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAP 2448
            P R W  +++     PS  +SFT+MC+NVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY  +F   L++R YDG F PKSR++ M + + K VDGCAIF++ E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE+ KD       P  +  K  L V+  H+HWDPEYSDVKLIQT+ + SEL + I         P   P  +P +LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G P
Sbjct:  165 PQRPWITLKERDQILPS--VSFTVMCFNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVSCDADIISLQEVETEQYYTLFMPALKERGYDGFFSPKSRAKIMSDQEKKHVDGCAIFFRTEKFSLVQKHTVEFNQIAMANSEG-SEAMLNRVMTKDNIGVTVLLELHKDLSGAGMKPHHSSEKQLLMVANAHMHWDPEYSDVKLIQTMMFVSELKSIIEKAASRPGSPTPDPNSIPFVLCADLNSLPDSGVVEYLTNGGVADNHKDFKELRYNECLTNFSCNGKNGTPDGRITHGFQLRSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMDVLGVLGPLDPQWMVENNITGCP 516          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Match: PDE12 (phosphodiesterase 12 [Source:HGNC Symbol;Acc:HGNC:25386])

HSP 1 Score: 127.487 bits (319), Expect = 5.717e-30
Identity = 101/388 (26.03%), Postives = 172/388 (44.33%), Query Frame = 1
Query: 1381 PQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHM-----YPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLN----------RVMNRDNVALSIILE-VKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELE 2496
            P R+L+  +IV        +  + +    F  + YN+L + YA T +     YPYCPA+AL   YR   +  E+  Y+ADI+CLQE +   +E      L +   +G +  K R +          +G A F+  + F  +    H+  L+   + +    ELL           RV+ R +    ++LE +++P    R++CV+  H+++ P+   ++L+Q     + L +   + Y            +PV+ CGDFNSLP +G+  ++  G +     D            W++  +E   N  L H F+   A  +       +TNY  +F G +DYIF     L L   +  +P S  E  +    P V   SDH +L+ +L+
Sbjct:  200 PGRYLSDGRIV--------LTREGAGPGRFRTVSYNILAEVYARTELSREVLYPYCPAWALQGGYRHSLLRRELSGYRADILCLQEADREVFEAALGPLLEQLGMEGRYRGKERQQ----------EGLATFYSRDRFRLLGQ--HDISLAGALLGEPRHSELLGRLSRYPGARERVLKRSSALQVLVLESIEEP---SRRICVANTHLYFHPKGGHIRLVQMAVALAHLGHVANELYGG----------IPVVFCGDFNSLPNTGLHRFVQGGAIAEDDED------------WTSNGEEERCNMALTHPFSLASACGEP-----AYTNYIGEFHGCLDYIFIDSRQLALE-QIIPLP-SHEEVTQYRALPSVAHPSDHLALVCDLK 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Match: Cnot6 (CCR4-NOT transcription complex, subunit 6 [Source:MGI Symbol;Acc:MGI:2144529])

HSP 1 Score: 321.627 bits (823), Expect = 2.413e-97
Identity = 178/406 (43.84%), Postives = 240/406 (59.11%), Query Frame = 1
Query: 1357 DSLKTCLIP---QRFLNYY------KIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            D L  CL P   +R LNY           PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADII LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     LG C  +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S      + N  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+SK  L  L  L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  135 DILNLCLEPDGTRRLLNYLLDNLSVSTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Match: Cnot6 (CCR4-NOT transcription complex, subunit 6 [Source:MGI Symbol;Acc:MGI:2144529])

HSP 1 Score: 320.087 bits (819), Expect = 8.281e-97
Identity = 178/411 (43.31%), Postives = 240/411 (58.39%), Query Frame = 1
Query: 1357 DSLKTCLIP---QRFLNYY-----------KIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            D L  CL P   +R LNY                PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADII LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     LG C  +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S      + N  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+SK  L  L  L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  135 DILNLCLEPDGTRRLLNYLLDNLSGTAKRISTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Match: Cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:MGI Symbol;Acc:MGI:2443154])

HSP 1 Score: 313.923 bits (803), Expect = 1.505e-94
Identity = 165/371 (44.47%), Postives = 220/371 (59.30%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI  + ADII LQE+ET QY  +F   L+ R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S           + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +
Sbjct:  165 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGFQLKSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQ 530          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Match: Cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:MGI Symbol;Acc:MGI:2443154])

HSP 1 Score: 313.923 bits (803), Expect = 1.782e-94
Identity = 165/371 (44.47%), Postives = 220/371 (59.30%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI  + ADII LQE+ET QY  +F   L+ R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S           + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +
Sbjct:  170 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGFQLKSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQ 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Match: Cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:MGI Symbol;Acc:MGI:2443154])

HSP 1 Score: 248.825 bits (634), Expect = 2.302e-72
Identity = 129/271 (47.60%), Postives = 168/271 (61.99%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREF 2190
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI  + ADII LQE+ET QY  +F   L+ R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E 
Sbjct:  165 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKEL 433          
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Match: sp|Q5BJ41|CNOT6_XENLA (CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis OX=8355 GN=cnot6 PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 1.688e-96
Identity = 178/406 (43.84%), Postives = 240/406 (59.11%), Query Frame = 1
Query: 1357 DSLKTCLIP---QRFLNYY------KIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            D L  CL P   +R LNY           PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADII LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     LG C  +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S      + N  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+SK  L  L  L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  135 DILNLCLEPDGTRRLLNYLLDNLSVSTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Match: sp|Q6AXU9|CNOT6_RAT (CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus OX=10116 GN=Cnot6 PE=2 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 5.792e-96
Identity = 178/411 (43.31%), Postives = 240/411 (58.39%), Query Frame = 1
Query: 1357 DSLKTCLIP---QRFLNYY-----------KIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            D L  CL P   +R LNY                PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADII LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     LG C  +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S      + N  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+SK  L  L  L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  135 DILNLCLEPDGTRRLLNYLLDNLSGTAKRISTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Match: sp|Q8K3P5|CNOT6_MOUSE (CCR4-NOT transcription complex subunit 6 OS=Mus musculus OX=10090 GN=Cnot6 PE=1 SV=2)

HSP 1 Score: 320.087 bits (819), Expect = 5.792e-96
Identity = 178/411 (43.31%), Postives = 240/411 (58.39%), Query Frame = 1
Query: 1357 DSLKTCLIP---QRFLNYY-----------KIVAPPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            D L  CL P   +R LNY                PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADII LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    +S     LG C  +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S      + N  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+SK  L  L  L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  135 DILNLCLEPDGTRRLLNYLLDNLSGTAKRISTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIISLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKELIEMSSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRSLKSSVLGECGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCNGKNGMTNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSKPQLNTLAILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Match: sp|Q9ULM6|CNOT6_HUMAN (CCR4-NOT transcription complex subunit 6 OS=Homo sapiens OX=9606 GN=CNOT6 PE=1 SV=2)

HSP 1 Score: 315.849 bits (808), Expect = 2.633e-94
Identity = 176/413 (42.62%), Postives = 241/413 (58.35%), Query Frame = 1
Query: 1342 TNDIFDSLKTCLIPQRFLNYY---------KIVA--PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---------DPKMNKRK--LCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGP-CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            T DI +  +     +R LNY          +I    PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP++AL+W+YRK+ I++EI    ADI+ LQE+ET QY + F VEL++R Y+G F PKSR+RTM E + K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++          P +   K  + V+  H+HWDPEYSDVKL+QT+ + SE+ N I    ++     LG    +P++LC D NSLP SGVV+YL  G VE +H DF+E         +S        N  + H F    AY    ESGL  +TNYT+DF+GIIDYIF+SK  L  LG L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  133 TQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYCPSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGTEKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSGVVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAY----ESGLMPYTNYTFDFKGIIDYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Match: sp|Q8VEG6|CNO6L_MOUSE (CCR4-NOT transcription complex subunit 6-like OS=Mus musculus OX=10090 GN=Cnot6l PE=1 SV=2)

HSP 1 Score: 313.923 bits (803), Expect = 1.246e-93
Identity = 165/371 (44.47%), Postives = 220/371 (59.30%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGM----SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVE 2490
            P R W I  K  D +    SFT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI  + ADII LQE+ET QY  +F   L+ R YDG F PKSR++ M E + K VDGCAIF+K E F  V   T EF    +  S   +  +LNRVM +DN+ ++++LEV               +K+ L V+  H+HWDPEYSDVKLIQT+ + SE+ N +         P   P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S           + H F    AY++   + + +TNYT+DF+G+IDYIF+SK H+ +LG L  +   W  +  I G PH H  SDHFSLL +
Sbjct:  170 PPRPW-ITLKERDQILPSASFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEIVNWDADIISLQEVETEQYFTLFLPALKDRGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDG-SEAMLNRVMTKDNIGVAVVLEVHKELFGTGMKPIHAADKQLLIVANAHMHWDPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEYLSNGGVADNHKDFKELRYNECLMNFSCSGKNGSSEGRITHGFQLKSAYEN---NLMPYTNYTFDFKGVIDYIFYSKTHMNVLGVLGPLDPQWLVENNITGCPHPHIPSDHFSLLTQ 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Match: A0A5K3EN64 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 4.017e-146
Identity = 220/397 (55.42%), Postives = 280/397 (70.53%), Query Frame = 1
Query: 1315 IAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPS-DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKM-NKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            I  P++  R  D   SLKTC +P    ++Y   +PP R W  +  PS +G   TLMCYNVL   YAT   YPYCP +A+DWEYR+RGILEE+  Y  +IICLQE++T Q+E VF  EL K NY+G+F+ KSRSRTM  + ++ VDGCAIFW  E F KV    +EFMLSC  VS++P+P LLNRVM RDNVA+ ++LE+K P   N R+ CVSTGHIHWDPE+SDVKLIQT+ W++ELW+++         P  G   MPV+LCGD NSLP SGVV++L KG V  SHV+F  FG  Y F +W  ++   V+ D+L+HRFNFDRAYK     G+K TN TYDF+G+IDYIFF++ H  LL +L QIPESWF +++I+G PH+H  SDHFSLLVEL+L
Sbjct:  292 IPPPLRIPRALDHCKSLKTCAVPFSEFSHYFNSSPPRRQWRQLGSPSKNGYRLTLMCYNVLSSNYATYSQYPYCPTWAIDWEYRRRGILEELRLYAPNIICLQEIDTDQFETVFVPELAKNNYEGIFLAKSRSRTMEPASARKVDGCAIFWLSEKFTKVTEFRYEFMLSCSNVSEHPSPLLLNRVMTRDNVAIGVVLEIKAPSPGNSRRFCVSTGHIHWDPEHSDVKLIQTIIWTAELWSHLDKLCGDSGKPGSGASRMPVVLCGDLNSLPTSGVVEFLSKGCVPTSHVEFLNFGFSYQFEDWKMLEKWAVDGDILRHRFNFDRAYKGGIADGMKITNLTYDFKGMIDYIFFTRHHFRLLRSLDQIPESWFMEERILGCPHIHVPSDHFSLLVELDL 688          
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Match: A0A183AF73 (Endo/exonuclease/phosphatase domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5608 PE=4 SV=1)

HSP 1 Score: 475.707 bits (1223), Expect = 1.357e-145
Identity = 223/423 (52.72%), Postives = 296/423 (69.98%), Query Frame = 1
Query: 1315 IAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPS-DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK----DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYI-------------------RDYYKSENMPHLGP----CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            + EPI+  R+ D++++L+TCL+P   L  Y   APP R W  +E+PS DG +FTLMCYN+LC  YAT +MYPYCP++AL+W+YR+R IL+EI  Y A+IICLQE+ET+Q+E +F  EL K  YD +F+PKSR RTM   D K VDGCAIFW+V+ FEK+H   HEFM SC  + +NP+P ++NRVM RDNVAL +I E K          R+ CV+TGHIHWDPE SDVK+IQT+ W++ELW YI                   R+   S  +P  GP     +MPVILCGD NSLP+SGVV++L++G + +SH DF   G KY+F +W  ++   V+ D L+HRF FDRAY++    G++ TN+TY+F+G+IDY+ FS++H  LLG+L QI ESWF ++KIVG PHVH  SDHF+LLVELEL
Sbjct:  593 VPEPIRVPRSQDVYNALRTCLVPHYELRDYATSAPPPRQWRRLEEPSKDGFAFTLMCYNLLCPSYATQNMYPYCPSWALNWDYRRRAILDEIRVYHANIICLQEVETNQFEEIFKPELAKLKYDAVFLPKSRCRTMDMKDGKKVDGCAIFWQVDKFEKLHEFHHEFMFSCSNMCENPSPLIVNRVMTRDNVALGVIFETKGAPGPDGPGGRQFCVTTGHIHWDPELSDVKMIQTILWTAELWAYIDQFLTGSGDVKDRGSPSNTRNTPLSNRVPVPGPSSPAANMPVILCGDLNSLPESGVVEFLMRGSLPKSHTDFLNNGFKYMFEDWRLLEKWAVDGDTLRHRFTFDRAYRESQ--GMQLTNFTYEFKGMIDYVLFSRQHFRLLGSLDQIHESWFIEKKIVGCPHVHIPSDHFALLVELEL 1013          
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Match: A0A068Y900 (CCR4 NOT transcription complex subunit 6 OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 4.850e-145
Identity = 217/397 (54.66%), Postives = 282/397 (71.03%), Query Frame = 1
Query: 1315 IAEPIQSSRTNDIFDSLKTCLIP-QRFLNYYKIVAPPNRNWHIIEKPS-DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            I  P+   R  D   SLKTC +P   F NY    APP+R W     PS +G   T+MCYNVL   YAT   YPYCP++A+DWEYR+RGILEE+ +Y+ +IICLQE++T Q+E VF  EL K NY+G+F+PKSRSRTM  + ++ VDGCAIFW  E F KV    HEFM+SC  V+ +P+P L+NRVM RDNVA+ ++LE+K+   N R+ CV+TGHIHWDPE+SDVKLIQ + W++ELW+ +  +      P LG   MPVILCGDFNSLP SGVV+YL  G V  +HV+F  FG  Y F +W  ++    E ++L+HRFNFDRAY+     G++ TN TYDF+G+IDYIFFS+ H  LLG+L QIP+SWF +++++G PH+H  SDHFSLLVEL+L
Sbjct:  435 IPAPLHLPRAQDHCGSLKTCAVPFSEFPNYIG-SAPPHRQWRQFGTPSRNGYRLTVMCYNVLSANYATHSQYPYCPSWAIDWEYRRRGILEELRQYEPNIICLQEIDTDQFETVFVPELAKNNYEGVFLPKSRSRTMEPALARKVDGCAIFWLSEKFTKVAEFHHEFMISCSSVADHPSPLLINRVMTRDNVAIGVVLEIKNSGTNGRRFCVTTGHIHWDPEHSDVKLIQAILWTAELWSRLERFNGDCGKPGLGASRMPVILCGDFNSLPDSGVVEYLSTGSVPTTHVEFLNFGFNYHFEDWKLLEKWAYEGNILRHRFNFDRAYRGNANDGMRVTNLTYDFKGMIDYIFFSRNHFRLLGSLDQIPDSWFVEERVLGCPHIHVPSDHFSLLVELDL 830          
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Match: A0A068WF28 (CCR4 NOT transcription complex subunit 6 OS=Echinococcus granulosus OX=6210 GN=EgrG_000611400 PE=4 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 2.463e-144
Identity = 217/397 (54.66%), Postives = 282/397 (71.03%), Query Frame = 1
Query: 1315 IAEPIQSSRTNDIFDSLKTCLIP-QRFLNYYKIVAPPNRNWHIIEKPS-DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            I  P+   R  D   SLKTC +P   F NY    APP+R W     PS +G   T+MCYNVL   YAT   YPYCP++A+DWEYR+RGILEE+ +Y+ +IICLQE++T Q+E VF  EL K NY+G+F+PKSRSRTM  + ++ VDGCAIFW  E F KV    HEFM+SC  V+ +P+P L+NRVM RDNVA+ ++LE+K+   N R+ CV+TGHIHWDPE+SDVKLIQ + W++ELW+ +  +      P LG   MPVILCGDFNSLP SGVV+YL  G V  +HV+F  FG  Y F +W  ++    E ++L+HRFNFDRAY+     G++ TN TYDF+G+IDYIFFS+ H  LLG+L QIP+SWF +++++G PH+H  SDHFSLLVEL+L
Sbjct:  435 IPAPLHLPRAQDHCRSLKTCAMPFSEFPNYIG-SAPPHRQWRQFGTPSRNGYRLTVMCYNVLSANYATHSQYPYCPSWAIDWEYRRRGILEELRQYEPNIICLQEIDTDQFETVFVPELAKNNYEGVFLPKSRSRTMEPALARKVDGCAIFWLSEKFTKVAEFHHEFMISCSSVADHPSPLLINRVMTRDNVAIGVVLEIKNSGTNGRRFCVTTGHIHWDPEHSDVKLIQAILWTAELWSRLERFNGDCEKPGLGASRMPVILCGDFNSLPDSGVVEYLSTGSVPTTHVEFLNFGFNYHFEDWKLLEKWAYEGNILRHRFNFDRAYRGNANDGMRVTNLTYDFKGMIDYIFFSRNHFRLLGSLDQIPDSWFVEERVLGCPHIHVPSDHFSLLVELDL 830          
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Match: A0A4E0RF53 (CCR4-NOT transcription complex subunit OS=Fasciola hepatica OX=6192 GN=D915_001748 PE=4 SV=1)

HSP 1 Score: 476.863 bits (1226), Expect = 1.201e-142
Identity = 221/424 (52.12%), Postives = 294/424 (69.34%), Query Frame = 1
Query: 1315 IAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPS-DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK----DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYI-------------------RDYYKSENMPHLGP----CDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELR 2502
            + EPI+  R++D++++L+TCL+P   L  Y   APP R W  +E+P  DG +FTLMCYN+LC  YAT +MYPYCP++AL+W+YR+R IL+EI  Y A+IICLQE+ET+Q+E +F  EL K  YD +F+PKSR RTM   D K VDGCAIFW+++ FEK+H   HEFM SC  + +NP P ++NRVM RDNVAL +I E K          R+ CV+TGHIHWDPE SDVK+IQT+ W++ELW YI                   R    S  +P  GP      MPVILCGD NSLP+SGVV++L++G + +SH DF   G KY+F +W  ++   V+ D L+HRF FDRAY++    G++ TN+TY+F+G+IDY+ FS++H  LLG+L QI ESWF ++KIVG PHVH  SDHF+LLVELEL+
Sbjct:  982 VPEPIRVPRSHDVYNALRTCLVPHSELRDYATSAPPPRQWRRLEEPKKDGFAFTLMCYNLLCPSYATQNMYPYCPSWALNWDYRRRAILDEIRIYHANIICLQEVETNQFEEIFKPELEKLKYDAVFLPKSRCRTMDMKDCKKVDGCAIFWQIDKFEKLHEFQHEFMFSCTNMCENPPPLIVNRVMTRDNVALGVIFETKGAPGPDGPGGRQFCVTTGHIHWDPELSDVKMIQTILWTAELWAYIDQFLTGSGDLKDRESPTNTRKTPLSNRIPVPGPSSPAASMPVILCGDLNSLPESGVVEFLMRGSLPKSHTDFLNNGFKYMFEDWRLLEKWAVDGDTLRHRFTFDRAYRESQ--GMQLTNFTYEFKGMIDYVLFSRQHFRLLGSLDQIQESWFAEKKIVGCPHVHIPSDHFALLVELELK 1403          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Match: cnot6a (CCR4-NOT transcription complex subunit 6 [Source:NCBI gene;Acc:103025554])

HSP 1 Score: 313.923 bits (803), Expect = 1.449e-94
Identity = 166/378 (43.92%), Postives = 232/378 (61.38%), Query Frame = 1
Query: 1417 PPNRNWHIIEKPS---DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            PP R+W  +++P        F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    ADII LQE+ET QY N F VEL++  Y+G F PKSR+RTM ESD K VDGCAIF+K + F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++              M K+ + V+  H+HWDPEYSDVKL+QT+ + SE+ N +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E         ++        +  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+S+  L +LG L  +   W  +  I G PH H  SDHFSL  +LEL
Sbjct:  168 PPPRSWVPLQEPDRTRPSALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIMQEILNCSADIISLQEVETEQYYNFFLVELKEHGYEGFFSPKSRARTMSESDRKHVDGCAIFYKTDKFSLVQKHTVEFNQLAMANSEG-SEVMLNRVMTKDNIGVAVLLELRKEIMEQSAGKPLHGMEKQLVLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDSTHKDFKELRYIDCLTNFNCNGKNGTSSTRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSQPLLNVLGVLGPLDPHWLHENNITGCPHPHIPSDHFSLFAQLEL 540          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Match: cnot6b (CCR4-NOT transcription complex subunit 6 [Source:NCBI gene;Acc:103047334])

HSP 1 Score: 312.383 bits (799), Expect = 4.564e-94
Identity = 166/378 (43.92%), Postives = 229/378 (60.58%), Query Frame = 1
Query: 1417 PPNRNWHIIEKP---SDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESG-LKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            PP R+W ++++P        F++MCYNVLC KYAT  +Y YCP +AL+WEYRK+ I++EI    ADII LQE+ET QY   F VEL+ + YDG F PKSR+RTM ESD K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LE++              M K+ L V+  H+HWDPEYSDVKL+QT+ + SE+ N +    +S  +  + G  + +P++LC D NSLP SGVV++L  G V+ +H DF+E         ++        N  + H F    AY    E+G + +TNYT+DF+GIIDYIF S+  L +LG L  +   W  +  I G PH    SDHFSL  +LEL
Sbjct:  169 PPPRSWIVLQEPDRTGPAALFSVMCYNVLCDKYATRQLYGYCPPWALNWEYRKKSIMQEILSCNADIISLQEVETEQYYKFFLVELKGQGYDGFFSPKSRARTMSESDRKHVDGCAIFYKTEKFTVVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLELRREMMEITSGKSLHGMEKQLLLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKASRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEFLSSGGVDCTHKDFKELLYSDSLTNFNCNGKNGSSNSRITHGFKLKSAY----ENGIMPYTNYTFDFKGIIDYIFHSEPQLNVLGVLGPLDPDWLLENSITGCPHPSIPSDHFSLFAQLEL 541          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Match: cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:NCBI gene;Acc:553665])

HSP 1 Score: 307.76 bits (787), Expect = 2.812e-92
Identity = 164/372 (44.09%), Postives = 218/372 (58.60%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK--------DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKS--ENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELE 2496
            P R W  +++    M    FT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI    ADII LQE+ET QY   F   L++R YDG F PKSR++ + E + K VDGCA+F+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEVK             K+ L V+  H+HWDPEYSDVKLIQT+ + SEL +       S            +P++LC D NSLP SGVV+YL  G V  +H DF+E         +S        +  + H F    AY+    + + +TNYTYDF+G+IDYIFFSK H+ +LG L  +   W     I G PH H  SDHFSLL +LE
Sbjct:  165 PQRPWITLKERDQTMPTAVFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEITHCDADIISLQEVETEQYYTFFLETLKERGYDGFFCPKSRAKLVSEQERKHVDGCAVFFKTEKFALVQKHTVEFNQVAMANSEG-SEVMLNRVMTKDNIGVAVLLEVKKEMFAGGIKSPTEKQLLLVANAHMHWDPEYSDVKLIQTMMFLSELKSITERALASLDSTTSTSDSDSIPIVLCADLNSLPDSGVVEYLSNGGVAENHKDFKELRYSECLTNFSCNGKNGKPDGSITHSFQLKSAYES---NLMPYTNYTYDFKGVIDYIFFSKTHMSVLGLLGPLETQWLVDNSITGCPHPHIPSDHFSLLTQLE 532          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Match: cnot6a (CCR4-NOT transcription complex subunit 6 [Source:NCBI gene;Acc:103025554])

HSP 1 Score: 301.982 bits (772), Expect = 2.943e-90
Identity = 167/395 (42.28%), Postives = 234/395 (59.24%), Query Frame = 1
Query: 1384 QRFLNYY------KIVAPPNRNWHIIEKPS---DGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            +R LNY           PP R+W  +++P        F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    ADII LQE+ET QY N F VEL++  Y+G F PKSR+RTM ESD K VDG  IF   +  +K  H T EF    +  S+  +  +LNRVM +DN+ ++++LE++              M K+ + V+  H+HWDPEYSDVKL+QT+ + SE+ N +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E         ++        +  + H F    AY    E+GL  +TNYT+DF+GIIDYIF+S+  L +LG L  +   W  +  I G PH H  SDHFSL  +LEL
Sbjct:  147 RRLLNYLLDNLAVSTEQPPPRSWVPLQEPDRTRPSALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIMQEILNCSADIISLQEVETEQYYNFFLVELKEHGYEGFFSPKSRARTMSESDRKHVDGSIIFSLFQLNQKSKH-TVEFNQLAMANSEG-SEVMLNRVMTKDNIGVAVLLELRKEIMEQSAGKPLHGMEKQLVLVANAHMHWDPEYSDVKLVQTMMFLSEVKNIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDSTHKDFKELRYIDCLTNFNCNGKNGTSSTRITHGFKLKSAY----ENGLMPYTNYTFDFKGIIDYIFYSQPLLNVLGVLGPLDPHWLHENNITGCPHPHIPSDHFSLFAQLEL 535          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Match: pde12 (phosphodiesterase 12 [Source:NCBI gene;Acc:103036143])

HSP 1 Score: 119.398 bits (298), Expect = 2.786e-27
Identity = 104/376 (27.66%), Postives = 165/376 (43.88%), Query Frame = 1
Query: 1429 NWHI-IEKPSDGMSFTLMCYNVLCQKYATTHM-----YPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLS------------CIGVSKNPAPELLNRVMNRD-NVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIP-ESWFEQQKIVGAPHVHFNSDHFSLLVELE 2496
            N H+   K +D  +  ++ YN+L   YA T +     YPYC  +AL  +YR+  I +E+  Y ADI+CLQE++   + +     L     DG+F  K +    HE       G A F++   F  +    H+ MLS               VS NP   L+ +V+ R   + ++++  V DP    + + V   H++W P+ S+V+LIQ       L     ++  +            +I CGDFNS P SG+   L +G V  +H D+   G            +E ++ ++L   F  + A  +       +TNY   F G +DYIF     L +    + IP  S  E       P V   SDH +L+ +L+
Sbjct:  268 NRHMYTRKVTDATTVRVVSYNILADIYAQTELSKTVLYPYCAPYALGLDYRQSLIKKELSGYNADIVCLQEVDKGVFSDSLCPALDAFGMDGVFRVKEK---QHE-------GLATFYRRSKFRLLGQ--HDVMLSEALTTDAVHSALLEKVSTNPT--LMEKVVQRSTTLQVTVLQSVGDP---SKIVYVGNTHLYWHPKGSNVRLIQVAVALQHLKRVTEEHPGT------------LIFCGDFNSTPSSGLFQLLSQGSVPENHSDWESNGP-----------EELIQMELLS-PFQLNSACGEP-----AYTNYVGGFHGCLDYIFMEPRALQV---EQVIPLPSHQEVTTYQALPSVAHPSDHIALVCDLK 594          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Match: cnot6l (CCR4-NOT transcription complex, subunit 6-like [Source:NCBI gene;Acc:553665])

HSP 1 Score: 291.967 bits (746), Expect = 3.171e-87
Identity = 164/380 (43.16%), Postives = 221/380 (58.16%), Query Frame = 1
Query: 1417 PPNRNWHIIEKP----SDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMN-----------KRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKS-------ENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFG-DKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESG-LKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFS 2478
            PP R W  +  P           +MCYNVLC KYAT  +Y YCP +AL WEYRK+GI++EI +Y ADII LQE+ET QY N F  EL+ + Y G+F  KSR+RTM E + K VDGCA+F+K + F  +     EF    +  S+  +  +LNRVM +DN+ ++++LEVKD               K+ L V+  HIHWDPE+SDVKLIQT+ + SEL +   +  ++          P   G C  +P++LC D NSLP SGVV+YL  G V  +H D +E   +K L N   +   +   N  + H F    AY    E+G + +TNYTYDF+G+IDYIF+SK HL LLG L  +   W ++  + G PH    SDHFS
Sbjct:  171 PPPRPWIQLANPDRVRPPARLTKVMCYNVLCDKYATRQLYGYCPTWALAWEYRKKGIMQEIMQYSADIISLQEVETDQYWNFFLPELKLQGYSGIFSSKSRARTMSEQERKFVDGCAVFFKSDKFTLMKEHLVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLEVKDVNFQGSCELHVCNDIKQTLLVANAHIHWDPEFSDVKLIQTMMFLSELRSIAEEASRALAKSSGGGGGPSTKGDCSTIPLLLCADLNSLPDSGVVEYLSSGGVPENHKDLKELAYNKCLMN--FSCNGKGSPNGFITHSFKMRSAY----ENGIMPYTNYTYDFKGVIDYIFYSKLHLNLLGVLGPLDTHWLDENNVTGCPHPSIPSDHFS 543          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Match: angel2 (angel homolog 2 (Drosophila) [Source:NCBI gene;Acc:562704])

HSP 1 Score: 84.7297 bits (208), Expect = 2.471e-17
Identity = 69/239 (28.87%), Postives = 113/239 (47.28%), Query Frame = 1
Query: 1462 MSFTLMCYNVLCQKYA--TTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFE-KVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIIL-----EVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKG 2154
            M+F++M YN+L Q       ++Y +C    L+W YR   +++EI ++ AD++CLQE++   Y +     L K  Y   +        M   D    DGCAI +K   F  +  H    +     GVS          +M+RDNV    +L     EV  P +    +C++  H+ ++P+  D+KL Q     +E+ + + D  +           +PV+LCGDFNS+P S +  +L  G
Sbjct:   20 MAFSVMTYNILSQTLLEDNAYLYRHCNRSVLEWAYRFPNLIQEIERFNADVLCLQEVQKDHYIDQLKPHLIKLGYSCHY-------KMRTGDKN--DGCAICFKRSRFSLRSWHAVEYYR---PGVS----------LMDRDNVGTIAVLQPLPQEVVHP-LTPYSVCIANTHLLFNPKRGDIKLAQLALLLAEI-DKVSDGGR-----------LPVLLCGDFNSVPGSPLYHFLRHG 223          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Match: angel2 (angel homolog 2 (Drosophila) [Source:NCBI gene;Acc:562704])

HSP 1 Score: 82.4185 bits (202), Expect = 1.026e-16
Identity = 69/239 (28.87%), Postives = 112/239 (46.86%), Query Frame = 1
Query: 1462 MSFTLMCYNVLCQKYA--TTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFE-KVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIIL-----EVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKG 2154
            M+F++M YN+L Q       ++Y +C    L+W YR   +++EI ++ AD++CLQE++   Y +     L K  Y   +        M   D    DGCAI +K   F  +  H    +     GVS          +M+RDNV    +L     EV  P      +C++  H+ ++P+  D+KL Q     +E+ + + D  +           +PV+LCGDFNS+P S +  +L  G
Sbjct:   19 MAFSVMTYNILSQTLLEDNAYLYRHCNRSVLEWAYRFPNLIQEIERFNADVLCLQEVQKDHYIDQLKPHLIKLGYSCHY-------KMRTGDKN--DGCAICFKRSRFSLRSWHAVEYYR---PGVS----------LMDRDNVGTIAVLQPLPQEVVHPLTP--YVCIANTHLLFNPKRGDIKLAQLALLLAEI-DKVSDGGR-----------LPVLLCGDFNSVPGSPLYHFLRHG 221          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Match: angel2 (angel homolog 2 (Drosophila) [Source:NCBI gene;Acc:562704])

HSP 1 Score: 81.2629 bits (199), Expect = 2.242e-16
Identity = 69/239 (28.87%), Postives = 112/239 (46.86%), Query Frame = 1
Query: 1462 MSFTLMCYNVLCQKYA--TTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFE-KVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIIL-----EVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKG 2154
            M+F++M YN+L Q       ++Y +C    L+W YR   +++EI ++ AD++CLQE++   Y +     L K  Y   +        M   D    DGCAI +K   F  +  H    +     GVS          +M+RDNV    +L     EV  P      +C++  H+ ++P+  D+KL Q     +E+ + + D  +           +PV+LCGDFNS+P S +  +L  G
Sbjct:    3 MAFSVMTYNILSQTLLEDNAYLYRHCNRSVLEWAYRFPNLIQEIERFNADVLCLQEVQKDHYIDQLKPHLIKLGYSCHY-------KMRTGDKN--DGCAICFKRSRFSLRSWHAVEYYR---PGVS----------LMDRDNVGTIAVLQPLPQEVVHPLTP--YVCIANTHLLFNPKRGDIKLAQLALLLAEI-DKVSDGGR-----------LPVLLCGDFNSVPGSPLYHFLRHG 205          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Match: nocta (nocturnin a [Source:ZFIN;Acc:ZDB-GENE-050208-306])

HSP 1 Score: 79.7221 bits (195), Expect = 6.064e-16
Identity = 69/233 (29.61%), Postives = 102/233 (43.78%), Query Frame = 1
Query: 1465 SFTLMCYNVLCQKYATTH-MYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLC-VSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPC--------DMPVILCGDFNSLPQSGV 2133
            SF +M +NVL Q        +  C    L W  R   IL+EI  Y+ D+ICLQE++  +Y + FS  L +  Y G FVPK  S  +    +   DGCAIF++ E FE +           IG+   P P   ++V+        ++L          KLC V TGH         + +  T   + + W  +R    +    HL  C        + P+++CGDFN+ P   V
Sbjct:   79 SFRIMQWNVLAQALGEGKDNFVCCRPADLTWAARWPLILDEIVSYQPDLICLQEVD--RYHDAFSPALNQLGYGGAFVPKRHSPCLDVQPNYGPDGCAIFYRKERFELLGGYA-------IGLRAEPIPYPTHQVL--------LVL----------KLCYVDTGH--------SLTVACTHLKARQGWERLR----AAQAKHLLTCLNSDQEAREGPLVVCGDFNAKPAETV 272          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Yeast
Match: CCR4 (Component of the CCR4-NOT transcriptional complex; CCR4-NOT is involved in regulation of gene expression; component of the major cytoplasmic deadenylase, which is involved in mRNA poly(A) tail shortening [Source:SGD;Acc:S000000019])

HSP 1 Score: 189.504 bits (480), Expect = 6.080e-50
Identity = 123/356 (34.55%), Postives = 182/356 (51.12%), Query Frame = 1
Query: 1465 SFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSK-NPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQ---------TLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVE-RSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            +FT++ YN LCQ YAT  MY Y P++AL W+YR+  + E+I  Y +D++CLQE+E+  +E  +   L K  Y G+F  K+R++TMH  DSK VDGC IF+K + F+ +     +F  + +   K     + LNR MN+DNVAL + L+      +   +   T H+HWDP+++DVK  Q         TL       N+ +D  K            PV++CGDFNS   S V + +  G V+     + R+FG  Y+       +  F  N  LK  +N            L +TN+T  F  +IDYI+FS   L + G L ++   +    K +G P+  F SDH  LL   E 
Sbjct:  504 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHIP---SGDTIWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLKEETSHNFRQDIKK-----------FPVLICGDFNSYINSAVYELINTGRVQIHQEGNGRDFG--YM------SEKNFSHNLALKSSYNC--------IGELPFTNFTPSFTDVIDYIWFSTHALRVRGLLGEVDPEYVS--KFIGFPNDKFPSDHIPLLARFEF 827          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Yeast
Match: NGL1 (Putative endonuclease; has a domain similar to a magnesium-dependent endonuclease motif in mRNA deadenylase Ccr4p; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000005402])

HSP 1 Score: 77.0258 bits (188), Expect = 2.806e-15
Identity = 92/366 (25.14%), Postives = 161/366 (43.99%), Query Frame = 1
Query: 1468 FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIW-KYKADIICLQELETSQYENVFSVELR-KRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGV-SKNPAPELLNRVMNRDNVALSIILE--VKDPKMNKRKLCV-------STG--------HIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLK--QIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            FTL+ YN+L   Y    +Y Y      +W YR R + +E+   +KADI+CLQE+    YE+ +   +    NY   F+ K+  +   +   K +DG +IF+ +  F+ +   +  ++   + V ++     L N+ +   + A ++I E  + D    K ++C+        TG        H++W  +Y +VKL Q +    EL   I+     +     G   + ++  GD NS   S VV++L +G++  SH      GD  L N      D  V +D+ K  F                T Y+   +GI DY+++      L   L   ++ +      ++ G P+ +  SDH  LL E ++
Sbjct:   27 FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKP-VKDMDGVSIFYNLAKFDFISS-SGIYLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLNTHLYW--KYDEVKLTQCMIIMRELSKIIKQLLPGDVK---GQERVKILFTGDLNSTRDSLVVNFL-QGQIV-SH------GDLNLINPMRPYLDRCVYDDIPKDYFVH--------------TCYSGKLKGIFDYVWYHDSDFLLTKILTGNEVSDELLASNQL-GLPNENHPSDHIPLLTEFKI 362          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Yeast
Match: NGL2 (Protein involved in 5.8S rRNA processing; Ccr4p-like RNase required for correct 3'-end formation of 5.8S rRNA at site E; similar to Ngl1p; NGL2 has a paralog, NGL3, that arose from the whole genome duplication [Source:SGD;Acc:S000004898])

HSP 1 Score: 69.707 bits (169), Expect = 1.373e-12
Identity = 63/238 (26.47%), Postives = 102/238 (42.86%), Query Frame = 1
Query: 1447 KPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP------KMNKRK--LCVSTGHIHWDP--EYSDVKLIQTLFWSSELWNYIRDYYKSEN---MPHLGPCDMPVILCGDFNSLP 2121
            +P  G  F LM YN L Q      ++P     AL W  R + +L E   Y +D+ICLQE++  Q+++ +  E  K  YDG +    R+ T +        G AI W+ E F +V  +        I   K  +  +  R    +NV L + L+  +       K + +K  + + T H+ W P   Y   +    +    + + +  +  ++EN   + H  P       CGDFNS P
Sbjct:  105 EPVTGFRFKLMTYNCLAQALIRRKLFPDS-GDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYY---RNATKNH-------GVAIMWRRELFHQVDKM-------LIDYDKESSESISTRTTT-NNVGLVLALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFP-----FFCGDFNSQP 318          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Yeast
Match: NGL3 (3'-5' exonuclease specific for poly-A RNAs; has a domain similar to a magnesium-dependent endonuclease motif in mRNA deadenylase Ccr4p; similar to Ngl1p; NGL3 has a paralog, NGL2, that arose from the whole genome duplication [Source:SGD;Acc:S000004587])

HSP 1 Score: 49.6766 bits (117), Expect = 2.304e-6
Identity = 56/244 (22.95%), Postives = 101/244 (41.39%), Query Frame = 1
Query: 1441 IEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKD-PKMNKRKLCVSTGHIHWDP---------EYSDVKLIQTL-------FWSSELWNYIRDY-YKSENMPHLGPCDMPVILCGDFNSL 2118
            I+   D +   +M YN L Q       +P     AL W  R + ++ E+ KY+ D++ LQE++ ++  N +     K  +D +F         HE  +    G  + W  + F+    + +++ML    +    A  +++      N+AL I L  K     + R + V+  H+ W P          Y  ++ IQ +        W S L   + D+  + E  P+L     P+IL G   ++
Sbjct:  100 IQVTQDSLDVKIMTYNTLAQTLIRRDFFPES-GPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIF-------KRHEGKTH---GLLVAWNNKKFQ----LDNDWMLDYDNIL---AGNVISARTRTKNIALIISLYFKGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEIKACSKYNGWHSLL---MGDFNTEPEEPPYLAITKRPLILKGPIRAM 321          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Match: EDO30336 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T131])

HSP 1 Score: 296.975 bits (759), Expect = 6.595e-89
Identity = 155/377 (41.11%), Postives = 227/377 (60.21%), Query Frame = 1
Query: 1414 APPNRNW--HIIEKPSDGMS--FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKM----NKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCD------MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDV-LKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            APP R W   + E+P    S  F++MC+NVLC KY T+  Y YCP +AL+W+YRK  I++EI  Y ADI+ LQE+ET Q+ N F  +L++  Y+G+F PKSR+RTM E D K VDGCAIF++   F  V     EF    +  ++  + ++LNRVM +DN+ ++++LE+KD         +++ VS  HIHWDPE+ DVKLIQT+    EL   ++ Y    + PH G         +P++LCGD NSLP SGV+++L  G +   H DF+E   +   +  S    +  +    L H     +AY  +H+  L ++N TY+F+G+IDY+++S + L  LG L  I   +  + KI+G PH HF SDH +LLVE E+
Sbjct:  162 APPERQWIQLVPERPRHRSSGNFSVMCFNVLCDKYCTSQQYGYCPTWALNWDYRKTAIMKEILHYGADIVSLQEVETEQFHNFFLPQLKQDGYNGIFSPKSRARTMSEDDRKHVDGCAIFYRTTKFTMVKEFLTEFNQLAMANAQG-SDDMLNRVMTKDNIGIAVLLELKDTGYIGYNGGQQVLVSNAHIHWDPEFRDVKLIQTVLLMHELQMILKQYIPGFH-PHGGKNGTTPSKSIPIVLCGDLNSLPNSGVIEFLDNGRIPIDHCDFQEMQYQGFLSRLSNGSSKNGDTSGELTHGLRLKKAYDGDHQ--LPFSNLTYEFKGVIDYVYYSYDTLSPLGVLGSINPDYISENKIIGWPHPHFPSDHQALLVEFEV 534          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Match: EDO45845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK8])

HSP 1 Score: 127.487 bits (319), Expect = 1.868e-30
Identity = 100/373 (26.81%), Postives = 170/373 (45.58%), Query Frame = 1
Query: 1423 NRNWHIIEKPSDGMSFTLMCYNVLCQKYATTH-----MYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHH---VTHEFMLSCIGVSK-----NPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELR 2502
            NR+ + ++K   G     + YN+L   YA        +YPYCP +ALD  YRK+ +++E+  Y ADIICLQE     ++      +    Y G+   K+          +  +G AIF+  + FE +     V  E +LS +   +     +P P L   ++ R+ +A   +L+ K    N   +CV   H+++ P    ++++Q    ++ + N+ +              D+ V+ CGDFNS P +G+   L KG V R+H D+    D           D+      L H F+F  A          +TNYT+ F+  +DYIF   +    + ++  +PE   E +  +  P V   SDH +L+ +L+ +
Sbjct:  221 NRHLYTLKKLEPG-HIRCVSYNILADAYAREEFALNVLYPYCPPYALDIGYRKQVLMKELIGYNADIICLQECGQKLFDGFLLPCMELEGYQGIIKCKA---------GEIPEGEAIFFNRDKFELIKTCDVVLRESLLSHLSQEEILQHISPIPALFESLIKRNAIAQVAVLKCKGNNDNSPLICVVNTHLYYRPHSPHIRMLQ----AAIILNHTKAVVHELTSERDDNIDVAVLFCGDFNSTPHTGLFQLLTKGHVARTHHDWLVHED----------VDQHCNTLDLSHGFSFVNACGTP-----LFTNYTHGFKDTLDYIFCDSKFFE-VQSVVPLPEEE-ELRNHLALPSVVMPSDHLALVCDLKCK 562          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Match: EDO40210 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S800])

HSP 1 Score: 110.538 bits (275), Expect = 2.195e-27
Identity = 79/231 (34.20%), Postives = 115/231 (49.78%), Query Frame = 1
Query: 1477 MCYNVLCQKYATTH--MYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVK---DPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKG 2154
            M YNVL       H  +Y  C    LDWEYRK+ +L+EI    ADI+CLQE+E+  ++N F  EL K  Y G +    + RT  +S     DGCA F+K   F   HH+  + +  C         ++L  VM+RDNVAL ++L  +       N   LCV+  H+ ++ +  D+KL+Q     +E+         SE    +  C   VILCGDFN  P   +   +++G
Sbjct:    1 MSYNVLADGLMQAHPGLYEECEERCLDWEYRKKNLLKEILHCNADILCLQEVESEHFDNWFFPELCKAGYKGFY----KKRTGKKS-----DGCATFYKKSRF---HHLLTQEVEFC-------RKDIL--VMDRDNVALIVVLRPRYENGKTCNHTALCVANTHLLFNKKRGDIKLLQLSSLFAEIQQVTSKVCSSEGSRGIKQCG--VILCGDFNMTPWCPLYSLVVQG 208          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Match: EDO30198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G7])

HSP 1 Score: 82.8037 bits (203), Expect = 6.663e-17
Identity = 41/91 (45.05%), Postives = 57/91 (62.64%), Query Frame = 1
Query: 1414 APPNRNW--HIIEKPSDGMS--FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKR 1674
            APP R W   + E+P    S  F++MC+NVLC KY T+  Y YCP +AL+W+YRK  I++EI  Y ADI+ LQ+  ++  +  F   LR R
Sbjct:  228 APPERQWIQLVPERPRHRSSGNFSVMCFNVLCDKYCTSQQYGYCPTWALNWDYRKTAIMKEILHYGADIVSLQDYYSAFRKAAFDKWLRSR 318          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Match: EDO34680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM0])

HSP 1 Score: 80.1073 bits (196), Expect = 5.181e-16
Identity = 63/251 (25.10%), Postives = 111/251 (44.22%), Query Frame = 1
Query: 1417 PP--NRNWHIIEKPSDGMSFTLMCYNVLCQKYAT---THMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKG 2154
            PP   R +  +     G  F +M +NVL    +    T  +  CP+ AL W  RK+ +++ I  Y+ DIICL+E++   + + F   L +  Y G+FVPK  S  +    +   DG AIF+  + F+     + +         KN    L N+         ++ + + D  +NK+ L     H+   P + D++  Q       +  +++D+ ++E           V++CGDFN+ P   V   +  G
Sbjct:   25 PPLTERTFETVHYACKGSPFRVMQWNVLADGLSGSSPTSNFIKCPSEALSWSTRKQRLIQGILTYEPDIICLEEVD--HFYDFFKPSLDEVGYTGIFVPKEDSPCLKFPGNSGPDGTAIFFDKQRFKLRKQQSKQL--------KNSDGTLTNQT--------ALFVHLFD-NLNKKSLYCCGTHLKAKPAFQDLRSAQ----GKSVLAFLKDFMENEQ--------AEVLVCGDFNAEPTEPVYQVMEDG 244          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Match: cnot6b (CCR4-NOT transcription complex subunit 6 [Source:NCBI gene;Acc:101160421])

HSP 1 Score: 321.242 bits (822), Expect = 3.079e-97
Identity = 168/378 (44.44%), Postives = 234/378 (61.90%), Query Frame = 1
Query: 1417 PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            PP R+W  +++P    S   F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    +DII LQE+ET QY N F  EL+ + YDG F PKSR+RTM ESD K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEV+              M K+ L V+  H+HWDP+YSDVKL+QT+ + SE+ + +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E        +++        N  + H F    AY    E+GL  +TNYT+DF+G+IDYIF+SK HL +LG L  +   W  +  + G PH H  SDHFSL  +LEL
Sbjct:  169 PPARSWISLQEPERTRSSALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIIQEIMGCNSDIISLQEVETEQYYNFFLPELKDQGYDGFFSPKSRARTMSESDRKHVDGCAIFYKTEKFSAVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLEVRKEMMELSSGKSLHGMEKQLLLVANAHMHWDPDYSDVKLVQTMMFLSEVKSIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDCTHKDFKELRYSDCLTKFNCNGKNSTSNGRITHGFKLKSAY----ENGLMPYTNYTFDFKGVIDYIFYSKPHLNVLGILGPLDPHWLVENNVTGCPHPHIPSDHFSLFAQLEL 541          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Match: cnot6l (CCR4-NOT transcription complex subunit 6 like [Source:NCBI gene;Acc:101166103])

HSP 1 Score: 310.457 bits (794), Expect = 1.791e-93
Identity = 167/373 (44.77%), Postives = 223/373 (59.79%), Query Frame = 1
Query: 1420 PNRNWHIIEKPSDGMS----FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEV---------KDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELEL 2499
            P R W +  K  D +S    FT+MCYNVLC KYAT  +Y YCP++AL+WEYRK+GI+EEI  + ADII LQE+ET QY   F   L+ R YDG F PKSR++ + E + K VDGCA+F+K + F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEV         K P+  K+ L V+  H+HWDPEYSDVKLIQT+ + SEL +       S       P  +P++LC D NSLP SGVV+YL  G V  +H DF+E         ++        +  + H F    AY     S + +TNYTYDF+G+IDYIFFS+ H+ +LG L  +   W     I+G PH H  SDHFSLL +LEL
Sbjct:  165 PQRPW-VTVKEQDHLSPSAVFTVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKGIMEEITNWDADIISLQEVETEQYYTFFLESLKGRGYDGYFCPKSRAKLVSEQERKHVDGCAVFFKTQKFTLVQKHTVEFNQVAMANSEG-SEVMLNRVMTKDNIGVAVLLEVNRDLFSGGLKSPQ-EKQLLLVANAHMHWDPEYSDVKLIQTMMFLSELKSIAERACSSLTS---DPSAIPIVLCADLNSLPDSGVVEYLSNGGVAENHKDFKELRYNECLTNFNCNGKNGNSDGSITHSFQLKSAYD---SSLMPYTNYTYDFKGVIDYIFFSRTHMSVLGLLGPLDNHWLMDNNIIGCPHPHIPSDHFSLLAQLEL 528          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Match: cnot6b (CCR4-NOT transcription complex subunit 6 [Source:NCBI gene;Acc:101160421])

HSP 1 Score: 263.848 bits (673), Expect = 6.187e-77
Identity = 141/325 (43.38%), Postives = 200/325 (61.54%), Query Frame = 1
Query: 1417 PPNRNWHIIEKPSDGMS---FTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDP-----------KMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL-GPCD-MPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGL-KWTNYTYDFR 2340
            PP R+W  +++P    S   F++MCYNVLC KYAT  +Y YCP++AL+WEYRK+ I++EI    +DII LQE+ET QY N F  EL+ + YDG F PKSR+RTM ESD K VDGCAIF+K E F  V   T EF    +  S+  +  +LNRVM +DN+ ++++LEV+              M K+ L V+  H+HWDP+YSDVKL+QT+ + SE+ + +    +S  +  + G  + +P++LC D NSLP SGVV+YL  G V+ +H DF+E        +++        N  + H F    AY    E+GL  +TNYT+DF+
Sbjct:  169 PPARSWISLQEPERTRSSALFSVMCYNVLCDKYATRQLYGYCPSWALNWEYRKKSIIQEIMGCNSDIISLQEVETEQYYNFFLPELKDQGYDGFFSPKSRARTMSESDRKHVDGCAIFYKTEKFSAVQKHTVEFNQLAMANSEG-SEAMLNRVMTKDNIGVAVLLEVRKEMMELSSGKSLHGMEKQLLLVANAHMHWDPDYSDVKLVQTMMFLSEVKSIVDKATRSLKLSSVSGETNAIPLVLCADLNSLPDSGVVEYLSTGGVDCTHKDFKELRYSDCLTKFNCNGKNSTSNGRITHGFKLKSAY----ENGLMPYTNYTFDFK 488          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Match: pde12 (phosphodiesterase 12 [Source:NCBI gene;Acc:101162595])

HSP 1 Score: 114.39 bits (285), Expect = 8.656e-26
Identity = 101/356 (28.37%), Postives = 158/356 (44.38%), Query Frame = 1
Query: 1474 LMCYNVLCQKYATTHM-----YPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVAL-------SIILEV---KDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIP-ESWFEQQKIVGAPHVHFNSDHFSLLVEL 2493
            ++ YN+L   YA T +     YPYC  +AL  +YR+  + +E+  Y  DI+CLQE++   + +  S  L     DG+F  K +    HE       G A F++   F+ +   +H+ M S    S     ELL R+    NVAL       S  L+V   +D     RKL V+  H++W P+  +V+L+Q       L +++ D    E          P++ CGDFNS+P SG+   L +G V   H D            WS +  E  E+  ++    F        +    +TNY   F G +DY+F   + + +    + IP  S  E       P +   SDH +L+ +L
Sbjct:  273 VVSYNILADIYAQTELSKTVLYPYCAPYALQLDYRQNLVKKELAGYNGDILCLQEVDKGVFADSLSPALDAFGLDGVFRIKEK---QHE-------GLATFYRRSKFQLLS--SHDIMFSEALTSDPLHSELLQRISG--NVALKEKVLQRSTSLQVTVLEDRFRADRKLIVANTHLYWHPKGGNVRLVQVGVALRHL-SHVMDTVAPE---------APLLFCGDFNSMPDSGLFQLLSEGSVPEQHPD------------WSGLGPE--ESCSMELTSPFPPLLSACGQPA--YTNYVGGFHGCLDYVFIQPQSMKV---EQVIPLPSHQEVTAYEALPSLAHPSDHIALVCDL 585          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Match: angel2 (protein angel homolog 2-like [Source:NCBI gene;Acc:111947098])

HSP 1 Score: 107.842 bits (268), Expect = 1.115e-23
Identity = 71/246 (28.86%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 1444 EKPSDGMS----FTLMCYNVLCQKYA--TTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVE 2163
            E P  G S    FT+M YN+L Q+       +Y +CP   L W++R   +L EI     D++CLQE++   Y+N     L+   Y   +    + RT  +      DGCA+ +K   F  +     EF  +             + +++RDNV L ++L+  D +     +CV+  H+ ++P+  D+KL Q     +E+    R       +P    C  PV+LCGD NS P S +  +L +G +E
Sbjct:  192 EPPPLGGSTAFHFTVMSYNILSQQLLEDNAFLYRHCPPAVLSWDHRLPNLLSEIQHLHPDVLCLQEVQEDHYDNQIKAALQALGYRCEY----KKRTGQKP-----DGCAVAFKASRFHLLSSNPVEFFRAG------------DPLLDRDNVGLVVLLQPADGRSGSPPICVANTHLLYNPKRGDIKLTQLAILLAEVQRLSR-------LPDGSAC--PVLLCGDLNSAPWSPLYTFLTRGCLE 407          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Match: SMESG000023679.1 (SMESG000023679.1)

HSP 1 Score: 1400.57 bits (3624), Expect = 0.000e+0
Identity = 790/818 (96.58%), Postives = 794/818 (97.07%), Query Frame = 1
Query:  271 MRNNRKFKNMTSHFSNGNELDIFTXXXXXXXXXXXXVNYVQNSTKSFKKTVKTNGKLKFDXXXXXXXXXXXXKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITEXXXXXXXXXXXFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKXXXXXXXXXXXXXXXXXXXXXXXXPYVSVLIPNSLKKCFFCQSNLTFCYECRKTXXXXXXXXXXXXXXXKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLXXXXXXXXXXXXXXXXXXXXXCQLXXXXXXXXXXXXLQPNCDSHISSLINLSAAITTSAYPYRGQSAWSS 2724
            MRNNRKFKNMTSHFSNGNELDIFTIKNSSKSRKIKRVNYVQNSTKSFKKTVKTNGKLKFDSNSNNNNNSNTNKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITESVSSYSSKKLSFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKQNFINQNFSSNNFSLNNFSSFSLSPYVSVLIPNSLKKCFFCQSNLTFCYECRKTPPSSFSNFNYSCSSCKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL                  ++  S  + + AITTSAYPYRGQSAWSS
Sbjct:    1 MRNNRKFKNMTSHFSNGNELDIFTIKNSSKSRKIKRVNYVQNSTKSFKKTVKTNGKLKFDSNSNNNNNSNTNKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITESVSSYSSKKLSFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKQNFINQNFSSNNFSLNNFSSFSLSPYVSVLIPNSLKKCFFCQSNLTFCYECRKTPPSSFSNFNYSCSSCKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL------------------TNSVSSNSSTTAITTSAYPYRGQSAWSS 800          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Match: SMESG000023679.1 (SMESG000023679.1)

HSP 1 Score: 1381.7 bits (3575), Expect = 0.000e+0
Identity = 781/809 (96.54%), Postives = 785/809 (97.03%), Query Frame = 1
Query:  298 MTSHFSNGNELDIFTXXXXXXXXXXXXVNYVQNSTKSFKKTVKTNGKLKFDXXXXXXXXXXXXKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITEXXXXXXXXXXXFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKXXXXXXXXXXXXXXXXXXXXXXXXPYVSVLIPNSLKKCFFCQSNLTFCYECRKTXXXXXXXXXXXXXXXKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLXXXXXXXXXXXXXXXXXXXXXCQLXXXXXXXXXXXXLQPNCDSHISSLINLSAAITTSAYPYRGQSAWSS 2724
            MTSHFSNGNELDIFTIKNSSKSRKIKRVNYVQNSTKSFKKTVKTNGKLKFDSNSNNNNNSNTNKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITESVSSYSSKKLSFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKQNFINQNFSSNNFSLNNFSSFSLSPYVSVLIPNSLKKCFFCQSNLTFCYECRKTPPSSFSNFNYSCSSCKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL                  ++  S  + + AITTSAYPYRGQSAWSS
Sbjct:    1 MTSHFSNGNELDIFTIKNSSKSRKIKRVNYVQNSTKSFKKTVKTNGKLKFDSNSNNNNNSNTNKEFIKTQSIEKEQSISEVVNHLSKALDKESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQSTDAVLESRNNDLSIKSDRFRVKSASEGSEPKITESVSSYSSKKLSFTFEFSYPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNNNDYQSHAVSQKQNFINQNFSSNNFSLNNFSSFSLSPYVSVLIPNSLKKCFFCQSNLTFCYECRKTPPSSFSNFNYSCSSCKVCNYNEYSDLISKSACVIAEPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL------------------TNSVSSNSSTTAITTSAYPYRGQSAWSS 791          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Match: SMESG000023679.1 (SMESG000023679.1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 413/447 (92.39%), Postives = 420/447 (93.96%), Query Frame = 1
Query: 1384 QRFLNYYKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLXXXXXXXXXXXXXXXXXXXXXCQLXXXXXXXXXXXXLQPNCDSHISSLINLSAAITTSAYPYRGQSAWSS 2724
            +++ N  KIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL                  ++  S  + + AITTSAYPYRGQSAWSS
Sbjct:  163 EQYYNKNKIVAPPNRNWHIIEKPSDGMSFTLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSSSSGQDINNSNSNNPSNNVNCQL------------------TNSVSSNSSTTAITTSAYPYRGQSAWSS 591          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Match: SMESG000062434.1 (SMESG000062434.1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.029e-21
Identity = 101/382 (26.44%), Postives = 164/382 (42.93%), Query Frame = 1
Query: 1414 APPNRNWHIIEKPSDGMS-FTLMCYNVLCQKYATT----HMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVTHE----FMLS---------CIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRN 2505
            A  NR W+     +D ++ F ++ YN+L + Y+ +     ++ +CP   LD  YRK  +++EI+ Y +DIICLQE+E+  Y +          +DGLF  K         D + ++G AIFW+   FE V +V  E     +L+          +   +     L N V  +  VA  ++  V   ++  R+L V   H+++ P      +I++   S+ L+          ++  L      VIL GDFN    S  V  ++ G V   H          L  E   +      + +LK  +N              +TNY  DF G +DYIF+    L   GN   +P S  E  +    P+  F SDH +L+ + +  N
Sbjct:  203 ALKNR-WNYTSNYNDQLNEFRVLSYNILAKMYSESDVGRQIFRHCPDEYLDVNYRKDLLIKEIFNYHSDIICLQEVESHMYRHFLYPFYSCYYFDGLFQAK---------DLESMEGQAIFWRKSKFELVENVCLESISKLVLTNDHLEGFKEIVNFIRKSNILLQNWVKLKQCVAGCVLQAVDGDRL--RQLIVFNTHLYFKPS---ANIIRSFQMSAILFQI--------SLLKLKYPRAKVILTGDFNDFRDSNAVSLVLDGSVTMKH----------LLTEGHELSINLSHDLLLKSAYNS------------SFTNYVLDFSGELDYIFYDSNELQ-CGNTVPLP-SLEEVMRDQALPNKDFPSDHLALIADFQYNN 537          
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Match: SMESG000035291.1 (SMESG000035291.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.013e-17
Identity = 86/356 (24.16%), Postives = 152/356 (42.70%), Query Frame = 1
Query: 1465 SFTLMCYNVLCQKYATTH-----MYPYCPAFALDWEYRKRGILEEIWKYKADIICLQELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKVECFEKVHHVT--------HEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPKMNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHLGPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWSAMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSKEHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVEL 2493
            SFT+  YN+L   YA T      +Y +C    L  +YR+  IL EI +  +D+I LQE++ S +  +    L+  NYDG++  KS+++         ++G AIFWK+  F+ + +++        ++    C   S      L+ +  +        +L+      NKR L +S  H+ + P+Y   +L Q     ++L    R+YY S             I+ GDFN+                     F +   K++F+    +Q    EN  +K      R     H   ++++N+T D+ G++D++    E +G+    K       E+   +  P+    SDH  L  +L
Sbjct:  236 SFTMCTYNILSHIYAETPHSKKVLYRHCDKKYLSHDYRQSLILGEIIQRSSDLIFLQEVDQSFFFQMLHPILKYFNYDGIYQNKSKNK---------LEGQAIFWKINKFKLLENISIPCLSDEINKIESFCEMKSMLTDTNLIEKWQSMGQCMTGCVLQAVFGSTNKR-LILSNNHLFFHPDYEIFRLFQVGIVFNQLERLKREYYGS-----------ACIIGGDFNA--------------------SFEDDSIKFIFDNQIQLQ---YENKSIKLEHGM-RNLLGVHRDVVEFSNFTPDYVGLLDHVIIDSEKIGIKRAYKTPSREEIEEN--IALPNKFHPSDHLPLYCDL 544          
The following BLAST results are available for this feature:
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNOT65.482e-9542.62CCR4-NOT transcription complex subunit 6 [Source:H... [more]
CNOT65.482e-9542.62CCR4-NOT transcription complex subunit 6 [Source:H... [more]
CNOT65.482e-9542.62CCR4-NOT transcription complex subunit 6 [Source:H... [more]
CNOT6L6.520e-9444.47CCR4-NOT transcription complex subunit 6 like [Sou... [more]
CNOT6L6.520e-9444.47CCR4-NOT transcription complex subunit 6 like [Sou... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccr-41.045e-8641.05CCR (Yeast CCR4/NOT complex component) homolog [S... [more]
ccr-41.103e-8641.05CCR (Yeast CCR4/NOT complex component) homolog [S... [more]
ccr-41.103e-8641.05CCR (Yeast CCR4/NOT complex component) homolog [S... [more]
ccr-42.981e-8641.05CCR (Yeast CCR4/NOT complex component) homolog [S... [more]
ccr-41.176e-8541.23CCR (Yeast CCR4/NOT complex component) homolog [S... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twin3.700e-9243.43gene:FBgn0011725 transcript:FBtr0084567[more]
twin5.491e-9243.43gene:FBgn0011725 transcript:FBtr0084566[more]
twin5.491e-9243.43gene:FBgn0011725 transcript:FBtr0084568[more]
twin5.491e-9243.43gene:FBgn0011725 transcript:FBtr0084571[more]
twin8.587e-9243.43gene:FBgn0011725 transcript:FBtr0084569[more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnot6b3.131e-9644.71CCR4-NOT transcription complex, subunit 6b [Source... [more]
cnot6a1.059e-9442.36CCR4-NOT transcription complex, subunit 6a [Source... [more]
cnot6a1.059e-9442.36CCR4-NOT transcription complex, subunit 6a [Source... [more]
cnot6l5.347e-9344.62CCR4-NOT transcription complex, subunit 6-like [So... [more]
cnot6l5.347e-9344.62CCR4-NOT transcription complex, subunit 6-like [So... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4g1.231e-9444.53hepatocyte nuclear factor 4 gamma [Source:Xenbase;... [more]
hnf4g3.732e-9444.06hepatocyte nuclear factor 4 gamma [Source:Xenbase;... [more]
hnf4g4.353e-9444.53hepatocyte nuclear factor 4 gamma [Source:Xenbase;... [more]
hnf4g2.789e-8643.30hepatocyte nuclear factor 4 gamma [Source:Xenbase;... [more]
PDE125.717e-3026.03phosphodiesterase 12 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnot62.413e-9743.84CCR4-NOT transcription complex, subunit 6 [Source:... [more]
Cnot68.281e-9743.31CCR4-NOT transcription complex, subunit 6 [Source:... [more]
Cnot6l1.505e-9444.47CCR4-NOT transcription complex, subunit 6-like [So... [more]
Cnot6l1.782e-9444.47CCR4-NOT transcription complex, subunit 6-like [So... [more]
Cnot6l2.302e-7247.60CCR4-NOT transcription complex, subunit 6-like [So... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BJ41|CNOT6_XENLA1.688e-9643.84CCR4-NOT transcription complex subunit 6 OS=Xenopu... [more]
sp|Q6AXU9|CNOT6_RAT5.792e-9643.31CCR4-NOT transcription complex subunit 6 OS=Rattus... [more]
sp|Q8K3P5|CNOT6_MOUSE5.792e-9643.31CCR4-NOT transcription complex subunit 6 OS=Mus mu... [more]
sp|Q9ULM6|CNOT6_HUMAN2.633e-9442.62CCR4-NOT transcription complex subunit 6 OS=Homo s... [more]
sp|Q8VEG6|CNO6L_MOUSE1.246e-9344.47CCR4-NOT transcription complex subunit 6-like OS=M... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EN644.017e-14655.42Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183AF731.357e-14552.72Endo/exonuclease/phosphatase domain-containing pro... [more]
A0A068Y9004.850e-14554.66CCR4 NOT transcription complex subunit 6 OS=Echino... [more]
A0A068WF282.463e-14454.66CCR4 NOT transcription complex subunit 6 OS=Echino... [more]
A0A4E0RF531.201e-14252.12CCR4-NOT transcription complex subunit OS=Fasciola... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnot6a1.449e-9443.92CCR4-NOT transcription complex subunit 6 [Source:N... [more]
cnot6b4.564e-9443.92CCR4-NOT transcription complex subunit 6 [Source:N... [more]
cnot6l2.812e-9244.09CCR4-NOT transcription complex, subunit 6-like [So... [more]
cnot6a2.943e-9042.28CCR4-NOT transcription complex subunit 6 [Source:N... [more]
pde122.786e-2727.66phosphodiesterase 12 [Source:NCBI gene;Acc:1030361... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnot6l3.171e-8743.16CCR4-NOT transcription complex, subunit 6-like [So... [more]
angel22.471e-1728.87angel homolog 2 (Drosophila) [Source:NCBI gene;Acc... [more]
angel21.026e-1628.87angel homolog 2 (Drosophila) [Source:NCBI gene;Acc... [more]
angel22.242e-1628.87angel homolog 2 (Drosophila) [Source:NCBI gene;Acc... [more]
nocta6.064e-1629.61nocturnin a [Source:ZFIN;Acc:ZDB-GENE-050208-306][more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
CCR46.080e-5034.55Component of the CCR4-NOT transcriptional complex;... [more]
NGL12.806e-1525.14Putative endonuclease; has a domain similar to a m... [more]
NGL21.373e-1226.47Protein involved in 5.8S rRNA processing; Ccr4p-li... [more]
NGL32.304e-622.953'-5' exonuclease specific for poly-A RNAs; has a ... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO303366.595e-8941.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458451.868e-3026.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402102.195e-2734.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301986.663e-1745.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346805.181e-1625.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnot6b3.079e-9744.44CCR4-NOT transcription complex subunit 6 [Source:N... [more]
cnot6l1.791e-9344.77CCR4-NOT transcription complex subunit 6 like [Sou... [more]
cnot6b6.187e-7743.38CCR4-NOT transcription complex subunit 6 [Source:N... [more]
pde128.656e-2628.37phosphodiesterase 12 [Source:NCBI gene;Acc:1011625... [more]
angel21.115e-2328.86protein angel homolog 2-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of CCR4-NOT transcription complex subunit 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023679.10.000e+096.58SMESG000023679.1[more]
SMESG000023679.10.000e+096.54SMESG000023679.1[more]
SMESG000023679.10.000e+092.39SMESG000023679.1[more]
SMESG000062434.13.029e-2126.44SMESG000062434.1[more]
SMESG000035291.11.013e-1724.16SMESG000035291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010856 ID=SMED30010856|Name=CCR4-NOT transcription complex subunit 6|organism=Schmidtea mediterranea sexual|type=transcript|length=3375bp
AGGCTGCTTGAAATAAAGTCTTTATGAATATTGATTGACGATTACTTGAT
TTTCATTGGTTGGTTTTTACTATATCAATTGGAATTTTTCTATCCTTTGT
ATAGCCGATTTTTCTTCTCTATAAATTTCTGTAATTCCTCTGTTAGCAGC
TACTAATTTCAATTTATTACATTCTACTAATTTACAATCGTTTTGAATTT
TTATTTCAACTGAACATTGACTGGAATTTATATTTTGACCATACAACTGA
AGAGGCAAGGTTATTTAATTATGAGGAATAATCGAAAATTTAAAAATATG
ACTTCTCACTTTTCAAATGGAAATGAATTGGATATTTTCACCATTAAAAA
TTCATCGAAAAGTCGGAAAATCAAACGCGTAAATTACGTACAGAATTCAA
CGAAATCTTTTAAGAAAACTGTGAAGACGAACGGAAAATTGAAATTTGAT
TCTAATAGTAATAATAATAACAATAGTAACACGAATAAAGAATTTATTAA
AACCCAATCAATTGAAAAGGAACAATCGATTTCGGAGGTTGTTAATCATT
TGTCTAAAGCCTTGGATAAGGAATCCATTTCCAATGACGTGAGAAATTCC
AATTCTGGAGTGCATACATTGTTCCATTATACACCGAATCAGCGAGTTGA
GAAAATTAATTTTGAAAAGGATAAATGCCCAGTTTGCAATTATTTAAAGC
GTCAACGGATTCAGTCAACCGATGCCGTGTTAGAGTCTCGAAACAATGAT
TTATCTATCAAATCTGACAGGTTTCGGGTGAAATCAGCCAGTGAAGGATC
AGAACCTAAAATAACTGAAAGTGTTTCATCATACTCATCGAAAAAACTAT
CATTCACATTCGAGTTTTCCTATCCTAATGACGGTGACAGCTCTGATTCA
GCTTTTTGCAATGGAATTAGTGTCGACTTGACTAACTGTGAAAACGTTTC
ATTTAGAATTGAAAAATTATCGGAAATTTCATCAAGATATTACTCCAATT
CATTTTCATTAATGAACAATAATGACTATCAATCTCATGCGGTTTCTCAG
AAACAAAATTTTATTAATCAAAACTTTAGCAGCAATAATTTTTCACTCAA
TAACTTTTCGAGTTTTTCTCTCAGTCCCTACGTATCAGTTTTAATACCAA
ATAGCCTTAAAAAGTGTTTCTTTTGTCAGTCTAATTTAACATTTTGTTAT
GAATGTCGTAAAACGCCGCCAAGTTCATTTTCAAACTTCAATTACAGTTG
CAGCTCATGTAAAGTTTGTAATTATAATGAATATTCCGATCTTATTTCCA
AATCTGCTTGTGTCATCGCTGAGCCAATCCAATCATCACGCACCAACGAT
ATATTTGATTCGTTGAAGACCTGTTTAATACCTCAAAGATTTCTCAATTA
TTATAAGATTGTTGCTCCACCGAATAGAAATTGGCATATCATTGAAAAAC
CTTCAGATGGAATGTCATTCACGTTGATGTGCTACAATGTACTTTGCCAA
AAATATGCTACAACTCACATGTATCCATATTGTCCGGCATTCGCGTTAGA
TTGGGAATATCGAAAACGGGGAATTCTTGAAGAAATTTGGAAATATAAAG
CGGATATTATTTGTCTTCAAGAGTTAGAAACATCTCAATATGAGAATGTT
TTTTCTGTTGAATTGCGAAAGAGAAATTATGATGGTTTGTTTGTCCCAAA
AAGCAGATCAAGAACAATGCACGAATCTGATTCCAAATGTGTTGATGGAT
GTGCAATATTCTGGAAAGTTGAGTGTTTCGAAAAAGTCCACCACGTCACC
CACGAATTCATGCTGTCTTGCATTGGTGTCAGCAAAAATCCTGCCCCGGA
GTTACTGAATAGAGTAATGAATCGGGACAATGTGGCTCTTAGTATAATTT
TAGAGGTTAAGGATCCAAAAATGAACAAAAGAAAACTTTGTGTATCGACA
GGTCACATCCATTGGGATCCAGAATATAGTGACGTCAAATTAATTCAAAC
TCTGTTTTGGTCTTCGGAGTTGTGGAATTATATTAGGGATTATTACAAGT
CTGAAAATATGCCACATTTAGGTCCTTGTGATATGCCTGTGATTTTGTGT
GGTGACTTTAATTCTTTACCTCAATCTGGAGTTGTGGATTATTTAATCAA
AGGGGAAGTAGAACGGAGTCACGTTGACTTTCGAGAATTCGGAGATAAAT
ATTTATTTAATGAGTGGAGTGCAATGCAAGACGAGTTCGTTGAAAACGAT
GTGTTAAAGCATAGATTTAATTTCGATCGGGCCTATAAGGATGAGCATGA
AAGCGGGCTCAAATGGACTAATTACACGTATGATTTTCGGGGAATTATCG
ATTACATATTTTTCTCCAAAGAGCATTTGGGTTTGCTGGGGAATTTGAAA
CAAATTCCAGAAAGTTGGTTTGAACAACAGAAAATTGTCGGAGCACCACA
TGTGCATTTCAATAGTGATCATTTTTCGTTATTGGTAGAGCTGGAGCTGA
GAAATTCCGGCTTGTCGTCGTCATCAGGTCAAGATATTAATAACAGCAAC
AGCAACAACCCCTCCAACAATGTCAATTGTCAACTCACGAATTCAGTCAG
CAGCAACAGCAGTACAAGTAATTTACAACCGAATTGCGATTCTCACATCA
GTTCTCTTATTAATCTTTCAGCTGCCATCACCACCAGTGCATATCCTTAT
AGAGGCCAATCAGCGTGGTCATCATGATGTCCTTCAACCAATCCATTATC
ATCATCTGTATATTGTGTTATTGTGTTATTATTTACCTACCAAATACATT
TATTGACAGTTTTGTAAATTTGTAAATATTTCCTGGCTTTACTTGCTTGT
GCTACTCATAATTTGTAAGCTAGTATGTTGTTGTTATTTGTTGTTGTAAG
TGATCTGTGGTATTTATGAAAAGGTGTGTTTTCCTATTGAATTAACACAT
CAATTCGGTCAATAATTTCAACATGATAATGAATCCAATAATATTATAAT
TATTATTGATAATATTCGGGAAATTTAGCATTCGTTGTTTTGATTAGTTG
ACTGGATTGTCTGTCTGTGTGTATTTGTATAAATATGTAAAGTTTTTTAA
TATTACTTTGTGAATTACATTTTTATATAATTATATTGTGTTTATCAGCA
GGACTATTTGATGTGGATTTCGCTTCGGCTTCGCGGAGGGTACCTGTAAC
TGTAAAACGAAGCCTTATTATTATTTAACTTACGTTTGTATTCTTGGCTG
CATTTATTTTTTTAAGATTTGTGTTTGGGATAATAATTATAATGCTATGC
TCTCAGTTATAATTATTAATATTTGGGATACGATATGATTAATGTTTATG
GCCGTCCATAAATGTGTGACGTCAG
back to top

protein sequence of SMED30010856-orf-1

>SMED30010856-orf-1 ID=SMED30010856-orf-1|Name=SMED30010856-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=819bp
MRNNRKFKNMTSHFSNGNELDIFTIKNSSKSRKIKRVNYVQNSTKSFKKT
VKTNGKLKFDSNSNNNNNSNTNKEFIKTQSIEKEQSISEVVNHLSKALDK
ESISNDVRNSNSGVHTLFHYTPNQRVEKINFEKDKCPVCNYLKRQRIQST
DAVLESRNNDLSIKSDRFRVKSASEGSEPKITESVSSYSSKKLSFTFEFS
YPNDGDSSDSAFCNGISVDLTNCENVSFRIEKLSEISSRYYSNSFSLMNN
NDYQSHAVSQKQNFINQNFSSNNFSLNNFSSFSLSPYVSVLIPNSLKKCF
FCQSNLTFCYECRKTPPSSFSNFNYSCSSCKVCNYNEYSDLISKSACVIA
EPIQSSRTNDIFDSLKTCLIPQRFLNYYKIVAPPNRNWHIIEKPSDGMSF
TLMCYNVLCQKYATTHMYPYCPAFALDWEYRKRGILEEIWKYKADIICLQ
ELETSQYENVFSVELRKRNYDGLFVPKSRSRTMHESDSKCVDGCAIFWKV
ECFEKVHHVTHEFMLSCIGVSKNPAPELLNRVMNRDNVALSIILEVKDPK
MNKRKLCVSTGHIHWDPEYSDVKLIQTLFWSSELWNYIRDYYKSENMPHL
GPCDMPVILCGDFNSLPQSGVVDYLIKGEVERSHVDFREFGDKYLFNEWS
AMQDEFVENDVLKHRFNFDRAYKDEHESGLKWTNYTYDFRGIIDYIFFSK
EHLGLLGNLKQIPESWFEQQKIVGAPHVHFNSDHFSLLVELELRNSGLSS
SSGQDINNSNSNNPSNNVNCQLTNSVSSNSSTSNLQPNCDSHISSLINLS
AAITTSAYPYRGQSAWSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR005135Endo/exonuclease/phosphatase
Vocabulary: biological process
TermDefinition
GO:0000289nuclear-transcribed mRNA poly(A) tail shortening
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006417regulation of translation
GO:0031047gene silencing by RNA
GO:0043928exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
GO:0070966nuclear-transcribed mRNA catabolic process, no-go decay
GO:0090305nucleic acid phosphodiester bond hydrolysis
GO:0090503RNA phosphodiester bond hydrolysis, exonucleolytic
GO:2000327positive regulation of ligand-dependent nuclear receptor transcription coactivator activity
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0004518nuclease activity
GO:0004527exonuclease activity
GO:0004532exoribonuclease activity
GO:0004535poly(A)-specific ribonuclease activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0030014CCR4-NOT complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005135Endonuclease/exonuclease/phosphatasePFAMPF03372Exo_endo_phoscoord: 405..705
e-value: 9.9E-14
score: 51.4
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 378..790
e-value: 1.1E-114
score: 385.3
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 398..743
NoneNo IPR availablePANTHERPTHR12121:SF35CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 6-LIKEcoord: 384..750
NoneNo IPR availablePANTHERPTHR12121CARBON CATABOLITE REPRESSOR PROTEIN 4coord: 384..750