Receptor-type tyrosine-protein phosphatase F

Overview
NameReceptor-type tyrosine-protein phosphatase F
Smed IDSMED30010855
Length (bp)7186
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase F (SMED30010855) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase F (SMED30010855) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase F (SMED30010855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase F (SMED30010855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 SmedASXL_018252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 SmedASXL_018253SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038449.1 SMESG000035516.1 Contig4555newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038449.1 SMESG000035516.1 Contig4555uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038926.1 Contig4555newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038926.1 Contig4555uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038449.1 SMESG000035516.1 Contig39553newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010855SMESG000038449.1 SMESG000035516.1 Contig39553uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v4_8199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010855SMESG000038449.1 SMESG000035516.1 dd_Smed_v4_22581_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v6_8199_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30010855SMESG000038449.1 SMESG000038447.1 SMESG000035516.1 dd_Smed_v6_8199_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 378/673 (56.17%), Postives = 476/673 (70.73%), Query Frame = 2
Query: 5114 NHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            +H  + +++ +I    TPD  +RS + +       FH + +    L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct: 1333 HHPKDPVEMRRINFQ-TPDSGLRSPLREP-----GFHFESM----LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1944          

HSP 2 Score: 285.419 bits (729), Expect = 1.810e-76
Identity = 272/1088 (25.00%), Postives = 467/1088 (42.92%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISP-KKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRI---------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECT--TTPKACPMIVKNWDLSISKRG-GIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKF-----IHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYY-----EVWCFVLSHENKXXXXXXXXXX-XXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI         +T   G L+I  ++E D+G YECVATN+ G   SS   L +R    V+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W       Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+  +    G   P + + T  + P A P  VK     +S R   I + WR  P +    + +   + ++  LG+   +P  +  I        L+ +++   Y++  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KD+ +      ++        +  NL P++ Y I + + T +  G   K + + T    L +P           L    E P  T E          + GYRL++      D      LE   SE ++ T+S  H +G  Y F++AA +   +G+E  + + I E +P   P    L+   N S  +V+  W        NG    Y     E      + E +         E  +T+  LK D+ Y  +VR   ++    +S  + ++T      +P   +   + +++  ++W++ PD
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL-------LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS---PPRQESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVK----CVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDD-TAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAE--------DQVLGYRLQFG---REDSTPLATLEFPPSEDRY-TASGVH-KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQ--ILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEF-PD 1058          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 772.311 bits (1993), Expect = 0.000e+0
Identity = 369/628 (58.76%), Postives = 456/628 (72.61%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct: 1330 LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1906          

HSP 2 Score: 297.745 bits (761), Expect = 2.813e-80
Identity = 272/1075 (25.30%), Postives = 470/1075 (43.72%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISP-KKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECT--TTPKACPMIVKNWDLSISKRG-GIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKF-----IHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYY-----EVWCFVLSHENKXXXXXXXXXX-XXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W       Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+  +    G   P + + T  + P A P  VK     +S R   I + WR  P +    + +   + ++  LG+   +P  +  I        L+ +++   Y++  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KD+ +      +++Q +    +  NL P++ Y I + + T +  G   K + + T    L +P           L    E P  T E          + GYRL++      D      LE   SE ++ T+S  H +G  Y F++AA +   +G+E  + + I E +P   P    L+   N S  +V+  W        NG    Y     E      + E +         E  +T+  LK D+ Y  +VR   ++    +S  + ++T      +P   +   + +++  ++W++ PD
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS---PPRQESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVK----CVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVML------ADAQEM----VITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAE--------DQVLGYRLQFG---REDSTPLATLEFPPSEDRY-TASGVH-KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQ--ILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEF-PD 1036          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 369/628 (58.76%), Postives = 456/628 (72.61%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct:  921 LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1497          

HSP 2 Score: 244.202 bits (622), Expect = 4.599e-64
Identity = 170/591 (28.76%), Postives = 282/591 (47.72%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLST 2260
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W   P + Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+ 
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL-------LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS--PPR-QESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAA 583          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 369/628 (58.76%), Postives = 456/628 (72.61%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct:  921 LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1497          

HSP 2 Score: 244.202 bits (622), Expect = 4.638e-64
Identity = 170/591 (28.76%), Postives = 282/591 (47.72%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLST 2260
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W   P + Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+ 
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL-------LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS--PPR-QESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAA 583          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRS (protein tyrosine phosphatase receptor type S [Source:HGNC Symbol;Acc:HGNC:9681])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 369/628 (58.76%), Postives = 456/628 (72.61%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct:  925 LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1501          

HSP 2 Score: 238.424 bits (607), Expect = 2.991e-62
Identity = 170/595 (28.57%), Postives = 282/595 (47.39%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLST 2260
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +R    V+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W   P + Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+ 
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL-------LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS--PPR-QESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAA 587          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 300/628 (47.77%), Postives = 407/628 (64.81%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + +  +P+  L+ H+  L+ N++  F  E+ESIE GQ FTW  S+ ++N+ KNRYANV AYDHSRV+L        SN    P   G DYINAN++ GY  P++YIATQGPL ET  DFWRM+WE+ S  IVM+T LEER R KCDQYWP  G    +T+  I VT+++ + LA+YT+R   ++ + +  VREI   Q+TAWPDHGVP+HP P L+FL+RV +    + GPI+ HCSAG+GRTGAFIVID MLERLRY+NTVDIY  VT +R+QR+YMVQTE+QYIFI++ +L+AV  G+TEVP   L  H+  L+Q      +AD  Q++G+ MEF +L                      T     +N CT         A    N+ KNR+L  +P D +RV +  + G +GSDYINASWIDGYK R AYIA Q+P +ET  DFWR +WEHNS I+ ML +  E  +E+   YWP++   +    +V+P+AEY+M  Y +REF+++D    + R +RQF F +W +    PH+   FLD + QVH T  Q G  GPI VHC +G+GRT +F+ALS I++RM+ E V+D+F TVKLLR +R  ++Q  +QY F Y+AA EYL  ++
Sbjct: 1626 VSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVL--------SNVEGYP---GMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG---TATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-----PSAD--QLSGIDMEFRHL----------------------TTLKWTSNRCT--------VANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGK-PHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 2201          

HSP 2 Score: 229.18 bits (583), Expect = 1.141e-59
Identity = 331/1492 (22.18%), Postives = 601/1492 (40.28%), Query Frame = 2
Query:  515 KQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN-QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGS-TDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN---LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNF-IKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKV-FVMKTKD-----FLVNKNLTSGTIINVKKSDYEFVKTKSLQ---------NLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT-QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG---MPSLVEC-TTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKIN-----IRI-YFQ---SKLGNF-SVQPSLQ-------------TIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYI-FANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVT-VEWK--EDIKNKKWIKGY----RLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDA-IRFIRLSQSTAQITWKWNP----DFLIHYSHFIIYYTNEKTF--LNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIW-KLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTEN-GTIDDYYVVV-------------------KVLKEKTRKL-RSVNLVDER-------TIGNLIQNSSFN-------RNEISNPYIAVSLKDELIFPISTPLKQVHK----IKIGENNINGQFKNWKLDPKFYYQFQIIAC----IRLKES 4663
            +  P ++V++  +  V+ + +  F C  DGNP P + WR+N +S T   R S+  ++   S LR   V LDDN T ++C A N + +   + ASL+V   + ++P GFP I    S+   E+     + C+V+G P   + WL+D IP+D   + R + S  GN   L I   +E+D+G YEC+A N LG   S    L ++V+   P F  K+    +V  G ++ L C A+G P+P V+W+  +T L       T    +  + L+ +  +    CVA +   +I  + +V  +E    P  I V+ +   S  I+W      E   +Y V + +K+++          +       + + S+    + K+++          L+ F  Y   + S       ++S  V   T    P T P + +  S++  ++L+ W P + PNG+IT Y +YYT      P+  W ++  KS       +  T ++ +  ++ Y++ + AQNS G SP+S  + +  R G+   P      A  S  ++L WD     S V  + Y + Y   +    +KE     SP +  ++ G L P+  Y F+++  ++   G    P + +   + P + P IV     + +    +EI W+  PE+  K+N      RI YF+   SK  N  SV+                  + S      L ++    +Y++ +     +   P E S ++          P   +    ++T++++ W   +  +     Y + L     +R  + +P+ +   KK +     ++ + RY    +L P++EY   LN+  R   G   + + I T       P+ + + L    E P V  +EWK  +   N+  I+ Y    R + YP   +  +K K     V  +   T+    W G  Y+  +AA N        T+ I    GSP   P + + +         ++ +W   S+   NG    Y+     +                 +   +     Y  +V     K    +S  +      A    P   +R    S STA + W +       F++ Y H      + + +  L  + + K     F   ++  LNA   Y   V +V N   +GP SD     ++  S  P   +  L     +S  +QL W   +       F VN +G   +        +  + QE++      G +     +   H+ Y    +W  L+P+  YTI +     P           +  T    P  ++   L D + +     ++   P TE  G I  Y++++                   K   EK  +L RS+++   +        +G+  Q++S++       R  +   Y+   L  + +       KQ ++      +G++ +   F N+ L+   +Y+  + A     +R K+S
Sbjct:   44 EDDPARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVP-RDKVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWK--KTDLMVLDDPSTAPIGKNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKSENKDDAALFAKDSRAEDESDSERYSEGRSSRGKTMETLENSLVIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSD------EFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPMLTVKALDSRRMQLTWDKPLYSSPV--VGYTVRY---NTSDGEKELTLT-SPHEKHVVTG-LHPDKYYYFRVAAYSDRGQGEFTEPMISKTIASIPLSSPTIVS---AAATSSKSVEIRWKG-PEQK-KLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGP-ESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYL-----DRMVNGEPVVEKGSKKRI--VMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRD-EPPVVARIEWKMPKMKPNETPIEKYNLWLRAQGYP---DSYVKAKT----VDGTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKG----KIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKENPKRF--AVVSDLNAHKPYAFCVLAVKNNR-QGPCSD---PPTVLESVTPTYMVQNLRVLWKTSNSVQLTW--EYNGPRNVGFYVNHTGRKDY--------VNHELQEKTMSTPGFGQD-----VDEKHREY----LWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQMIRLTPATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRV-------KQQYRNNQPFIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDS 1462          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 620.928 bits (1600), Expect = 0.000e+0
Identity = 300/628 (47.77%), Postives = 407/628 (64.81%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + +  +P+  L+ H+  L+ N++  F  E+ESIE GQ FTW  S+ ++N+ KNRYANV AYDHSRV+L        SN    P   G DYINAN++ GY  P++YIATQGPL ET  DFWRM+WE+ S  IVM+T LEER R KCDQYWP  G    +T+  I VT+++ + LA+YT+R   ++ + +  VREI   Q+TAWPDHGVP+HP P L+FL+RV +    + GPI+ HCSAG+GRTGAFIVID MLERLRY+NTVDIY  VT +R+QR+YMVQTE+QYIFI++ +L+AV  G+TEVP   L  H+  L+Q      +AD  Q++G+ MEF +L                      T     +N CT         A    N+ KNR+L  +P D +RV +  + G +GSDYINASWIDGYK R AYIA Q+P +ET  DFWR +WEHNS I+ ML +  E  +E+   YWP++   +    +V+P+AEY+M  Y +REF+++D    + R +RQF F +W +    PH+   FLD + QVH T  Q G  GPI VHC +G+GRT +F+ALS I++RM+ E V+D+F TVKLLR +R  ++Q  +QY F Y+AA EYL  ++
Sbjct: 1602 VSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVL--------SNVEGYP---GMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG---TATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-----PSAD--QLSGIDMEFRHL----------------------TTLKWTSNRCT--------VANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGK-PHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 2177          

HSP 2 Score: 235.343 bits (599), Expect = 1.730e-61
Identity = 332/1478 (22.46%), Postives = 597/1478 (40.39%), Query Frame = 2
Query:  515 KQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN-QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGS-TDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN---LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNF-IKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKV-FVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT-QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG---MPSLVEC-TTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKIN-----IRI-YFQ---SKLGNF-SVQPSLQ-------------TIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYI-FANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVT-VEWK--EDIKNKKWIKGY----RLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDA-IRFIRLSQSTAQITWKWNP----DFLIHYSHFIIYYTNEKTF--LNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIW-KLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTEN-GTIDDYYVVV-------------------KVLKEKTRKL-RSVNLVDERT-------IGNLIQNSSFN-------RNEISNPYIAVSLKDELIFPISTPLKQVHK----IKIGENNINGQFKNWKLDPKFYYQFQIIAC----IRLKES 4663
            +  P ++V++  +  V+ + +  F C  DGNP P + WR+N +S T   R S+  ++   S LR   V LDDN T ++C A N + +   + ASL+V   + ++P GFP I    S+   E+     + C+V+G P   + WL+D IP+D   + R + S  GN   L I   +E+D+G YEC+A N LG   S    L ++V+   P F  K+    +V  G ++ L C A+G P+P V+W+  +T L       T    +  + L+ +  +    CVA +   +I  + +V  +E    P  I V+ +   S  I+W      E   +Y V + +K  +   ++  T  T+ N          +  +  L+ F  Y   + S       ++S  V   T    P T P + +  S++  ++L+ W P + PNG+IT Y +YYT      P+  W ++  KS       +  T ++ +  ++ Y++ + AQNS G SP+S  + +  R G+   P      A  S  ++L WD     S V  + Y + Y   +    +KE     SP +  ++ G L P+  Y F+++  ++   G    P + +   + P + P IV     + +    +EI W+  PE+  K+N      RI YF+   SK  N  SV+                  + S      L ++    +Y++ +     +   P E S ++          P   +    ++T++++ W   +  +     Y + L     +R  + +P+ +   KK +     ++ + RY    +L P++EY   LN+  R   G   + + I T       P+ + + L    E P V  +EWK  +   N+  I+ Y    R + YP   +  +K K     V  +   T+    W G  Y+  +AA N        T+ I    GSP   P + + +         ++ +W   S+   NG    Y+     +                 +   +     Y  +V     K    +S  +      A    P   +R    S STA + W +       F++ Y H      + + +  L  + + K     F   ++  LNA   Y   V +V N   +GP SD     ++  S  P   +  L     +S  +QL W   +       F VN +G   +        +  + QE++      G +     +   H+ Y    +W  L+P+  YTI +     P           +  T    P  ++   L D + +     ++   P TE  G I  Y++++                   K   EK  +L RS+++   +        +G+  Q++S++       R  +   Y+   L  + +       KQ ++      +G++ +   F N+ L+   +Y+  + A     +R K+S
Sbjct:   44 EDDPARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVP-RDKVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWK--KTDLMVLDDPSTAPIGKNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRSSRGKTMETLEN----------SLVIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSD------EFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPMLTVKALDSRRMQLTWDKPLYSSPV--VGYTVRY---NTSDGEKELTLT-SPHEKHVVTG-LHPDKYYYFRVAAYSDRGQGEFTEPMISKTIASIPLSSPTIVS---AAATSSKSVEIRWKG-PEQK-KLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGP-ESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYL-----DRMVNGEPVVEKGSKKRI--VMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRD-EPPVVARIEWKMPKMKPNETPIEKYNLWLRAQGYP---DSYVKAKT----VDGTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKG----KIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKENPKRF--AVVSDLNAHKPYAFCVLAVKNNR-QGPCSD---PPTVLESVTPTYMVQNLRVLWKTSNSVQLTW--EYNGPRNVGFYVNHTGRKDY--------VNHELQEKTMSTPGFGQD-----VDEKHREY----LWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQMIRLTPATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRV-------KQQYRNNQPFIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDS 1438          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 300/628 (47.77%), Postives = 407/628 (64.81%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + +  +P+  L+ H+  L+ N++  F  E+ESIE GQ FTW  S+ ++N+ KNRYANV AYDHSRV+L        SN    P   G DYINAN++ GY  P++YIATQGPL ET  DFWRM+WE+ S  IVM+T LEER R KCDQYWP  G    +T+  I VT+++ + LA+YT+R   ++ + +  VREI   Q+TAWPDHGVP+HP P L+FL+RV +    + GPI+ HCSAG+GRTGAFIVID MLERLRY+NTVDIY  VT +R+QR+YMVQTE+QYIFI++ +L+AV  G+TEVP   L  H+  L+Q      +AD  Q++G+ MEF +L                      T     +N CT         A    N+ KNR+L  +P D +RV +  + G +GSDYINASWIDGYK R AYIA Q+P +ET  DFWR +WEHNS I+ ML +  E  +E+   YWP++   +    +V+P+AEY+M  Y +REF+++D    + R +RQF F +W +    PH+   FLD + QVH T  Q G  GPI VHC +G+GRT +F+ALS I++RM+ E V+D+F TVKLLR +R  ++Q  +QY F Y+AA EYL  ++
Sbjct: 1670 VSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVL--------SNVEGYP---GMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG---TATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-----PSAD--QLSGIDMEFRHL----------------------TTLKWTSNRCT--------VANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGK-PHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 2245          

HSP 2 Score: 229.565 bits (584), Expect = 9.020e-60
Identity = 342/1532 (22.32%), Postives = 617/1532 (40.27%), Query Frame = 2
Query:  419 NAEKSNNQ--QRIILPLWKRSVDHNRQLDYTIIYKQK------PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN-QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGS-TDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN---LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNF-IKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKV-FVMKTKD-----FLVNKNLTSGTIINVKKSDYEFVKTKSLQ---------NLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT-QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG---MPSLVEC-TTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKIN-----IRI-YFQ---SKLGNF-SVQPSLQ-------------TIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYI-FANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVT-VEWK--EDIKNKKWIKGY----RLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDA-IRFIRLSQSTAQITWKWNP----DFLIHYSHFIIYYTNEKTF--LNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIW-KLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTEN-GTIDDYYVVV-------------------KVLKEKTRKL-RSVNLVDERT-------IGNLIQNSSFN-------RNEISNPYIAVSLKDELIFPISTPLKQVHK----IKIGENNINGQFKNWKLDPKFYYQFQIIAC----IRLKES 4663
            + E  +NQ  Q   +PL ++    N QL Y   Y+        P ++V++  +  V+ + +  F C  DGNP P + WR+N +S T   R S+  ++   S LR   V LDDN T ++C A N + +   + ASL+V   + ++P GFP I    S+   E+     + C+V+G P   + WL+D IP+D   + R + S  GN   L I   +E+D+G YEC+A N LG   S    L ++V+   P F  K+    +V  G ++ L C A+G P+P V+W+  +T L       T    +  + L+ +  +    CVA +   +I  + +V  +E    P  I V+ +   S  I+W      E   +Y V + +K+++          +       + + S+    + K+++          L+ F  Y   + S       ++S  V   T    P T P + +  S++  ++L+ W P + PNG+IT Y +YYT      P+  W ++  KS       +  T ++ +  ++ Y++ + AQNS G SP+S  + +  R G+   P      A  S  ++L WD     S V  + Y + Y   +    +KE     SP +  ++ G L P+  Y F+++  ++   G    P + +   + P + P IV     + +    +EI W+  PE+  K+N      RI YF+   SK  N  SV+                  + S      L ++    +Y++ +     +   P E S ++          P   +    ++T++++ W   +  +     Y + L     +R  + +P+ +   KK +     ++ + RY    +L P++EY   LN+  R   G   + + I T       P+ + + L    E P V  +EWK  +   N+  I+ Y    R + YP   +  +K K     V  +   T+    W G  Y+  +AA N        T+ I    GSP   P + + +         ++ +W   S+   NG    Y+     +                 +   +     Y  +V     K    +S  +      A    P   +R    S STA + W +       F++ Y H      + + +  L  + + K     F   ++  LNA   Y   V +V N   +GP SD     ++  S  P   +  L     +S  +QL W   +       F VN +G   +        +  + QE++      G +     +   H+ Y    +W  L+P+  YTI +     P           +  T    P  ++   L D + +     ++   P TE  G I  Y++++                   K   EK  +L RS+++   +        +G+  Q++S++       R  +   Y+   L  + +       KQ ++      +G++ +   F N+ L+   +Y+  + A     +R K+S
Sbjct:   49 DEEPPDNQDVQDGGIPLVRKEEFTNNQL-YAEAYQSYIQALAYPARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVP-RDKVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWK--KTDLMVLDDPSTAPIGKNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKSENKDDAALFAKDSRAEDESDSERYSEGRSSRGKTMETLENSLVIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSD------EFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPMLTVKALDSRRMQLTWDKPLYSSPV--VGYTVRY---NTSDGEKELTLT-SPHEKHVVTG-LHPDKYYYFRVAAYSDRGQGEFTEPMISKTIASIPLSSPTIVS---AAATSSKSVEIRWKG-PEQK-KLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGP-ESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYL-----DRMVNGEPVVEKGSKKRI--VMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRD-EPPVVARIEWKMPKMKPNETPIEKYNLWLRAQGYP---DSYVKAKT----VDGTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKG----KIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKENPKRF--AVVSDLNAHKPYAFCVLAVKNNR-QGPCSD---PPTVLESVTPTYMVQNLRVLWKTSNSVQLTW--EYNGPRNVGFYVNHTGRKDY--------VNHELQEKTMSTPGFGQD-----VDEKHREY----LWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQMIRLTPATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRV-------KQQYRNNQPFIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDS 1506          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 300/628 (47.77%), Postives = 407/628 (64.81%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + +  +P+  L+ H+  L+ N++  F  E+ESIE GQ FTW  S+ ++N+ KNRYANV AYDHSRV+L        SN    P   G DYINAN++ GY  P++YIATQGPL ET  DFWRM+WE+ S  IVM+T LEER R KCDQYWP  G    +T+  I VT+++ + LA+YT+R   ++ + +  VREI   Q+TAWPDHGVP+HP P L+FL+RV +    + GPI+ HCSAG+GRTGAFIVID MLERLRY+NTVDIY  VT +R+QR+YMVQTE+QYIFI++ +L+AV  G+TEVP   L  H+  L+Q      +AD  Q++G+ MEF +L                      T     +N CT         A    N+ KNR+L  +P D +RV +  + G +GSDYINASWIDGYK R AYIA Q+P +ET  DFWR +WEHNS I+ ML +  E  +E+   YWP++   +    +V+P+AEY+M  Y +REF+++D    + R +RQF F +W +    PH+   FLD + QVH T  Q G  GPI VHC +G+GRT +F+ALS I++RM+ E V+D+F TVKLLR +R  ++Q  +QY F Y+AA EYL  ++
Sbjct: 1646 VSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVL--------SNVEGYP---GMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG---TATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-----PSAD--QLSGIDMEFRHL----------------------TTLKWTSNRCT--------VANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGK-PHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 2221          

HSP 2 Score: 234.958 bits (598), Expect = 1.986e-61
Identity = 343/1518 (22.60%), Postives = 613/1518 (40.38%), Query Frame = 2
Query:  419 NAEKSNNQ--QRIILPLWKRSVDHNRQLDYTIIYKQK------PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN-QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGS-TDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN---LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNF-IKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKV-FVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT-QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG---MPSLVEC-TTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKIN-----IRI-YFQ---SKLGNF-SVQPSLQ-------------TIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYI-FANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVT-VEWK--EDIKNKKWIKGY----RLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDA-IRFIRLSQSTAQITWKWNP----DFLIHYSHFIIYYTNEKTF--LNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIW-KLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTEN-GTIDDYYVVV-------------------KVLKEKTRKL-RSVNLVDER-------TIGNLIQNSSFN-------RNEISNPYIAVSLKDELIFPISTPLKQVHK----IKIGENNINGQFKNWKLDPKFYYQFQIIAC----IRLKES 4663
            + E  +NQ  Q   +PL ++    N QL Y   Y+        P ++V++  +  V+ + +  F C  DGNP P + WR+N +S T   R S+  ++   S LR   V LDDN T ++C A N + +   + ASL+V   + ++P GFP I    S+   E+     + C+V+G P   + WL+D IP+D   + R + S  GN   L I   +E+D+G YEC+A N LG   S    L ++V+   P F  K+    +V  G ++ L C A+G P+P V+W+  +T L       T    +  + L+ +  +    CVA +   +I  + +V  +E    P  I V+ +   S  I+W      E   +Y V + +K  +   ++  T  T+ N          +  +  L+ F  Y   + S       ++S  V   T    P T P + +  S++  ++L+ W P + PNG+IT Y +YYT      P+  W ++  KS       +  T ++ +  ++ Y++ + AQNS G SP+S  + +  R G+   P      A  S  ++L WD     S V  + Y + Y   +    +KE     SP +  ++ G L P+  Y F+++  ++   G    P + +   + P + P IV     + +    +EI W+  PE+  K+N      RI YF+   SK  N  SV+                  + S      L ++    +Y++ +     +   P E S ++          P   +    ++T++++ W   +  +     Y + L     +R  + +P+ +   KK +     ++ + RY    +L P++EY   LN+  R   G   + + I T       P+ + + L    E P V  +EWK  +   N+  I+ Y    R + YP   +  +K K     V  +   T+    W G  Y+  +AA N        T+ I    GSP   P + + +         ++ +W   S+   NG    Y+     +                 +   +     Y  +V     K    +S  +      A    P   +R    S STA + W +       F++ Y H      + + +  L  + + K     F   ++  LNA   Y   V +V N   +GP SD     ++  S  P   +  L     +S  +QL W   +       F VN +G   +        +  + QE++      G +     +   H+ Y    +W  L+P+  YTI +     P           +  T    P  ++   L D + +     ++   P TE  G I  Y++++                   K   EK  +L RS+++   +        +G+  Q++S++       R  +   Y+   L  + +       KQ ++      +G++ +   F N+ L+   +Y+  + A     +R K+S
Sbjct:   49 DEEPPDNQDVQDGGIPLVRKEEFTNNQL-YAEAYQSYIQALAYPARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVP-RDKVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWK--KTDLMVLDDPSTAPIGKNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRSSRGKTMETLEN----------SLVIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSD------EFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPMLTVKALDSRRMQLTWDKPLYSSPV--VGYTVRY---NTSDGEKELTLT-SPHEKHVVTG-LHPDKYYYFRVAAYSDRGQGEFTEPMISKTIASIPLSSPTIVS---AAATSSKSVEIRWKG-PEQK-KLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGP-ESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYL-----DRMVNGEPVVEKGSKKRI--VMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRD-EPPVVARIEWKMPKMKPNETPIEKYNLWLRAQGYP---DSYVKAKT----VDGTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKG----KIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKENPKRF--AVVSDLNAHKPYAFCVLAVKNNR-QGPCSD---PPTVLESVTPTYMVQNLRVLWKTSNSVQLTW--EYNGPRNVGFYVNHTGRKDY--------VNHELQEKTMSTPGFGQD-----VDEKHREY----LWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQMIRLTPATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRV-------KQQYRNNQPFIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDS 1482          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 300/628 (47.77%), Postives = 407/628 (64.81%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + +  +P+  L+ H+  L+ N++  F  E+ESIE GQ FTW  S+ ++N+ KNRYANV AYDHSRV+L        SN    P   G DYINAN++ GY  P++YIATQGPL ET  DFWRM+WE+ S  IVM+T LEER R KCDQYWP  G    +T+  I VT+++ + LA+YT+R   ++ + +  VREI   Q+TAWPDHGVP+HP P L+FL+RV +    + GPI+ HCSAG+GRTGAFIVID MLERLRY+NTVDIY  VT +R+QR+YMVQTE+QYIFI++ +L+AV  G+TEVP   L  H+  L+Q      +AD  Q++G+ MEF +L                      T     +N CT         A    N+ KNR+L  +P D +RV +  + G +GSDYINASWIDGYK R AYIA Q+P +ET  DFWR +WEHNS I+ ML +  E  +E+   YWP++   +    +V+P+AEY+M  Y +REF+++D    + R +RQF F +W +    PH+   FLD + QVH T  Q G  GPI VHC +G+GRT +F+ALS I++RM+ E V+D+F TVKLLR +R  ++Q  +QY F Y+AA EYL  ++
Sbjct: 1649 VSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVL--------SNVEGYP---GMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRG---TATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQ-----PSAD--QLSGIDMEFRHL----------------------TTLKWTSNRCT--------VANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGK-PHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYD 2224          

HSP 2 Score: 234.572 bits (597), Expect = 2.540e-61
Identity = 332/1478 (22.46%), Postives = 597/1478 (40.39%), Query Frame = 2
Query:  515 KQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN-QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGS-TDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN---LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNF-IKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKV-FVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT-QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG---MPSLVEC-TTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKIN-----IRI-YFQ---SKLGNF-SVQPSLQ-------------TIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYI-FANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVT-VEWK--EDIKNKKWIKGY----RLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDA-IRFIRLSQSTAQITWKWNP----DFLIHYSHFIIYYTNEKTF--LNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIW-KLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTEN-GTIDDYYVVV-------------------KVLKEKTRKL-RSVNLVDER-------TIGNLIQNSSFN-------RNEISNPYIAVSLKDELIFPISTPLKQVHK----IKIGENNINGQFKNWKLDPKFYYQFQIIAC----IRLKES 4663
            +  P ++V++  +  V+ + +  F C  DGNP P + WR+N +S T   R S+  ++   S LR   V LDDN T ++C A N + +   + ASL+V   + ++P GFP I    S+   E+     + C+V+G P   + WL+D IP+D   + R + S  GN   L I   +E+D+G YEC+A N LG   S    L ++V+   P F  K+    +V  G ++ L C A+G P+P V+W+  +T L       T    +  + L+ +  +    CVA +   +I  + +V  +E    P  I V+ +   S  I+W      E   +Y V + +K  +   ++  T  T+ N          +  +  L+ F  Y   + S       ++S  V   T    P T P + +  S++  ++L+ W P + PNG+IT Y +YYT      P+  W ++  KS       +  T ++ +  ++ Y++ + AQNS G SP+S  + +  R G+   P      A  S  ++L WD     S V  + Y + Y   +    +KE     SP +  ++ G L P+  Y F+++  ++   G    P + +   + P + P IV     + +    +EI W+  PE+  K+N      RI YF+   SK  N  SV+                  + S      L ++    +Y++ +     +   P E S ++          P   +    ++T++++ W   +  +     Y + L     +R  + +P+ +   KK +     ++ + RY    +L P++EY   LN+  R   G   + + I T       P+ + + L    E P V  +EWK  +   N+  I+ Y    R + YP   +  +K K     V  +   T+    W G  Y+  +AA N        T+ I    GSP   P + + +         ++ +W   S+   NG    Y+     +                 +   +     Y  +V     K    +S  +      A    P   +R    S STA + W +       F++ Y H      + + +  L  + + K     F   ++  LNA   Y   V +V N   +GP SD     ++  S  P   +  L     +S  +QL W   +       F VN +G   +        +  + QE++      G +     +   H+ Y    +W  L+P+  YTI +     P           +  T    P  ++   L D + +     ++   P TE  G I  Y++++                   K   EK  +L RS+++   +        +G+  Q++S++       R  +   Y+   L  + +       KQ ++      +G++ +   F N+ L+   +Y+  + A     +R K+S
Sbjct:   91 EDDPARLVVRPDSSTVVDESKISFFCRADGNPLPSVIWRVNGKSITDHNRISIKSLATGLSTLRFERVSLDDNATVVSCSADNGVANPVVAEASLTVVP-RDKVPIGFPQIELHPSLKSVEQGKTAYVSCRVRGDPRAKVLWLRDLIPLDIRADGRYSVSTIGNPGALMIQHAREEDQGKYECIARNTLGVAHSKAANLYVKVRRVPPYFSYKLERQYVVGVGGNINLTCVAVGYPMPRVFWK--KTDLMVLDDPSTAPIGKNVLTLTHVESTENFTCVAVSALGNIEATTTVIAKELPPPPVNIVVSSVTSESVVITWKPPKYNEAINKYVVNYRLKYSEGRSSRGKTMETLEN----------SLVIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSILVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSD------EFMTTINGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPMLTVKALDSRRMQLTWDKPLYSSPV--VGYTVRY---NTSDGEKELTLT-SPHEKHVVTG-LHPDKYYYFRVAAYSDRGQGEFTEPMISKTIASIPLSSPTIVS---AAATSSKSVEIRWKG-PEQK-KLNGVLTAYRINYFRLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGP-ESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYL-----DRMVNGEPVVEKGSKKRI--VMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRD-EPPVVARIEWKMPKMKPNETPIEKYNLWLRAQGYP---DSYVKAKT----VDGTDLSTTISGLWMGVVYDVLLAAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKG----KIVVSWRPPSEEKRNGNITSYKAILSAMDATADRYEQPVPAPSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVVSIDKENPKRF--AVVSDLNAHKPYAFCVLAVKNNR-QGPCSD---PPTVLESVTPTYMVQNLRVLWKTSNSVQLTW--EYNGPRNVGFYVNHTGRKDY--------VNHELQEKTMSTPGFGQD-----VDEKHREY----LWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQPGQQMIRLTPATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSVSPSKKLKRKASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRV-------KQQYRNNQPFIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDS 1485          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 719.153 bits (1855), Expect = 0.000e+0
Identity = 347/631 (54.99%), Postives = 436/631 (69.10%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFE---NLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIP+   + H+  LK ND++ F++EYESIEPGQQFTW+ SN+E N+ KNRYANV AYDHSRV L P  +           V GSDYINAN+  GY    AY+ATQGPL ET  DFWRM WE  ++ IVMMTRLEER R KCDQYWP  G     T+  I VTI +  ELA Y+IR F + +   N+ REI Q QFTAWPDHGVP+HPAP L FLRR  +      GP++VHCSAGVGRTG +IVID MLER+++E  +DIY +VT +R+QRNYMVQTEDQYIFI++ +LEA+ CG TEVP   L  H++KL        T  G  ++G+++EF+   N+ + S  F+                                 TA   CN+ KNR++ ILP + SRV + PI G+EGSDY+NAS+IDGY+ R AYIAAQ P+ +  EDFWR LWEHNS+IVVMLT+LKE  RE+ FQYWP +RS RYQ+++VDP+AEYNM  Y +REFK+TD RD  SR +RQFQF DW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GR+G+F+ LS ++ERM+ E V+D+FQTV++LR QRPA++QTEDQY FCY AALEYL  F+
Sbjct: 1347 ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQL-PAVEG----------VVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG---TETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL------LITEPGETISGMEVEFKKLSNVKMDSSKFV---------------------------------TANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 1923          

HSP 2 Score: 248.825 bits (634), Expect = 1.296e-65
Identity = 187/648 (28.86%), Postives = 309/648 (47.69%), Query Frame = 2
Query:  503 TIIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN--QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGD-QIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY 2431
            TI+    PP+I+ K +N  V     A F CA  G+P P I WR N  +      R++V +     S+LRI PV+   +     C+A+N +G +  + A+L++Y   +  P+GFP I       V E    V++ CK  G PT  I+W+K+   +D  N R +  K+G L+I  ++E+D+G YECVA N++GT  S    L ++V+   P F +       V  GS++ L C A+G+P+P V W  G   L  +++   G+    NV+ L ++ ES    C+A +    I     V +Q   T PT ++++ +   S  + W+ K    E L+Y V   K K+     +  SG I     + Y  V+      L P+T Y  ++ + +       S   T TT      + P+NV++ ++S+  ++ITW+PP+ PNG +T Y +YYT   ++P +SW+   V +S       + T +S +  +  Y + + A  S G+ P+S P+ +  + GV   P +FRA     T + L W + P+ S  NI++Y L Y   +  +    KR   S       +  L P+T Y   L+  +    G  +      T +  P   ++   +      I + W+   EK+    IR Y
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDK-TPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR----NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK--GPEDLQYYVIQYKPKNANQAFSEISGII-----TMYYVVRA-----LSPYTEYEFYVIAVNNIGRGPPSAPATCTTEM---ESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNS-------ELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQW-TKPTHSSENIVHYEL-YWNDTYANQAHHKRISNS---EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGY 642          

HSP 3 Score: 147.132 bits (370), Expect = 1.195e-34
Identity = 285/1379 (20.67%), Postives = 537/1379 (38.94%), Query Frame = 2
Query:  896 CKVQGVPTLTIFWLKDSIPIDFENQRINT-SKNGNLEIIRTQE----DDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKV----SGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKN---IKESISRSISVTIQE-PSTV---PTAIRVTYIGPN---SCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITW---DPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTIL--IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSK--INIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSK---------EAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQ-GFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK--WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYY-VVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISN-PYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNK-----PNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRR 4897
            C  +G P  +I W K+   +     R     + G + I+R +      D+  YECVA N +G  VS+   L I     +P    V     G +++  G +V + C+A+GNP P +YW   QT +   +   + +     +  S   +  K  CVA+N    + S + ++ V ++  P T    P  I    +G N   SC    +  P   ++++    +    +  + +N+    +IN+++S                 NYT    S   Q DS+           LP  T P +V++  ++  +V + W    P D+          Y  Q+K K  +         S+ S       ++  ++  T Y   + A N+ G  P S P        +   P++ +    SS+ + + W+  P      +  Y + Y   S    + E  ++     N+ L  +  L P+  Y  ++   T+   G  S        +  P    N+  +      + + W + P  +S+  ++  +Y+     N   Q   + I +   Y  L  +  +  Y + +  + +  +        + TK  V   DP +V    +NST+I V W+    K +          A+  R +  G+       N+P K   +            T+ +    L PD++Y I + ++TR+  G    +  +KT P  +P    + L++        + +EW+   +    ++GYRLR+   V++  +K ++L    S  +     FD+ + G  Y F+VA  N   +G E        EG+P   PSN  ++     +P  +  TW+  ++   NG    Y+V  F    ++   +            NL+E++ Y  RVR + ++    +SD +  +T      AP +++    S+ TA+I W+   +   L+ Y    I+YT         W  K+   T +  +++ L     Y + +++    G+ G +S+ +     T    P      L    VS+  + L W    ++  + +++++F  +  F    G          Q+ +V      + +L  +       +H I +L P T Y + +  I S + +    +  T+ +        ++      +N    +I ++L + + E G I  YY VVV   K    K+    L D+   G        N+ E  N PYIA       I P +          +G  +    F N KL+ +  Y+  + A +   +         SSP++  +++       G +     PN+  +  VS N  +  P       V+ ++    +    + +  +VKRRR
Sbjct:   57 CAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMP-HVKWMKGSEDLTPENEMPIGRNVLQ--LINIQES----------------ANYTCIAASTLGQIDSVS----VVKVQSLP--TAPTDVQISEVTATSVRLEWSYKGPEDL--------QYYVIQYKPKNANQ------AFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTE--MESAPRNVQVRTLSSSTMVITWEP-PETPNGQVTGYKVYYTTNSN---QPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTK-PTHSSENIVHYELYWNDTYAN---QAHHKRISNSEAYT-LDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYV-PGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFL------NEPFKFDVVD-----------TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWG--VKDQALKEEML----SGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQ---TPDVLCVTWDPPTREHRNGIITRYDVQ-FHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYK---IFYTMTAVEDLDDWQTKTVGLTESADLVN-LEKFAQYAVAIAARFKNGL-GRLSEKV-----TVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGF--------SQTQIVPK---REIILKHYVK-----THTINELSPFTTYNVNVSAIPS-DYSYRPPTKITVTTQMAAPQPMVKPDFYGVVN--GEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGR-------NKPERPNAPYIAAKFPQRSI-PFT--------FHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH----LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL--WVVLPLMVSTFIVSTALIVLCVVKRRR 1304          

HSP 4 Score: 100.523 bits (249), Expect = 1.630e-20
Identity = 139/603 (23.05%), Postives = 246/603 (40.80%), Query Frame = 2
Query:  581 IFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGF---PTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPI-REEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKE-KRFDYSPQKNTIL------IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPM 2329
            +  C   GNP+P I W  NQ+       S  + S K   L+I   + +D + +  C+A+NS+G+  S A+ ++Y   + +P  F   P  IS+  +  N     + L C   G P   + W+K S  +  EN+ +   +N  L++I  QE     Y C+A + LG +  SV  + ++    +P  +++S    VT  +SV L+    G    + Y      ++Q + KN     +E + I         LS  +E    +    NI      + +    E  + P  ++V  +  ++  I+W        +   YKV+      +  N N    +  +    + E     ++  L P   YTV +++++       S  V     +  P + P N     I   AV + W  P   +  I  Y +Y+           D Y  ++  K  S  +   L  +  +T YYI ++A++  G    + P+ +  +  V   P+  +A   +ST I + W     K +  II  Y ++       L+ E K F   P K  ++      +  LQP+T Y  Q++ +T   +G  S      TP   P+
Sbjct:  158 LMTCKAIGNPTPNIYWIKNQTKV---DMSNPRYSLKDGFLQIENSREED-QGKYECVAENSMGTEHSKAT-NLYVKVRRVPPTFSRPPETISEVMLGSN-----LNLSCIAVGSPMPHVKWMKGSEDLTPENE-MPIGRN-VLQLINIQES--ANYTCIAASTLGQI-DSVSVVKVQSLPTAPTDVQISE---VT-ATSVRLEWSYKGPEDLQYY------VIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVY------YTTNSNQPEASWNSQMVDNSELT---TVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVP-SQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELYWN----------DTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIH----AQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPV 711          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 347/631 (54.99%), Postives = 436/631 (69.10%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFE---NLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIP+   + H+  LK ND++ F++EYESIEPGQQFTW+ SN+E N+ KNRYANV AYDHSRV L P  +           V GSDYINAN+  GY    AY+ATQGPL ET  DFWRM WE  ++ IVMMTRLEER R KCDQYWP  G     T+  I VTI +  ELA Y+IR F + +   N+ REI Q QFTAWPDHGVP+HPAP L FLRR  +      GP++VHCSAGVGRTG +IVID MLER+++E  +DIY +VT +R+QRNYMVQTEDQYIFI++ +LEA+ CG TEVP   L  H++KL        T  G  ++G+++EF+   N+ + S  F+                                 TA   CN+ KNR++ ILP + SRV + PI G+EGSDY+NAS+IDGY+ R AYIAAQ P+ +  EDFWR LWEHNS+IVVMLT+LKE  RE+ FQYWP +RS RYQ+++VDP+AEYNM  Y +REFK+TD RD  SR +RQFQF DW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GR+G+F+ LS ++ERM+ E V+D+FQTV++LR QRPA++QTEDQY FCY AALEYL  F+
Sbjct: 1449 ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQL-PAVEG----------VVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG---TETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL------LITEPGETISGMEVEFKKLSNVKMDSSKFV---------------------------------TANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 2025          

HSP 2 Score: 339.732 bits (870), Expect = 1.925e-93
Identity = 369/1495 (24.68%), Postives = 642/1495 (42.94%), Query Frame = 2
Query:  503 TIIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN--QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGD-QIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECTT--TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY--FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSK---------EAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQ-GFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK--WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYY-VVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISN-PYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNK-----PNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRR 4897
            TI+    PP+I+ K +N  V     A F CA  G+P P I WR N  +      R++V +     S+LRI PV+   +     C+A+N +G +  + A+L++Y   +  P+GFP I       V E    V++ CK  G PT  I+W+K+   +D  N R +  K+G L+I  ++E+D+G YECVA N++GT  S    L ++V+   P F +       V  GS++ L C A+G+P+P V W  G   L  +++   G+    NV+ L ++ ES    C+A +    I     V +Q   T PT ++++ +   S  + W+ K    E L+Y V   K K+     +  SG I     + Y  V+      L P+T Y  ++ + +       S   T TT E    + P+NV++ ++S+  ++ITW+PP+ PNG +T Y +YYT   ++P +SW+   V +S       + T +S +  +  Y + + A  S G+ P+S P+ +  + GV   P +FRA     T + L W + P+ S  NI++Y L Y   +  +    KR   S       +  L P+T Y   L+  +    G   P +   T    P A P   +N     +    I + W   P + S   I  Y  F  ++G    + +  T+   M    L E+K+   YK+ ++        P  H   + T+  V   DP +V    +NST+I V W+    K +          A+  R +  G+       N+P K   +            T+ +    L PD++Y I + ++TR+  G    +  +KT P  +P    + L++        + +EW+   +    ++GYRLR+   V++  +K ++L    S  +     FD+ + G  Y F+VA  N   +G E        EG+P   PSN  ++     +P  +  TW+  ++   NG    Y+V  F    ++   +            NL+E++ Y  RVR + ++    +SD +  +T      AP +++    S+ TA+I W+   +   L+ Y    I+YT         W  K+   T +  +++ L     Y + +++    G+ G +S+ +     T    P      L    VS+  + L W    ++  + +++++F  +  F    G          Q+ +V      + +L  +       +H I +L P T Y + +  I  P+            +T    P  +       +  +  +I ++L + + E G I  YY VVV   K    K+    L D+   G        N+ E  N PYIA       I P +          +G  +    F N KL+ +  Y+  + A +   +         SSP++  +++       G +     PN+  +  VS N  +  P       V+ ++    +    + +  +VKRRR
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDK-TPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR----NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK--GPEDLQYYVIQYKPKNANQAFSEISGII-----TMYYVVRA-----LSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNS-------ELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQW-TKPTHSSENIVHYEL-YWNDTYANQAHHKRISNS---EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPP---RNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTL--NMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDV-PGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFL------NEPFKFDVVD-----------TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWG--VKDQALKEEML----SGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQ---TPDVLCVTWDPPTREHRNGIITRYDVQ-FHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYK---IFYTMTAVEDLDDWQTKTVGLTESADLVN-LEKFAQYAVAIAARFKNGL-GRLSEKV-----TVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGF--------SQTQIVPK---REIILKHYVK-----THTINELSPFTTYNVNVSAI--PSDYSYRPPTKITVTTQMAAPQPMVKPDFYGV-VNGEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGR-------NKPERPNAPYIAAKFPQRSI-PFT--------FHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH----LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL--WVVLPLMVSTFIVSTALIVLCVVKRRR 1406          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 347/631 (54.99%), Postives = 436/631 (69.10%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFE---NLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIP+   + H+  LK ND++ F++EYESIEPGQQFTW+ SN+E N+ KNRYANV AYDHSRV L P  +           V GSDYINAN+  GY    AY+ATQGPL ET  DFWRM WE  ++ IVMMTRLEER R KCDQYWP  G     T+  I VTI +  ELA Y+IR F + +   N+ REI Q QFTAWPDHGVP+HPAP L FLRR  +      GP++VHCSAGVGRTG +IVID MLER+++E  +DIY +VT +R+QRNYMVQTEDQYIFI++ +LEA+ CG TEVP   L  H++KL        T  G  ++G+++EF+   N+ + S  F+                                 TA   CN+ KNR++ ILP + SRV + PI G+EGSDY+NAS+IDGY+ R AYIAAQ P+ +  EDFWR LWEHNS+IVVMLT+LKE  RE+ FQYWP +RS RYQ+++VDP+AEYNM  Y +REFK+TD RD  SR +RQFQF DW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GR+G+F+ LS ++ERM+ E V+D+FQTV++LR QRPA++QTEDQY FCY AALEYL  F+
Sbjct: 1355 ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQL-PAVEG----------VVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG---TETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL------LITEPGETISGMEVEFKKLSNVKMDSSKFV---------------------------------TANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 1931          

HSP 2 Score: 248.054 bits (632), Expect = 2.545e-65
Identity = 187/653 (28.64%), Postives = 310/653 (47.47%), Query Frame = 2
Query:  503 TIIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN--QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGD-QIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELP-----PYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY 2431
            TI+    PP+I+ K +N  V     A F CA  G+P P I WR N  +      R++V +     S+LRI PV+   +     C+A+N +G +  + A+L++Y   +  P+GFP I       V E    V++ CK  G PT  I+W+K+   +D  N R +  K+G L+I  ++E+D+G YECVA N++GT  S    L ++V+   P F +       V  GS++ L C A+G+P+P V W  G   L  +++   G+    NV+ L ++ ES    C+A +    I     V +Q   T PT ++++ +   S  + W+ K    E L+Y V   K K+     +  SG I     + Y  V+      L P+T Y  ++ + +       S   T TT +         + P+NV++ ++S+  ++ITW+PP+ PNG +T Y +YYT   ++P +SW+   V +S       + T +S +  +  Y + + A  S G+ P+S P+ +  + GV   P +FRA     T + L W + P+ S  NI++Y L Y   +  +    KR   S       +  L P+T Y   L+  +    G  +      T +  P   ++   +      I + W+   EK+    IR Y
Sbjct:   28 TIVDAAHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDK-TPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR----NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK--GPEDLQYYVIQYKPKNANQAFSEISGII-----TMYYVVRA-----LSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNS-------ELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQW-TKPTHSSENIVHYEL-YWNDTYANQAHHKRISNS---EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGY 650          

HSP 3 Score: 144.436 bits (363), Expect = 9.272e-34
Identity = 285/1385 (20.58%), Postives = 537/1385 (38.77%), Query Frame = 2
Query:  896 CKVQGVPTLTIFWLKDSIPIDFENQRINT-SKNGNLEIIRTQE----DDEGGYECVATNNLGTVVSSVIRLMI----RVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKN---IKESISRSISVTIQE-PSTV---PTAIRVTYIGPN---SCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITW---DPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG------PKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTIL--IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSK--INIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSK---------EAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQ-GFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK--WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYY-VVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISN-PYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNK-----PNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRR 4897
            C  +G P  +I W K+   +     R     + G + I+R +      D+  YECVA N +G  VS+   L I    +     P   +  G +++  G +V + C+A+GNP P +YW   QT +   +   + +     +  S   +  K  CVA+N    + S + ++ V ++  P T    P  I    +G N   SC    +  P   ++++    +    +  + +N+    +IN+++S                 NYT    S   Q DS+           LP  T P +V++  ++  +V + W    P D+          Y  Q+K K  +         S+ S       ++  ++  T Y   + A N+ G  P S P           G      P++ +    SS+ + + W+  P      +  Y + Y   S    + E  ++     N+ L  +  L P+  Y  ++   T+   G  S        +  P    N+  +      + + W + P  +S+  ++  +Y+     N   Q   + I +   Y  L  +  +  Y + +  + +  +        + TK  V   DP +V    +NST+I V W+    K +          A+  R +  G+       N+P K   +            T+ +    L PD++Y I + ++TR+  G    +  +KT P  +P    + L++        + +EW+   +    ++GYRLR+   V++  +K ++L    S  +     FD+ + G  Y F+VA  N   +G E        EG+P   PSN  ++     +P  +  TW+  ++   NG    Y+V  F    ++   +            NL+E++ Y  RVR + ++    +SD +  +T      AP +++    S+ TA+I W+   +   L+ Y    I+YT         W  K+   T +  +++ L     Y + +++    G+ G +S+ +     T    P      L    VS+  + L W    ++  + +++++F  +  F    G          Q+ +V      + +L  +       +H I +L P T Y + +  I S + +    +  T+ +        ++      +N    +I ++L + + E G I  YY VVV   K    K+    L D+   G        N+ E  N PYIA       I P +          +G  +    F N KL+ +  Y+  + A +   +         SSP++  +++       G +     PN+  +  VS N  +  P       V+ ++    +    + +  +VKRRR
Sbjct:   57 CAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMP-HVKWMKGSEDLTPENEMPIGRNVLQ--LINIQES----------------ANYTCIAASTLGQIDSVS----VVKVQSLP--TAPTDVQISEVTATSVRLEWSYKGPEDL--------QYYVIQYKPKNANQ------AFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEP-PETPNGQVTGYKVYYTTNSN---QPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTK-PTHSSENIVHYELYWNDTYAN---QAHHKRISNSEAYT-LDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYV-PGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFL------NEPFKFDVVD-----------TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWG--VKDQALKEEML----SGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQ---TPDVLCVTWDPPTREHRNGIITRYDVQ-FHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYK---IFYTMTAVEDLDDWQTKTVGLTESADLVN-LEKFAQYAVAIAARFKNGL-GRLSEKV-----TVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGF--------SQTQIVPK---REIILKHYVK-----THTINELSPFTTYNVNVSAIPS-DYSYRPPTKITVTTQMAAPQPMVKPDFYGVVN--GEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGR-------NKPERPNAPYIAAKFPQRSI-PFT--------FHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH----LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL--WVVLPLMVSTFIVSTALIVLCVVKRRR 1312          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331242)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 347/631 (54.99%), Postives = 436/631 (69.10%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFE---NLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIP+   + H+  LK ND++ F++EYESIEPGQQFTW+ SN+E N+ KNRYANV AYDHSRV L P  +           V GSDYINAN+  GY    AY+ATQGPL ET  DFWRM WE  ++ IVMMTRLEER R KCDQYWP  G     T+  I VTI +  ELA Y+IR F + +   N+ REI Q QFTAWPDHGVP+HPAP L FLRR  +      GP++VHCSAGVGRTG +IVID MLER+++E  +DIY +VT +R+QRNYMVQTEDQYIFI++ +LEA+ CG TEVP   L  H++KL        T  G  ++G+++EF+   N+ + S  F+                                 TA   CN+ KNR++ ILP + SRV + PI G+EGSDY+NAS+IDGY+ R AYIAAQ P+ +  EDFWR LWEHNS+IVVMLT+LKE  RE+ FQYWP +RS RYQ+++VDP+AEYNM  Y +REFK+TD RD  SR +RQFQF DW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GR+G+F+ LS ++ERM+ E V+D+FQTV++LR QRPA++QTEDQY FCY AALEYL  F+
Sbjct: 1361 ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQL-PAVEG----------VVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG---TETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL------LITEPGETISGMEVEFKKLSNVKMDSSKFV---------------------------------TANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 1937          

HSP 2 Score: 247.669 bits (631), Expect = 3.079e-65
Identity = 187/647 (28.90%), Postives = 308/647 (47.60%), Query Frame = 2
Query:  506 IIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN--QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGD-QIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY 2431
            I Y   PP+I+ K +N  V     A F CA  G+P P I WR N  +      R++V +     S+LRI PV+   +     C+A+N +G +  + A+L++Y   +  P+GFP I       V E    V++ CK  G PT  I+W+K+   +D  N R +  K+G L+I  ++E+D+G YECVA N++GT  S    L ++V+   P F +       V  GS++ L C A+G+P+P V W  G   L  +++   G+    NV+ L ++ ES    C+A +    I     V +Q   T PT ++++ +   S  + W+ K    E L+Y V   K K+     +  SG I     + Y  V+      L P+T Y  ++ + +       S   T TT      + P+NV++ ++S+  ++ITW+PP+ PNG +T Y +YYT   ++P +SW+   V +S       + T +S +  +  Y + + A  S G+ P+S P+ +  + GV   P +FRA     T + L W + P+ S  NI++Y L Y   +  +    KR   S       +  L P+T Y   L+  +    G  +      T +  P   ++   +      I + W+   EK+    IR Y
Sbjct:   43 IQYLTHPPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDK-TPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR----NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK--GPEDLQYYVIQYKPKNANQAFSEISGII-----TMYYVVRA-----LSPYTEYEFYVIAVNNIGRGPPSAPATCTTEM---ESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNS-------ELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQW-TKPTHSSENIVHYEL-YWNDTYANQAHHKRISNS---EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGY 656          

HSP 3 Score: 146.747 bits (369), Expect = 1.505e-34
Identity = 285/1379 (20.67%), Postives = 534/1379 (38.72%), Query Frame = 2
Query:  896 CKVQGVPTLTIFWLKDSIPIDFENQRINT-SKNGNLEIIRTQE----DDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKV----SGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKN---IKESISRSISVTIQE-PSTV---PTAIRVTYIGPN---SCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITW---DPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTIL--IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSK--INIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSK---------EAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQ-GFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK--WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYY-VVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISN-PYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNK-----PNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRR 4897
            C  +G P  +I W K+   +     R     + G + I+R +      D+  YECVA N +G  VS+   L I     +P    V     G +++  G +V + C+A+GNP P +YW   QT +   +   + +     +  S   +  K  CVA+N    + S + ++ V ++  P T    P  I    +G N   SC    +  P   ++++    +    +  + +N+    +IN+++S                 NYT    S   Q DS+           LP  T P +V++  ++  +V + W    P D+          Y  Q+K K  +         S+ S       ++  ++  T Y   + A N+ G  P S P        +   P++ +    SS+ + + W+  P      +  Y + Y   S    + E  ++     N+ L  +  L P+  Y  ++   T+   G  S        +  P    N+  +      + + W + P  +S+  ++  +Y+     N   Q   + I +   Y  L  +  +  Y + +  + +  +        + TK  V   DP +V    +NST+I V W+    K +          A+  R +  G+       N+P K   +            T+ +    L PD++Y I + ++TR+  G    +  +KT P  +P    + L++        + +EW+   +    ++GYRLR+   V++  +K ++L    S  +     FD+ + G  Y F+VA  N   +G E        EG+P   PSN  ++     +P  +  TW+  ++   NG    Y+V  F    ++   +            NL+E++ Y  RVR + ++    +SD +  +T      AP +++    S+ TA+I W+   +   L+ Y    I+YT         W  K+   T +  +++ L     Y + +++    G+ G +S+ +     T    P      L    VS+  + L W    ++  + +++++F  +  F    G          Q+ +V      + +L  +       +H I +L P T Y + +  I  P+            +T    P  +       +  +  +I ++L + + E G I  YY VVV   K    K+    L D+   G        N+ E  N PYIA       I P +          +G  +    F N KL+ +  Y+  + A +   +         SSP++  +++       G +     PN+  +  VS N  +  P       V+ ++    +    + +  +VKRRR
Sbjct:   71 CAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMP-HVKWMKGSEDLTPENEMPIGRNVLQ--LINIQES----------------ANYTCIAASTLGQIDSVS----VVKVQSLP--TAPTDVQISEVTATSVRLEWSYKGPEDL--------QYYVIQYKPKNANQ------AFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTE--MESAPRNVQVRTLSSSTMVITWEP-PETPNGQVTGYKVYYTTNSN---QPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTK-PTHSSENIVHYELYWNDTYAN---QAHHKRISNSEAYT-LDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYV-PGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFL------NEPFKFDVVD-----------TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWG--VKDQALKEEML----SGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQ---TPDVLCVTWDPPTREHRNGIITRYDVQ-FHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYK---IFYTMTAVEDLDDWQTKTVGLTESADLVN-LEKFAQYAVAIAARFKNGL-GRLSEKV-----TVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGF--------SQTQIVPK---REIILKHYVK-----THTINELSPFTTYNVNVSAI--PSDYSYRPPTKITVTTQMAAPQPMVKPDFYGV-VNGEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGR-------NKPERPNAPYIAAKFPQRSI-PFT--------FHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH----LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL--WVVLPLMVSTFIVSTALIVLCVVKRRR 1318          

HSP 4 Score: 100.523 bits (249), Expect = 1.662e-20
Identity = 140/604 (23.18%), Postives = 248/604 (41.06%), Query Frame = 2
Query:  581 IFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGF---PTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWN--QKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKE-KRFDYSPQKNTIL------IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPM 2329
            +  C   GNP+P I W  NQ+       S  + S K   L+I   + +D + +  C+A+NS+G+  S A+ ++Y   + +P  F   P  IS+  +  N     + L C   G P   + W+K S  +  EN+ +   +N  L++I  QE     Y C+A + LG +  SV  + ++    +P  +++S    VT  +SV L+    G    + Y      ++Q + KN     +E + I         LS  +E    +    NI      + +    E  + P  ++V  +  ++  I+W   + P   +   YKV+      +  N N    +  +    + E     ++  L P   YTV +++++       S  V     +  P + P N     I   AV + W  P   +  I  Y +Y+           D Y  ++  K  S  +   L  +  +T YYI ++A++  G    + P+ +  +  V   P+  +A   +ST I + W     K +  II  Y ++       L+ E K F   P K  ++      +  LQP+T Y  Q++ +T   +G  S      TP   P+
Sbjct:  172 LMTCKAIGNPTPNIYWIKNQTKV---DMSNPRYSLKDGFLQIENSREED-QGKYECVAENSMGTEHSKAT-NLYVKVRRVPPTFSRPPETISEVMLGSN-----LNLSCIAVGSPMPHVKWMKGSEDLTPENE-MPIGRN-VLQLINIQES--ANYTCIAASTLGQI-DSVSVVKVQSLPTAPTDVQISE---VT-ATSVRLEWSYKGPEDLQYY------VIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETP-NGQVTGYKVY------YTTNSNQPEASWNSQMVDNSELT---TVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVP-SQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELYWN----------DTYANQAHHKRISNSEAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIH----AQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPV 725          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0112800)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 347/631 (54.99%), Postives = 436/631 (69.10%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFE---NLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIP+   + H+  LK ND++ F++EYESIEPGQQFTW+ SN+E N+ KNRYANV AYDHSRV L P  +           V GSDYINAN+  GY    AY+ATQGPL ET  DFWRM WE  ++ IVMMTRLEER R KCDQYWP  G     T+  I VTI +  ELA Y+IR F + +   N+ REI Q QFTAWPDHGVP+HPAP L FLRR  +      GP++VHCSAGVGRTG +IVID MLER+++E  +DIY +VT +R+QRNYMVQTEDQYIFI++ +LEA+ CG TEVP   L  H++KL        T  G  ++G+++EF+   N+ + S  F+                                 TA   CN+ KNR++ ILP + SRV + PI G+EGSDY+NAS+IDGY+ R AYIAAQ P+ +  EDFWR LWEHNS+IVVMLT+LKE  RE+ FQYWP +RS RYQ+++VDP+AEYNM  Y +REFK+TD RD  SR +RQFQF DW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GR+G+F+ LS ++ERM+ E V+D+FQTV++LR QRPA++QTEDQY FCY AALEYL  F+
Sbjct: 1431 ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQL-PAVEG----------VVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWPTRG---TETYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKL------LITEPGETISGMEVEFKKLSNVKMDSSKFV---------------------------------TANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFD 2007          

HSP 2 Score: 337.421 bits (864), Expect = 1.030e-92
Identity = 367/1488 (24.66%), Postives = 639/1488 (42.94%), Query Frame = 2
Query:  524 PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN--QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGD-QIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECTT--TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY--FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSK---------EAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQ-GFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK--WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYY-VVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISN-PYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNK-----PNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRR 4897
            PP+I+ K +N  V     A F CA  G+P P I WR N  +      R++V +     S+LRI PV+   +     C+A+N +G +  + A+L++Y   +  P+GFP I       V E    V++ CK  G PT  I+W+K+   +D  N R +  K+G L+I  ++E+D+G YECVA N++GT  S    L ++V+   P F +       V  GS++ L C A+G+P+P V W  G   L  +++   G+    NV+ L ++ ES    C+A +    I     V +Q   T PT ++++ +   S  + W+ K    E L+Y V   K K+     +  SG I     + Y  V+      L P+T Y  ++ + +       S   T TT E    + P+NV++ ++S+  ++ITW+PP+ PNG +T Y +YYT   ++P +SW+   V +S       + T +S +  +  Y + + A  S G+ P+S P+ +  + GV   P +FRA     T + L W + P+ S  NI++Y L Y   +  +    KR   S       +  L P+T Y   L+  +    G   P +   T    P A P   +N     +    I + W   P + S   I  Y  F  ++G    + +  T+   M    L E+K+   YK+ ++        P  H   + T+  V   DP +V    +NST+I V W+    K +          A+  R +  G+       N+P K   +            T+ +    L PD++Y I + ++TR+  G    +  +KT P  +P    + L++        + +EW+   +    ++GYRLR+   V++  +K ++L    S  +     FD+ + G  Y F+VA  N   +G E        EG+P   PSN  ++     +P  +  TW+  ++   NG    Y+V  F    ++   +            NL+E++ Y  RVR + ++    +SD +  +T      AP +++    S+ TA+I W+   +   L+ Y    I+YT         W  K+   T +  +++ L     Y + +++    G+ G +S+ +     T    P      L    VS+  + L W    ++  + +++++F  +  F    G          Q+ +V      + +L  +       +H I +L P T Y + +  I  P+            +T    P  +       +  +  +I ++L + + E G I  YY VVV   K    K+    L D+   G        N+ E  N PYIA       I P +          +G  +    F N KL+ +  Y+  + A +   +         SSP++  +++       G +     PN+  +  VS N  +  P       V+ ++    +    + +  +VKRRR
Sbjct:   17 PPEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEGDK-TPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSL-KDGFLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSRPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGR----NVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK--GPEDLQYYVIQYKPKNANQAFSEISGII-----TMYYVVRA-----LSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNS-------ELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQW-TKPTHSSENIVHYEL-YWNDTYANQAHHKRISNS---EAYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPP---RNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTL--NMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDV-PGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFL------NEPFKFDVVD-----------TLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRWG--VKDQALKEEML----SGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQ---TPDVLCVTWDPPTREHRNGIITRYDVQ-FHKKIDHGLGSERNMTLRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYK---IFYTMTAVEDLDDWQTKTVGLTESADLVN-LEKFAQYAVAIAARFKNGL-GRLSEKV-----TVRIKPEDVPLNLRAHDVSTHSMTLSWSPPIRLTPV-NYKISFDAMKVFVDSQGF--------SQTQIVPK---REIILKHYVK-----THTINELSPFTTYNVNVSAI--PSDYSYRPPTKITVTTQMAAPQPMVKPDFYGV-VNGEEILVILPQASEEYGPISHYYLVVVPEDKSNLHKIPDQFLTDDLLPGR-------NKPERPNAPYIAAKFPQRSI-PFT--------FHLGSGDDYHNFTNRKLEREKRYRIFVRAVVDTPQKH----LYTSSPFSEFLSLDMREAPPGERPHRPDPNWPAEPEVSVNRNKDEPEIL--WVVLPLMVSTFIVSTALIVLCVVKRRR 1388          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 767.689 bits (1981), Expect = 0.000e+0
Identity = 367/627 (58.53%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN+N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q       + G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1219 EHPPISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDAVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PSAGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1794          

HSP 2 Score: 241.121 bits (614), Expect = 3.402e-63
Identity = 178/592 (30.07%), Postives = 270/592 (45.61%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM 2284
            P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NSLG  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D   N RI   ++G L+I  ++E D+G YECVATN+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L    +   G+    NV+ L+++ +S    CVA +    I  +  V+++     PT++ VT     S  ++W   N +P+    ++Y+    KT D             N ++ D       S+  L P++ Y   + + +       S  V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D PLS+W K+    S+        T +S +    TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W       Q  II Y L Y      + K    FD +    +  +  L+P+T Y+F L+  +    G+
Sbjct:   35 PNFVRSPEDQTGISGGVASFVCQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQ-IPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGR----NVLELTNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYIIQYRA---KTSD------------TNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSSPPLHVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSR-------LTTISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTWL---WPVQDPIIKYELQYWEADSDN-KIHVTFDPA---GSYAVEGLKPDTLYKFSLAARSEMGQGV 592          

HSP 3 Score: 114.39 bits (285), Expect = 1.333e-24
Identity = 206/924 (22.29%), Postives = 373/924 (40.37%), Query Frame = 2
Query:  896 CKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQ----EDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVS-GDQ--IVTPGSSVTLKCRALGNPIPEVYW---------QCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKN---IKESISRSISVTIQEP----STVPTAIRVTYIGPNSCNISWNQKPIREEYLRY---KVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYT-VWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSS--WDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKS----FRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGK-FNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            C+  G P   I W+K    +  +   +    +G+  ++R Q      DE  YEC ATN+LG + +S    ++        F  +  G Q  +V    + T+ C A GNP PE+ W              I Q +S  L  + +E        S+  K  CVA N    + S   ++ V ++      S  PT   V   G  S N++         Y+++   +V + K ++  V +N+    + N+++S                TNYT V + S  M   + +      +   LP   PP ++ +   +  +V +TWD     +G     + Y  Q++ K   +   +   V +++ S        +  ++  + Y   + A N+ G  P SEP  +  R G  Q P S     +A   S++ + + W+  P +    I  Y + Y       L   ++ +    + T  I SL    TY  ++   T+  +G PS V    T +  P    +++        I + W   P ++  I   + +     +  +  +    GS      ++ +K +  YK  +  +    +    H  +  T  SV    P ++   A+NSTAI V W+   +  +  +   Y++ ++    N E    P + D+ +       E+Q      + A LA ++ Y + + + T +  G   K++ + T      KP  I   +S ++ N  + ++W+        + GYRLRY  L E +   Y++  R  S +    +  D  +G  Y+F ++A N   +G+E    I   E  PS FP N ++     L+ ++   TW   +    NG+  +Y  V+  + S +N    T  T    +TI  L+ D+ Y  RV+ +  K     S +I  +T
Sbjct:   56 CQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQIPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGALQIENSEE-------SDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGG--SVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGRNVLE--LTNIRQS----------------TNYTCVAISSLGMIEATAQ-----VSVKALP--KPPTSLTVTETTATSVTLTWD-----SGNPEPVSYYIIQYRAKTSDTNFQEVDGVATTRYS--------IGGLSPYSEYEFRVMAVNNIGRGPPSEP--VETRTGE-QAPSSPPLHVQARMLSASTMLVQWEP-PEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSRLTT-ISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTWL-WPVQDPIIKYELQYWEADSDNKIHVTFDPAGSYA----VEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQV-IYSRLENGEPRGHPNIMDVALP------EAQEA----VIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELMGYRLRYKRLEEEN---YEI--REFSRTDDHHTVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQV---VGLTTSTTRLTWEPPALSERNGRIIHYIVVYRDINSKQNS---TNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRT 896          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 365/631 (57.84%), Postives = 455/631 (72.11%), Query Frame = 2
Query: 5240 NRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            +R  E+ P+ V AL++H+  L+ NDS  F++EYES++PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP  G     T+  I V+++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E +VDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q         G  +T +++EF+ L              AN+ +H S                 + +A+  CN+ KNR++ I+P + SRV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PLSET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQT+K LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1331 SRMREHPPVSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRG---TETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQ------APPGDTVTAMELEFKKL--------------ANSKAHTSR----------------FISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1910          

HSP 2 Score: 289.656 bits (740), Expect = 6.001e-78
Identity = 277/1037 (26.71%), Postives = 450/1037 (43.39%), Query Frame = 2
Query:  509 IYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDF--ENQRI------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKF-NYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFP 3574
            I+    P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NS+G  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D    N RI       T   G L+I  ++E D+G YECVA N+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L  + +   G+    NV+ L+++ +S    CVA +    I  +  +T++     P ++ VT     S  ++W+      E + Y V   ++K   ++ N         ++ D       S+  L P++ Y   + + +       S +V   TSE  P +PP  V+   +S   +L+ W+PP+ PNG I  Y +YYT     PLS+W K+  + S         T +S +  + TY + + A  S G  P S+ L +  + GV   P  F A A+  T I L W   P + Q  I  Y L Y      + K    FD +    +  I SL+P+T Y+F L+  +    G+    +E  T   A     +   L       I++ W   P  +   +I  Y   +Q+  G    +  ++ I + +    L+ +++   Y V +         P   S +I T+  V    P  V    +NSTA+ V W+      ++ +H  I+ +    +R  + +P     I   ++  E+Q      + + L P++ Y + + + T +  G   K++ + T      KP  I   +S +I N  + ++W+   +    + GYRLRY      +E  Y V +   ++  F  +     +G  Y FK+ A N    G+E + +I   E  PS +P N K+     L+ T+    W+       NGK   Y  V+  + SH+N+   T  T    +TI  LK D+ Y  RVR +  K     S +I  +T     P
Sbjct:   27 IHADSMPSFVKTPEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEEDQ-IPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGGTPIRGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELTKEEEMPIGR----NVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTWDSG--NPEPVSYYVIQYRSK---ISDN-------GFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQKHNTEDSS-------LTTISGLVPDITYGLRVLAFTSVGDGPPSDILQVKTQQGVPAQPTGFEAEAELDTRIMLSW-LWPVQDQ--ITKYELTYWEADSDN-KHHVIFDPA---GSYAIDSLKPDTLYKFSLAARSEMGLGVYTQPIEARTAQSAPSAPPQEVHLISLSSSSIKVSWVAPPAASRHGSIVRYSLAYQAVSGEDQERHEVKDIPADVSSYVLEGLEKWTEYTVWVKAHTDVGPGPESGSTRIRTQEDVPGAPPRRVEVDNINSTALRVSWKP---PLQQKQHGHIRGYQVVYSRLENGEPRGQPIILD-VALPEAQEA----VISGLLPETTYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTIGNTAL-IQWQPPKEMVGELMGYRLRYK---REEEDIYTVRDFRRTDDHFTVTGLH--KGATYIFKLCAKNRAGNGEEYSKEISTPEDVPSSYPQNLKV---VGLTTTTTKLAWDPPPLPERNGKIVRYVVVYRDINSHQNQ---TNGTADTEMTIQGLKPDTTYDIRVRAFTGKGGGPISPSIQSRTMSTSMP 1009          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 367/627 (58.53%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN+N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q       + G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1305 EHPPISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDAVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PSAGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1880          

HSP 2 Score: 304.679 bits (779), Expect = 1.447e-82
Identity = 280/1033 (27.11%), Postives = 455/1033 (44.05%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN------LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGK-FNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NSLG  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D   N RI   ++G       L+I  ++E D+G YECVATN+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L    +   G+    NV+ L+++ +S    CVA +    I  +  V+++     PT++ VT     S  ++W   N +P+    ++Y+    KT D             N ++ D       S+  L P++ Y   + + +       S  V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D PLS+W K+    S+        T +S +    TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W   P   Q  II Y L Y      + K    FD +    +  +  L+P+T Y+F L+  +    G+    +E  T    P A P  V    LS +    I++ W   P  +    I  Y   +Q+  G  + +  +  IG+      L+ +++   Y+V +         P   + +I T   V    P ++   A+NSTAI V W+   +  +  +   Y++ ++    N E    P + D+ + +     E ++     + A LA ++ Y + + + T +  G   K++ + T      KP  I   +S ++ N  + ++W+        + GYRLRY  L E +   Y++  R  S +    +  D  +G  Y+F ++A N   +G+E    I   E  PS FP N ++     L+ ++   TW   +    NG+  +Y  V+  + S +N    T  T    +TI  L+ D+ Y  RV+ +  K     S +I  +T
Sbjct:    4 PNFVRSPEDQTGISGGVASFVCQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQ-IPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGGSPIRGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGR----NVLELTNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYIIQYRA---KTSD------------TNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSSPPLHVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSR-------LTTISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTW-LWP--VQDPIIKYELQYWEADSDN-KIHVTFDPA---GSYAVEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTS---IKVSWVAPPAASRHGAIVRYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPGPESTAVRIRTNEDVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQV-IYSRLENGEPRGHPNIMDVALPEAQWKIE-ESTEYEAVIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELMGYRLRYKRLEEEN---YEI--REFSRTDDHHTVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQV---VGLTTSTTRLTWEPPALSERNGRIIHYIVVYRDINSKQNS---TNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRT 982          

HSP 3 Score: 55.4546 bits (132), Expect = 1.257e-6
Identity = 75/350 (21.43%), Postives = 146/350 (41.71%), Query Frame = 2
Query: 1400 TAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFWDSLPSKSQVN--IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEK-NSKINIRIYF 2434
            TAIRVT+  P S       +  +  Y R +    +    +++  L        + ++YE V    +  L   T+Y+V + +++ + D  +S     TT+   P  P   + + +      LI W PP    G +  Y + Y + ++      + Y ++   ++D     T L   A   TY   +SA+N AG     E +  +  P  V    P + + +  +++   L W+  P+ S+ N  II+Y +VY       +  ++          + I  L+P+TTY+ ++   T+   G  S    + T    P    ++ +    +  + + W E+PE   S++  +I +
Sbjct:  698 TAIRVTWKPPLSGKQHGQIRGYQVIYSRLENGEPRGHPNIMDVALPEAQWKIEESTEYEAV----IAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKP--TMIISTTVGNTALIQWQPPKDMVGELMGYRLRYKRLEE------ENYEIREFSRTDDHHTVTDLHKGA---TYSFHLSARNRAGLG--EEYVKDIGTPEDVPSGFPLNLQVVGLTTSTTRLTWEP-PALSERNGRIIHYIVVYR-----DINSKQNSTNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRTMSTSPAFATSFGVKAVMKTSVLLTW-EVPENYKSQVPFKILY 1023          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 367/627 (58.53%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN+N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q       + G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1327 EHPPISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDAVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PSAGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1902          

HSP 2 Score: 303.138 bits (775), Expect = 4.534e-82
Identity = 280/1033 (27.11%), Postives = 453/1033 (43.85%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGN------LEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGK-FNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NSLG  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D   N RI   ++G       L+I  ++E D+G YECVATN+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L    +   G+    NV+ L+++ +S    CVA +    I  +  V+++     PT++ VT     S  ++W   N +P+    ++Y+    KT D             N ++ D       S+  L P++ Y   + + +       S  V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D PLS+W K+    S+        T +S +    TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W       Q  II Y L Y      + K    FD +    +  +  L+P+T Y+F L+  +    G+    +E  T    P A P  V    LS +    I++ W   P  +    I  Y   +Q+  G  + +  +  IG+      L+ +++   Y+V +         P   + +I T   V    P ++   A+NSTAI V W+   +  +  +   Y++ ++    N E    P + D+ +       E+Q      + A LA ++ Y + + + T +  G   K++ + T      KP  I   +S ++ N  + ++W+        + GYRLRY  L E +   Y++  R  S +    +  D  +G  Y+F ++A N   +G+E    I   E  PS FP N ++     L+ ++   TW   +    NG+  +Y  V+  + S +N    T  T    +TI  L+ D+ Y  RV+ +  K     S +I  +T
Sbjct:   35 PNFVRSPEDQTGISGGVASFVCQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQ-IPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGGSPIRGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGR----NVLELTNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYIIQYRA---KTSD------------TNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSSPPLHVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSR-------LTTISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTWL---WPVQDPIIKYELQYWEADSDN-KIHVTFDPA---GSYAVEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTS---IKVSWVAPPAASRHGAIVRYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPGPESTAVRIRTNEDVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQV-IYSRLENGEPRGHPNIMDVALP------EAQEA----VIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELMGYRLRYKRLEEEN---YEI--REFSRTDDHHTVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQV---VGLTTSTTRLTWEPPALSERNGRIIHYIVVYRDINSKQNS---TNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRT 1004          

HSP 3 Score: 53.9138 bits (128), Expect = 3.068e-6
Identity = 61/285 (21.40%), Postives = 121/285 (42.46%), Query Frame = 2
Query: 1595 LQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFWDSLPSKSQVN--IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEK-NSKINIRIYF 2434
            +  L   T+Y+V + +++ + D  +S     TT+   P  P   + + +      LI W PP    G +  Y + Y + ++      + Y ++   ++D     T L   A   TY   +SA+N AG     E +  +  P  V    P + + +  +++   L W+  P+ S+ N  II+Y +VY       +  ++          + I  L+P+TTY+ ++   T+   G  S    + T    P    ++ +    +  + + W E+PE   S++  +I +
Sbjct:  781 IAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKP--TMIISTTVGNTALIQWQPPKDMVGELMGYRLRYKRLEE------ENYEIREFSRTDDHHTVTDLHKGA---TYSFHLSARNRAGLG--EEYVKDIGTPEDVPSGFPLNLQVVGLTTSTTRLTWEP-PALSERNGRIIHYIVVYR-----DINSKQNSTNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRTMSTSPAFATSFGVKAVMKTSVLLTW-EVPENYKSQVPFKILY 1045          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 367/627 (58.53%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN+N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q       + G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1334 EHPPISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDAVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PSAGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1909          

HSP 2 Score: 309.686 bits (792), Expect = 4.115e-84
Identity = 280/1027 (27.26%), Postives = 455/1027 (44.30%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGK-FNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NSLG  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D   N RI   ++G L+I  ++E D+G YECVATN+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L    +   G+    NV+ L+++ +S    CVA +    I  +  V+++     PT++ VT     S  ++W   N +P+    ++Y+    KT D             N ++ D       S+  L P++ Y   + + +       S  V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D PLS+W K+    S+        T +S +    TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W   P   Q  II Y L Y      + K    FD +    +  +  L+P+T Y+F L+  +    G+    +E  T    P A P  V    LS +    I++ W   P  +    I  Y   +Q+  G  + +  +  IG+      L+ +++   Y+V +         P   + +I T   V    P ++   A+NSTAI V W+   +  +  +   Y++ ++    N E    P + D+ + +     E ++     + A LA ++ Y + + + T +  G   K++ + T      KP  I   +S ++ N  + ++W+        + GYRLRY  L E +   Y++  R  S +    +  D  +G  Y+F ++A N   +G+E    I   E  PS FP N ++     L+ ++   TW   +    NG+  +Y  V+  + S +N    T  T    +TI  L+ D+ Y  RV+ +  K     S +I  +T
Sbjct:   35 PNFVRSPEDQTGISGGVASFVCQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQ-IPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGR----NVLELTNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYIIQYRA---KTSD------------TNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSSPPLHVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSR-------LTTISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTW-LWP--VQDPIIKYELQYWEADSDN-KIHVTFDPA---GSYAVEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTS---IKVSWVAPPAASRHGAIVRYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPGPESTAVRIRTNEDVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQV-IYSRLENGEPRGHPNIMDVALPEAQWKIE-ESTEYEAVIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELMGYRLRYKRLEEEN---YEI--REFSRTDDHHTVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQV---VGLTTSTTRLTWEPPALSERNGRIIHYIVVYRDINSKQNS---TNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRT 1007          

HSP 3 Score: 55.0694 bits (131), Expect = 1.393e-6
Identity = 75/350 (21.43%), Postives = 146/350 (41.71%), Query Frame = 2
Query: 1400 TAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFWDSLPSKSQVN--IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEK-NSKINIRIYF 2434
            TAIRVT+  P S       +  +  Y R +    +    +++  L        + ++YE V    +  L   T+Y+V + +++ + D  +S     TT+   P  P   + + +      LI W PP    G +  Y + Y + ++      + Y ++   ++D     T L   A   TY   +SA+N AG     E +  +  P  V    P + + +  +++   L W+  P+ S+ N  II+Y +VY       +  ++          + I  L+P+TTY+ ++   T+   G  S    + T    P    ++ +    +  + + W E+PE   S++  +I +
Sbjct:  723 TAIRVTWKPPLSGKQHGQIRGYQVIYSRLENGEPRGHPNIMDVALPEAQWKIEESTEYEAV----IAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKP--TMIISTTVGNTALIQWQPPKDMVGELMGYRLRYKRLEE------ENYEIREFSRTDDHHTVTDLHKGA---TYSFHLSARNRAGLG--EEYVKDIGTPEDVPSGFPLNLQVVGLTTSTTRLTWEP-PALSERNGRIIHYIVVYR-----DINSKQNSTNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRTMSTSPAFATSFGVKAVMKTSVLLTW-EVPENYKSQVPFKILY 1048          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 373/647 (57.65%), Postives = 467/647 (72.18%), Query Frame = 2
Query: 5195 QTLGSLVQFHGQHIQNRYLE-YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            QT GS V  + +++ +  +  + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDYIN+N+I GY    AYIATQGPL ET GDFWRMMWEQ ++ IVMMT+LEER R KCDQYWP  G     T+  I +T++D +ELA YT+R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1303 QTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRG---TETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1898          

HSP 2 Score: 289.656 bits (740), Expect = 8.640e-78
Identity = 276/1036 (26.64%), Postives = 452/1036 (43.63%), Query Frame = 2
Query:  524 PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RI------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVK-NWDLSISKRGGIEICWREIP--EKNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWC--FVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            PPK+     +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A NS+G   +   L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI       T   G L+I +++E D+G YECVATN+ GT  S+   L +RV+  +P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     + ++     P    VT     S  ++W+      E + Y +   K K    +       I  V  + Y      S+  L P++ Y   + + +       S  V   TSE  P +PP+NV+   +S+  +L+ W+ P+ PNG I  Y +YYT    + ++SW K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y L Y  +   H  +E+     P  +  L G L+PN+ Y F+L+       G  S  E +     + P A P  ++ N   S S    I + W   P  ++N KI    I +     + +    + +I S+     L+++++   Y+++++        P      I T   V    P +V   AVNST+++V W++     +  +    Q+H     N E   +P LKD+ +       +        I + L P++ Y I + + T +  G   K + + T      KP+ +  H +++ ++      ++W   ++    + GYRL++      D      LE +  E  F  ++ D  +G  Y FK++A N+   G+EI  ++ I E  PS FP N    +TS+   TSV+ TW   +    NG    Y +      L H              +T+  LK D+ Y  ++R    K    +S ++ F+T
Sbjct:    6 PPKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----SSEEQYKEIDGVATTRY------SVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADS-------QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSW--TPPRSD-TISSYDLYY--KEGDH-AEEQVITIDPATSYRLQG-LKPNSLYYFRLAARAQVGLGA-STAEISARTMQSKPSAPPQDIRCNSQSSTS----ILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDD-TTEHEMIISGLQPETAYSITVTAYTTKGDGARSKPKIVSTSAAVPGKPRLVISHTQMNTAL------IQWYPPVETFGPVIGYRLKF---GRKDLDTLTTLEFSEKEEHF--TATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSS---TSVLITWQHPNLEERNGLLTKYTLMYRDINLPH-YPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRT 989          

HSP 3 Score: 61.6178 bits (148), Expect = 2.246e-8
Identity = 64/249 (25.70%), Postives = 107/249 (42.97%), Query Frame = 2
Query: 1697 ELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTI-LSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
            E PP   P+N+   S S+ +VLITW  P++   NG++T Y + Y         +   Y ++       P  TT+ L+ +  +TTY + + A  S G  P S  +     P      K+F   A   T + L W+ +P          Y   +P  + +   +   +   +    LI +L+P T+Y F L+   N+A G+   V    T K  P ++K   + I K     +   E+PE  +   I+ Y+
Sbjct:  891 EEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDI------NLPHYPIEVPI---VPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWE-IPEN--------YNSALPFKILYDDGKMAMEVDGRATQKLITNLKPETSYSFVLTNRGNSAGGLQHRV----TAKTAPDVLKTKPVFIGKTNSDGMITVELPEVLANDRIKGYY 1117          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 373/647 (57.65%), Postives = 467/647 (72.18%), Query Frame = 2
Query: 5195 QTLGSLVQFHGQHIQNRYLE-YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            QT GS V  + +++ +  +  + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDYIN+N+I GY    AYIATQGPL ET GDFWRMMWEQ ++ IVMMT+LEER R KCDQYWP  G     T+  I +T++D +ELA YT+R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1317 QTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRG---TETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1912          

HSP 2 Score: 295.434 bits (755), Expect = 1.363e-79
Identity = 276/1032 (26.74%), Postives = 458/1032 (44.38%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVK-NWDLSISKRGGIEICWREIP--EKNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWC--FVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            + PPK+     +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A NS+G   +   L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI   ++G L+I +++E D+G YECVATN+ GT  S+   L +RV+  +P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     + ++     P    VT     S  ++W+      E + Y +   K K    +       I  V  + Y      S+  L P++ Y   + + +       S  V   TSE  P +PP+NV+   +S+  +L+ W+ P+ PNG I  Y +YYT    + ++SW K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y L Y  +   H  +E+     P  +  L G L+PN+ Y F+L+       G  S  E +     + P A P  ++ N   S S    I + W   P  ++N KI    I +     + +    + +I S+     L+++++   Y+++++        P      I T   V    P +V   AVNST+++V W++     +  +    Q+H     N E   +P LKD+ +      +++Q +    I + L P++ Y I + + T +  G   K + + T      KP+ +  H +++ ++      ++W   ++    + GYRL++      D      LE +  E  F  ++ D  +G  Y FK++A N+   G+EI  ++ I E  PS FP N    +TS+   TSV+ TW   +    NG    Y +      L H              +T+  LK D+ Y  ++R    K    +S ++ F+T
Sbjct:   28 ETPPKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----SSEEQYKEIDGVATTRY------SVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADS-------QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSW--TPPRSD-TISSYDLYY--KEGDH-AEEQVITIDPATSYRLQG-LKPNSLYYFRLAARAQVGLGA-STAEISARTMQSKPSAPPQDIRCNSQSSTS----ILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVML------ADAQEM----IISGLQPETAYSITVTAYTTKGDGARSKPKIVSTSAAVPGKPRLVISHTQMNTAL------IQWYPPVETFGPVIGYRLKFG---RKDLDTLTTLEFSEKEEHF--TATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSS---TSVLITWQHPNLEERNGLLTKYTLMYRDINLPH-YPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRT 998          

HSP 3 Score: 61.2326 bits (147), Expect = 2.616e-8
Identity = 64/249 (25.70%), Postives = 107/249 (42.97%), Query Frame = 2
Query: 1697 ELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTI-LSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
            E PP   P+N+   S S+ +VLITW  P++   NG++T Y + Y         +   Y ++       P  TT+ L+ +  +TTY + + A  S G  P S  +     P      K+F   A   T + L W+ +P          Y   +P  + +   +   +   +    LI +L+P T+Y F L+   N+A G+   V    T K  P ++K   + I K     +   E+PE  +   I+ Y+
Sbjct:  900 EEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDI------NLPHYPIEVPI---VPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWE-IPEN--------YNSALPFKILYDDGKMAMEVDGRATQKLITNLKPETSYSFVLTNRGNSAGGLQHRV----TAKTAPDVLKTKPVFIGKTNSDGMITVELPEVLANDRIKGYY 1126          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 373/647 (57.65%), Postives = 467/647 (72.18%), Query Frame = 2
Query: 5195 QTLGSLVQFHGQHIQNRYLE-YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            QT GS V  + +++ +  +  + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDYIN+N+I GY    AYIATQGPL ET GDFWRMMWEQ ++ IVMMT+LEER R KCDQYWP  G     T+  I +T++D +ELA YT+R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1326 QTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRG---TETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1921          

HSP 2 Score: 294.664 bits (753), Expect = 2.278e-79
Identity = 275/1032 (26.65%), Postives = 454/1032 (43.99%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVK-NWDLSISKRGGIEICWREIP--EKNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWC--FVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            + PPK+     +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A NS+G   +   L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI   ++G L+I +++E D+G YECVATN+ GT  S+   L +RV+  +P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     + ++     P    VT     S  ++W+      E + Y +   K K    +       I  V  + Y      S+  L P++ Y   + + +       S  V   TSE  P +PP+NV+   +S+  +L+ W+ P+ PNG I  Y +YYT    + ++SW K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y L Y  +   H  +E+     P  +  L G L+PN+ Y F+L+       G  S  E +     + P A P  ++ N   S S    I + W   P  ++N KI    I +     + +    + +I S+     L+++++   Y+++++        P      I T   V    P +V   AVNST+++V W++     +  +    Q+H     N E   +P LKD+ +       +        I + L P++ Y I + + T +  G   K + + T      KP+ +  H +++ ++      ++W   ++    + GYRL++      D      LE +  E  F  ++ D  +G  Y FK++A N+   G+EI  ++ I E  PS FP N    +TS+   TSV+ TW   +    NG    Y +      L H              +T+  LK D+ Y  ++R    K    +S ++ F+T
Sbjct:   28 ETPPKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----SSEEQYKEIDGVATTRY------SVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADS-------QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSW--TPPRSD-TISSYDLYY--KEGDH-AEEQVITIDPATSYRLQG-LKPNSLYYFRLAARAQVGLGA-STAEISARTMQSKPSAPPQDIRCNSQSSTS----ILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDD-TTEHEMIISGLQPETAYSITVTAYTTKGDGARSKPKIVSTSAAVPGKPRLVISHTQMNTAL------IQWYPPVETFGPVIGYRLKF---GRKDLDTLTTLEFSEKEEHF--TATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSS---TSVLITWQHPNLEERNGLLTKYTLMYRDINLPH-YPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRT 1007          

HSP 3 Score: 61.6178 bits (148), Expect = 2.447e-8
Identity = 64/249 (25.70%), Postives = 107/249 (42.97%), Query Frame = 2
Query: 1697 ELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTI-LSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
            E PP   P+N+   S S+ +VLITW  P++   NG++T Y + Y         +   Y ++       P  TT+ L+ +  +TTY + + A  S G  P S  +     P      K+F   A   T + L W+ +P          Y   +P  + +   +   +   +    LI +L+P T+Y F L+   N+A G+   V    T K  P ++K   + I K     +   E+PE  +   I+ Y+
Sbjct:  909 EEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDI------NLPHYPIEVPI---VPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWE-IPEN--------YNSALPFKILYDDGKMAMEVDGRATQKLITNLKPETSYSFVLTNRGNSAGGLQHRV----TAKTAPDVLKTKPVFIGKTNSDGMITVELPEVLANDRIKGYY 1135          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 774.622 bits (1999), Expect = 0.000e+0
Identity = 373/647 (57.65%), Postives = 467/647 (72.18%), Query Frame = 2
Query: 5195 QTLGSLVQFHGQHIQNRYLE-YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            QT GS V  + +++ +  +  + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDYIN+N+I GY    AYIATQGPL ET GDFWRMMWEQ ++ IVMMT+LEER R KCDQYWP  G     T+  I +T++D +ELA YT+R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1321 QTPGSGVSGYPRNLHSSSMANHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRG---TETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1916          

HSP 2 Score: 295.049 bits (754), Expect = 1.610e-79
Identity = 275/1032 (26.65%), Postives = 454/1032 (43.99%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVK-NWDLSISKRGGIEICWREIP--EKNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWC--FVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            + PPK+     +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A NS+G   +   L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI   ++G L+I +++E D+G YECVATN+ GT  S+   L +RV+  +P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     + ++     P    VT     S  ++W+      E + Y +   K K    +       I  V  + Y      S+  L P++ Y   + + +       S  V   TSE  P +PP+NV+   +S+  +L+ W+ P+ PNG I  Y +YYT    + ++SW K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y L Y  +   H  +E+     P  +  L G L+PN+ Y F+L+       G  S  E +     + P A P  ++ N   S S    I + W   P  ++N KI    I +     + +    + +I S+     L+++++   Y+++++        P      I T   V    P +V   AVNST+++V W++     +  +    Q+H     N E   +P LKD+ +       +        I + L P++ Y I + + T +  G   K + + T      KP+ +  H +++ ++      ++W   ++    + GYRL++      D      LE +  E  F  ++ D  +G  Y FK++A N+   G+EI  ++ I E  PS FP N    +TS+   TSV+ TW   +    NG    Y +      L H              +T+  LK D+ Y  ++R    K    +S ++ F+T
Sbjct:   28 ETPPKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----SSEEQYKEIDGVATTRY------SVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADS-------QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSW--TPPRSD-TISSYDLYY--KEGDH-AEEQVITIDPATSYRLQG-LKPNSLYYFRLAARAQVGLGA-STAEISARTMQSKPSAPPQDIRCNSQSSTS----ILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEYDD-TTEHEMIISGLQPETAYSITVTAYTTKGDGARSKPKIVSTSAAVPGKPRLVISHTQMNTAL------IQWYPPVETFGPVIGYRLKF---GRKDLDTLTTLEFSEKEEHF--TATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSS---TSVLITWQHPNLEERNGLLTKYTLMYRDINLPH-YPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRT 1007          

HSP 3 Score: 61.6178 bits (148), Expect = 2.230e-8
Identity = 64/249 (25.70%), Postives = 107/249 (42.97%), Query Frame = 2
Query: 1697 ELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTI-LSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
            E PP   P+N+   S S+ +VLITW  P++   NG++T Y + Y         +   Y ++       P  TT+ L+ +  +TTY + + A  S G  P S  +     P      K+F   A   T + L W+ +P          Y   +P  + +   +   +   +    LI +L+P T+Y F L+   N+A G+   V    T K  P ++K   + I K     +   E+PE  +   I+ Y+
Sbjct:  909 EEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDI------NLPHYPIEVPI---VPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWE-IPEN--------YNSALPFKILYDDGKMAMEVDGRATQKLITNLKPETSYSFVLTNRGNSAGGLQHRV----TAKTAPDVLKTKPVFIGKTNSDGMITVELPEVLANDRIKGYY 1135          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 773.081 bits (1995), Expect = 0.000e+0
Identity = 368/626 (58.79%), Postives = 456/626 (72.84%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDYIN+N+I GY    AYIATQGPL ET GDFWRMMWEQ ++ IVMMT+LEER R KCDQYWP  G     T+  I +T++D +ELA YT+R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1330 HPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRG---TETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1904          

HSP 2 Score: 291.967 bits (746), Expect = 1.423e-78
Identity = 285/1065 (26.76%), Postives = 468/1065 (43.94%), Query Frame = 2
Query:  452 ILPLWKRSVDHNRQ-----LDYTIIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RI------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVK-NWDLSISKRGGIEICWREIP--EKNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWC--FVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            +LP  KR   H+R      L+Y  +    PPK+     +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A NS+G   +   L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI       T   G L+I +++E D+G YECVATN+ GT  S+   L +RV+  +P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     + ++     P    VT     S  ++W+      E + Y +   K K    +       I  V  + Y      S+  L P++ Y   + + +       S  V   TSE  P +PP+NV+   +S+  +L+ W+ P+ PNG I  Y +YYT    + ++SW K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y L Y  +   H  +E+     P  +  L G L+PN+ Y F+L+       G  S  E +     + P A P  ++ N   S S    I + W   P  ++N KI    I +     + +    + +I S+     L+++++   Y+++++        P      I T   V    P +V   AVNST+++V W++     +  +    Q+H     N E   +P LKD+ +      +++Q +    I + L P++ Y I + + T +  G   K + + T      KP+ +  H +++ ++      ++W   ++    + GYRL++      D      LE +  E  F  ++ D  +G  Y FK++A N+   G+EI  ++ I E  PS FP N    +TS+   TSV+ TW   +    NG    Y +      L H              +T+  LK D+ Y  ++R    K    +S ++ F+T
Sbjct:    2 LLPQEKRR--HSRHKCLISLEYFFVLS-SPPKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----SSEEQYKEIDGVATTRY------SVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADS-------QITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQVITQTGVPSQPLNFKAEPESETSILLSW--TPPRSD-TISSYDLYY--KEGDH-AEEQVITIDPATSYRLQG-LKPNSLYYFRLAARAQVGLGA-STAEISARTMQSKPSAPPQDIRCNSQSSTS----ILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEILSISSETRQYLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWRSPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVML------ADAQEM----IISGLQPETAYSITVTAYTTKGDGARSKPKIVSTSAAVPGKPRLVISHTQMNTAL------IQWYPPVETFGPVIGYRLKF---GRKDLDTLTTLEFSEKEEHF--TATDIHKGALYIFKLSARNKVGYGEEIVKELSIPEEPPSGFPQNIHCDSTSS---TSVLITWQHPNLEERNGLLTKYTLMYRDINLPH-YPIEVPIVPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRT 1002          

HSP 3 Score: 62.003 bits (149), Expect = 1.731e-8
Identity = 64/249 (25.70%), Postives = 107/249 (42.97%), Query Frame = 2
Query: 1697 ELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTI-LSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
            E PP   P+N+   S S+ +VLITW  P++   NG++T Y + Y         +   Y ++       P  TT+ L+ +  +TTY + + A  S G  P S  +     P      K+F   A   T + L W+ +P          Y   +P  + +   +   +   +    LI +L+P T+Y F L+   N+A G+   V    T K  P ++K   + I K     +   E+PE  +   I+ Y+
Sbjct:  904 EEPPSGFPQNIHCDSTSSTSVLITWQHPNLEERNGLLTKYTLMYRDI------NLPHYPIEVPI---VPADTTVTLTGLKPDTTYDVKLRAHTSKGPGPFSPSVQFRTLPVDQVFAKNFHVKAVMKTSVLLSWE-IPEN--------YNSALPFKILYDDGKMAMEVDGRATQKLITNLKPETSYSFVLTNRGNSAGGLQHRV----TAKTAPDVLKTKPVFIGKTNSDGMITVELPEVLANDRIKGYY 1130          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 368/628 (58.60%), Postives = 455/628 (72.45%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH+  LK NDS   ++EYESI+PGQQFTW  SN+E N+PKNRYANVIAYDHSRVILQPL             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+ +I VT++D +ELA + +R F + K   +  RE+  FQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              A++ +H S                 + TA+  CN+ KNR++ ILP + SRV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E +  P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFC+ AALEYL  F+
Sbjct: 1327 LSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEG-----------IMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVE------PGEHVTGMELEFKRL--------------ASSKAHTSR----------------FITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 277.33 bits (708), Expect = 3.790e-74
Identity = 265/1071 (24.74%), Postives = 460/1071 (42.95%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTT----PKACPMIVKNWDLSISKRGGIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDI-KNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHEN------KXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFK-TRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF          ++LRI P++   ++    C+AQNS+G    +A L+V    Q +P GFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA AKS T I L W    +  Q ++I Y L++  R     ++  R FD +      ++  L+PNT Y F+L+  +    G  + V    T    P A P  VK   L   +   I + WR  P +    + +   + ++  LG+    P  +  I        L+ +++   Y+V  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KDI +      +++Q +    +  NL P++ Y I + + T +  G   K + + T    L +P    L +  + E   +   W+      +  + GYRL++      ++     LE    E +F   +    +G  Y F++AA     +G+E    + I E +P  FP    L    N+S  SV+  W        NG    Y V                 +         +T+  L+ ++ Y  RVR   ++    +S  + ++  RD   P    ++ I   +++  ++W++ PD
Sbjct:   30 EEPPRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLREDQ-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWS---APRQESVIKYELLF--REGDRGREVGRTFDPT---TAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSL---RSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIML------ADAQEM----VITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPT---LSVQQTPEG-SLLARWEPPADAAEDPVLGYRLQF----GREDAAPATLELAAWERRFAAPAH---KGATYVFRLAARGRAGLGEEAAAALSIPEDAPRGFPQ--ILGAAGNVSAGSVLLRWLPPVPAERNGAIIKYTVSVREAGAPGPATETELAAAAQPGAETALTLRGLRPETAYELRVRAHTRRGPGPFSPPLRYRLARDPVSPKNFKVKMI--MKTSVLLSWEF-PD 1033          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprf (protein tyrosine phosphatase, receptor type, F [Source:MGI Symbol;Acc:MGI:102695])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 372/678 (54.87%), Postives = 469/678 (69.17%), Query Frame = 2
Query: 5105 RFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSL-VQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQ 7135
            R + H  +  D   I L  +  LL  SS P  +  L  Q  G        ++ PIP+  L++++  LK ND   F++EYESI+PGQQFTW  SN E+N+PKNRYANVIAYDHSRV+L  +             V GSDYINAN+I GY    AYIATQGPL ET+GDFWRM+WEQ ++ +VMMTRLEE+ R KCDQYWP+ G     T+  I VT+VD +ELA YT+R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQY+FI+E LLEA  CG+TEV    L  HI+KL Q+        G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS++DGY+ +KAYIA Q PL+E+ EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK LR QRPA++QTEDQYQ CY AALEYL  F+ 
Sbjct: 1277 RKRTHSPSSKDEQSIGLKDS--LLAHSSDPVEMRRLNYQTPGMR------DHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNSEVNKPKNRYANVIAYDHSRVLLTSIDG-----------VPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPVRG---TETYGLIQVTLVDTVELATYTMRTFALHKSGSSEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAAMCGHTEVLARNLYAHIQKLGQV------PPGESVTAMELEFKLL--------------ANSKAHTSR----------------FVSANLPCNKFKNRLVNIMPYELTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDH 1895          

HSP 2 Score: 299.671 bits (766), Expect = 4.660e-81
Identity = 292/1148 (25.44%), Postives = 486/1148 (42.33%), Query Frame = 2
Query:  578 AIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECT--TTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY------FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILD-SLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQ----LRWF 3943
            A F+C   G P P+I W         +RF V +      S+LRI P+++  ++    C A NSLG  ++ A LSV    Q +PSGFPTI     + V EK     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ GT  S+   L +RV+  +P F      Q V PG SV L C A+G P+P V W  G   L  + +   G+    NV+ LS++  S    CVA +    I  +  VT++     P  + VT     S  ++W   N +P+    ++Y+                +GT    ++ D       S+  L PF+ Y   + + +       S  V   T E  P +PP+ V+   +S   +L+ W+PP+ PNG++  Y +YYT    +PLS+W K+       +D+   TT+ S +    TY + + A  + G  P S  + +  + GV   P  F+A A+S T I+L W   P   Q  I+ Y LVY        + +  FD +   ++  +  L+P+T Y FQL+  ++   G+  P++   T  +TP A P  V       +    + + W   P  +    I  Y   +++  G    +  +  I  +     L  +++   Y+V +         P      + T   V    P +V    +NSTA+ V W+      +       Q+ GY        N E   +P ++D+ +      +E+Q  T+    + L P++ Y I + + T +  G   K + + T      +P  +   +S +  +  + ++W    +    + GYRL+Y      DE +   ++    +  F  +     +G  Y F++AA N    G+E   +I   E  PS FP N ++   + L+ ++   TW+       NG    Y V    ++  ++      T    +T+  LK D+ Y  +VR    K     S +I  +T           R     +++  ++W+  PD       F I Y  +   ++          +  K+I D   N   S+V+     S  G++  +S       L     PA    E     +S   +Q    +RWF
Sbjct:   50 ASFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSAKLSVLEEDQ-LPSGFPTIDMGPQLKVVEKGRTATMLCAAGGNPDPEISWFKDFLPVDPAASNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSSQEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGR----NVLELSNVMRSANYTCVAISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNTEPVSFYGIQYRA---------------AGTDGPFQEVDGVASTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRVQARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPLSAWHKH------NTDAGLLTTVGSLLP-GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQANAESDTRIQLSWLLPP---QERIVKYELVYWAAEDEGQQHKVTFDPT---SSYTLEDLKPDTLYHFQLAARSDLGVGVFTPTVEARTAQSTPSAPPQKVTCVSTGSTT---VRVSWVPPPADSRNGIITQYSVAYEAVDGEDRKRHVVDGISREHSSWDLLGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPLNSTAVHVSWKLPVPNKQHG-----QIRGYQVTYVRLENGEPRGQPIIQDVML------AEAQETTI----SGLTPETTYSITVAAYTTKGDGARSKPKVVTTTGAVPGRPTMM---VSTTAMHTAL-LQWHPPKELPGELLGYRLQYR---RADEARPNTIDFGKDDQHFTVTGLH--KGATYVFRLAAKNRAGPGEEFEKEITTPEDVPSGFPQNLRV---TGLTTSTTELTWDPPVLAERNGHITNYTVVYRDIN--SQLELQNVTNDTHLTLLGLKPDTTYDIKVRAHTSKGAGPLSPSIQSRTMPVEQVFAKNFRVAAAMKTSVLLSWE-VPDSYKSAVPFKILYNGQSVEVD--------GHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAPDLLPQKPLPASAFIEDGRFSLSMPQVQDPSLVRWF 1123          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 364/626 (58.15%), Postives = 454/626 (72.52%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDY+NAN+I GY    AYIATQG L ET GDFWRM+WEQ S+ +VMMT+LEER R KCDQYWP  G     T   + VT++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS++DGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1312 HPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRG---TETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1886          

HSP 2 Score: 286.96 bits (733), Expect = 4.114e-77
Identity = 268/1034 (25.92%), Postives = 453/1034 (43.81%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVKNWDLSISKRGGIEICWREIP-EKNSKI--NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFN-----YYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            + PP+      +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G       L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI   ++G L+I +++E D+G YECVATN+ GT  S+   L +RV+   P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W+      E + Y +   K K    N       I  +  + Y      S+  L P+++Y   + + +       S  V   TSE  P + P++V+   +S+  +L+ W  P+ PNG I  Y +YYT    + +++W K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y LVY         +E+R    P  +  L G L+PN+ Y F+LS  +    G  S  E +     + P A P  +     S +    I + W+  P EK + I     + + +  G       +  I S      L+++++   Y++ +         P   S  I T   V    P +V   AVN+TA++V W++     +  +    Q+H     N E   +P LKD+ +      +++Q++    I + L P++ Y + + + T +  G   K + + T      KP+ +  H +++ ++      ++W   +     ++GYRL++      D      LE +  E  F  ++ D  +G  Y F+++A N+   G+E+  +I + E  P+ FP N   + T++   TSV  +W        NG        Y ++   +L  E+            +T+  LK D+ Y  +VR    K    +S ++ F+T
Sbjct:   21 ETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGR----NVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----NSEEPYKEIDGIATTRY------SVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADS-------QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSW--TPPRSD-TIASYELVYRDGDQ---GEEQRITIEPGTSYRLQG-LKPNSLYYFRLSARSPQGLGA-STAEISARTMQSKPSAPPQDISCTSPSSTS---ILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVML------ADAQDM----IISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL------IQWHPPVDTFGPLQGYRLKFG---RKDMEPLTTLEFSEKEDHF--TATDIHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTS---TSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEH----LIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQFRT 991          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 764.607 bits (1973), Expect = 0.000e+0
Identity = 364/626 (58.15%), Postives = 454/626 (72.52%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L           S    + GSDY+NAN+I GY    AYIATQG L ET GDFWRM+WEQ S+ +VMMT+LEER R KCDQYWP  G     T   + VT++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              A++ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS++DGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1334 HPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL-----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRG---TETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ASSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1908          

HSP 2 Score: 272.707 bits (696), Expect = 1.001e-72
Identity = 270/1048 (25.76%), Postives = 450/1048 (42.94%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RI---------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECT-----TTPKACPMIVKNWDLSISKRGGIEICWREIP-EKNSKI--NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMR-YIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFI--HLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFN-----YYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            + PP+      +   +    A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G       L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D  N   RI          T   G L+I +++E D+G YECVATN+ GT  S+   L +R    V+   P F     +  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W+      E + Y +   K K    N       I  +  + Y      S+  L P+++Y   + + +       S  V   TSE  P + P++V+   +S+  +L+ W  P+ PNG I  Y +YYT    + +++W K+ V  S       Q T +  +    TY + + A  S G  P+S  + ++ + GV   P +F+A  +S T I L W   P +S   I  Y LVY         +E+R    P  +  L G L+PN+ Y F+LS  +    G  S  E +     + P A P  +     S +    I + W+  P EK + I     + + +  G       +  I S      L+++++   Y++ +         P   S  I T   V    P +V   AVN+TA++V W++     +  +    Q+H     N E   +P LKD+ +    +  E  + T    I + L P++ Y + + + T +  G   K + + T      KP+ +  H +++ ++      ++W   +     ++GYRL++      D      LE +  E  F  ++ D  +G  Y F+++A N+   G+E+  +I + E  P+ FP N   + T++   TSV  +W        NG        Y ++   +L  E+            +T+  LK D+ Y  +VR    K    +S ++ F+T
Sbjct:   21 ETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ-IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGR----NVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSG--NPEPVSYYIIQHKPK----NSEEPYKEIDGIATTRY------SVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADS-------QITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSW--TPPRSD-TIASYELVYRDGDQ---GEEQRITIEPGTSYRLQG-LKPNSLYYFRLSARSPQGLGA-STAEISARTMQSKPSAPPQDISCTSPSSTS---ILVSWQPPPVEKQNGIITEYSLKYAAVDGEDFKPHEILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTDEDVPSGPPRKVEVEAVNATAVKVSWRSPVPNKQHGQIRGYQVHYVKMENGEPKGQPMLKDVMLAD--AQWEFDDTTEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL------IQWHPPVDTFGPLQGYRLKFG---RKDMEPLTTLEFSEKEDHF--TATDIHKGASYVFRLSARNKVGFGEEMVKEISVPEEIPTGFPQNLHSEGTTS---TSVQLSWQPPVLAERNGVITKYTLLYRDINVPLLPMEH----LIVPADTSMTLTGLKSDTTYDVKVRAHTSKGPGPYSPSVQFRT 1013          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 368/628 (58.60%), Postives = 455/628 (72.45%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH+  LK NDS   ++EYESI+PGQQFTW  SN+E N+PKNRYANVIAYDHSRVILQPL             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+ +I VT++D +ELA + +R F + K   +  RE+  FQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              A++ +H S                 + TA+  CN+ KNR++ ILP + SRV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E +  P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFC+ AALEYL  F+
Sbjct:  921 LSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEG-----------IMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVE------PGEHVTGMELEFKRL--------------ASSKAHTSR----------------FITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1497          

HSP 2 Score: 238.424 bits (607), Expect = 1.809e-62
Identity = 175/638 (27.43%), Postives = 297/638 (46.55%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPE 2401
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF          ++LRI P++   ++    C+AQNS+G    +A L+V    Q +P GFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA AKS T I L W    +  Q ++I Y L++  R     ++  R FD +      ++  L+PNT Y F+L+  +    G  + V    T +A  +  KN+ + +  +  + + W E P+
Sbjct:   30 EEPPRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLREDQ-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWS---APRQESVIKYELLF--REGDRGREVGRTFDPT---TAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQA--ISPKNFKVKMIMKTSVLLSW-EFPD 627          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|Q13332|PTPRS_HUMAN (Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 772.696 bits (1994), Expect = 0.000e+0
Identity = 378/673 (56.17%), Postives = 476/673 (70.73%), Query Frame = 2
Query: 5114 NHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            +H  + +++ +I    TPD  +RS + +       FH + +    L + PIP+  ++EH   LK NDS   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVILQP+             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMTRLEE+ R KCDQYWP  G     T+ +I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct: 1333 HHPKDPVEMRRINFQ-TPDSGLRSPLREP-----GFHFESM----LSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEG-----------IMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1944          

HSP 2 Score: 285.419 bits (729), Expect = 8.691e-76
Identity = 272/1088 (25.00%), Postives = 467/1088 (42.92%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISP-KKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRI---------NTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECT--TTPKACPMIVKNWDLSISKRG-GIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKF-----IHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYY-----EVWCFVLSHENKXXXXXXXXXX-XXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQNS+G    +A L+V    Q +PSGFP I     + V E+     + C   G P   I W KD +P+D    N RI         +T   G L+I  ++E D+G YECVATN+ G   SS   L +R    V+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA A+S T I L W       Q +II Y L++  R   H ++  R FD +    + ++  L+PNT Y F+L+  +    G   P + + T  + P A P  VK     +S R   I + WR  P +    + +   + ++  LG+   +P  +  I        L+ +++   Y++  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KD+ +      ++        +  NL P++ Y I + + T +  G   K + + T    L +P           L    E P  T E          + GYRL++      D      LE   SE ++ T+S  H +G  Y F++AA +   +G+E  + + I E +P   P    L+   N S  +V+  W        NG    Y     E      + E +         E  +T+  LK D+ Y  +VR   ++    +S  + ++T      +P   +   + +++  ++W++ PD
Sbjct:   30 EEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSL-------LTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWS---PPRQESIIKYELLF--REGDHGREVGRTFDPT---TSYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVK----CVSVRSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDD-TAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAE--------DQVLGYRLQFG---REDSTPLATLEFPPSEDRY-TASGVH-KGATYVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQ--ILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSVLLSWEF-PD 1058          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|F1NWE3|PTPRS_CHICK (Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 372/628 (59.24%), Postives = 459/628 (73.09%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIPV  L+EH   LK ND+   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVIL P+             + GSDYINAN+I GY    AYIATQGPL ET GDFWRM+WEQ S+ IVMMT+LEE+ R KCDQYWP  G+G+  T+  I VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQY FI++ LLEAV CGNTEVP   L  +I+KL QIE+      G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct:  936 LSHPPIPVSELAEHTEHLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILLPIEG-----------IVGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIKCDQYWP--GRGT-DTYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEV------GEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1512          

HSP 2 Score: 233.032 bits (593), Expect = 6.343e-60
Identity = 175/641 (27.30%), Postives = 297/641 (46.33%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPE 2401
            + PP  + K  +   +    A F+C   G+P P++ W         +RF   +      ++LRI P++   ++    C+AQN  G    +A L+V    Q +P GFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVA+N+ G   SS   L +R    V+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  I+W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S+  ++I W+ P  PNG I  Y +YYT   D+P+S+W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P +FRA AK+ T I L W   P + ++ I+ Y L++  +   H ++  R ++ P   +  +  L+PNT Y F+L+    +A G+ +            ++ KN+ + +  +  + + W E PE
Sbjct:   29 ESPPVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENIYECVAQNPHGEVTVHAKLTVLREDQ-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSTSNGRIKQLRSGGLQIESSEETDQGKYECVASNSAGVRYSSPANLYVRELREVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTETTATSITITWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQGRMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKTETSIVLSWS--PPRQEI-IVKYELLF--KEGDHGREVPR-NFEP-TTSFTVEGLKPNTEYVFRLA--ARSALGLGAFTPEVRERTLQSILPKNFKVKMVTKTSVLLSW-EFPE 630          

HSP 3 Score: 56.9954 bits (136), Expect = 2.873e-6
Identity = 131/616 (21.27%), Postives = 244/616 (39.61%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDD----NKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFP--TIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTP--GSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKESISRSISVTI---QEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLR-YKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFWD-------SLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM 2284
            P I +  +   V R   A  +CA  GNP P+I W   + F LP   S +    K+  LR   ++++     ++ +  C+A NS G   S  +       +E+    P  +I+  S  I+   N  +   C   G P   + W++ +  +  E+  +   +N  LE+  T   D   Y CVA ++LG V+ +V ++ ++      +  K  G  +VT    +S+T+   + GNP P  Y+     +++ +SK+  G       I         LS  SE    +    +I +       VT    Q P++ P  ++   +   +  I W +       +R Y+V+     D  V+         N +K + +     ++ +LL    YTV + +F+   D   S+ +   T +  P   P N    + +  +++++W PP     II  Y + + +              +   ++  P  +  +  +  NT Y   ++A+++ G    +      +R   +Q   PK+F+    + T + L W+         P K Q N +                    D   +    LI +L+P+T Y F L    N+  G+
Sbjct:  134 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWF--KDF-LPVDPSTSNGRIKQ--LRSGGLQIESSEETDQGKYECVASNSAGVRYSSPANLYVRELREVRRVAPRFSILPVSHEIMPGGNVNIT--CVAVGSPMPYVKWMQGAEDLTPEDD-MPVGRN-VLEL--TDVKDSANYTCVAMSSLG-VIEAVAQITVK------SLPKAPGTPVVTETTATSITITWDS-GNPDPVSYY-----VIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQGRMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVS---------NWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVP-GQPMNFRAEAKTETSIVLSWSPPR--QEIIVKYELLFKEGDHG----------REVPRNFEPTTSFTVEGLKPNTEYVFRLAARSALGLGAFTPE----VRERTLQSILPKNFKVKMVTKTSVLLSWEFPENYNSPTPYKIQYNGL------------------NVDVDGRTTKKLITNLKPHTFYNFVLMNRGNSMGGL 681          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|Q64605|PTPRS_RAT (Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus OX=10116 GN=Ptprs PE=1 SV=2)

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 368/628 (58.60%), Postives = 455/628 (72.45%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH+  LK NDS   ++EYESI+PGQQFTW  SN+E N+PKNRYANVIAYDHSRVILQPL             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+ +I VT++D +ELA + +R F + K   +  RE+  FQFTAWPDHGVP +P P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+R E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              A++ +H S                 + TA+  CN+ KNR++ ILP + SRV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E +  P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFC+ AALEYL  F+
Sbjct: 1327 LSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEG-----------IMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRVKCDQYWPNRG---TETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIRTEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVE------PGEHVTGMELEFKRL--------------ASSKAHTSR----------------FITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 287.345 bits (734), Expect = 2.128e-76
Identity = 265/1071 (24.74%), Postives = 461/1071 (43.04%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPK-KSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTT----PKACPMIVKNWDLSISKRGGIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDI-KNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHEN------KXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFK-TRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF          ++LRI P++   ++    C+AQNS+G    +A L+V    Q +P GFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA AKS T I L W    +  Q ++I Y L++  R     ++  R FD +      ++  L+PNT Y F+L+  +    G  + V    T    P A P  VK   L   +   I + WR  P +    + +   + ++  LG+    P  +  I        L+ +++   Y+V  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KDI +      +++Q +    +  NL P++ Y I + + T +  G   K + + T    L +P    L +  + E   +   W+      +  + GYRL++      ++     LE    E +F   +    +G  Y F++AA     +G+E +  + I E +P  FP    L    N+S  SV+  W        NG    Y V                 +         +T+  L+ ++ Y  RVR   ++    +S  + ++  RD   P    ++ I   +++  ++W++ PD
Sbjct:   30 EEPPRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQ-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWS---APRQESVIKYELLF--REGDRGREVGRTFDPT---TAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSL---RSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIML------ADAQEM----VITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPT---LSVQQTPEG-SLLARWEPPADAAEDPVLGYRLQF----GREDAAPATLELAAWERRFAAPAH---KGATYVFRLAARGRAGLGEEASAALSIPEDAPRGFPQ--ILGAAGNVSAGSVILRWLPPVPAERNGAIIKYTVSVREAGAPGPATETELAAAAQPGAETALTLQGLRPETAYELRVRAHTRRGPGPFSPPLRYRLARDPVSPKNFKVKMI--MKTSVLLSWEF-PD 1033          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|B0V2N1|PTPRS_MOUSE (Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1)

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 368/628 (58.60%), Postives = 455/628 (72.45%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  ++EH+  LK NDS   ++EYESI+PGQQFTW  SN+E N+PKNRYANVIAYDHSRVILQPL             + GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+ +I VT++D +ELA + +R F + K   +  RE+  FQFTAWPDHGVP +P P L FLRRV +    + GPIVVHCSAGVGRTG FIVID MLER++ E TVD+Y +VT +RSQRNYMVQTEDQY FI+E LLEAV CGNTEVP   L  +I+KL Q+E       G  +TG+++EF+ L              A++ +H S                 + TA+  CN+ KNR++ ILP + SRV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E +  P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFC+ AALEYL  F+
Sbjct: 1327 LSHPPIPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQPLEG-----------IMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPNRG---TETYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVE------PGEHVTGMELEFKRL--------------ASSKAHTSR----------------FITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 2 Score: 277.33 bits (708), Expect = 2.651e-73
Identity = 265/1071 (24.74%), Postives = 460/1071 (42.95%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKD--FLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKR-FDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTT----PKACPMIVKNWDLSISKRGGIEICWREIPEK---NSKINIRIYFQSKLGNFSVQP-SLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDI-KNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHEN------KXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFK-TRDAHFPAPDAIRFIRLSQSTAQITWKWNPD 3646
            ++PP+ + + K+   +    A F+C   G+P P++ W         +RF          ++LRI P++   ++    C+AQNS+G    +A L+V    Q +P GFP I     + V E+     + C   G P   I W KD +P+D    N RI   ++G L+I  ++E D+G YECVATN+ G   SS   L +RV+  +P F  +     + PG +V + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N  P+    + YK    K++D  + + +++T+                 S+  L P + Y +W+ + +       S  V   T E  P + P+NV+   +S   +++ W+ P  PNG+I  Y +YYT   + P+ +W K+ V  S         T +  +  + TY + + A  S G  P+S+P+ +  + GV   P + RA AKS T I L W    +  Q ++I Y L++  R     ++  R FD +      ++  L+PNT Y F+L+  +    G  + V    T    P A P  VK   L   +   I + WR  P +    + +   + ++  LG+    P  +  I        L+ +++   Y+V  V        P      + T   V    P +V   A+N+TAI V W++ +   +  +    Q+H       E    P +KDI +      +++Q +    +  NL P++ Y I + + T +  G   K + + T    L +P    L +  + E   +   W+      +  + GYRL++      ++     LE    E +F   +    +G  Y F++AA     +G+E    + I E +P  FP    L    N+S  SV+  W        NG    Y V                 +         +T+  L+ ++ Y  RVR   ++    +S  + ++  RD   P    ++ I   +++  ++W++ PD
Sbjct:   30 EEPPRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLREDQ-LPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGR----NVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPDPVSYYVIEYK---SKSQDGPYQIKEDITT--------------TRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDS-------LLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSWS---APRQESVIKYELLF--REGDRGREVGRTFDPT---TAFVVEDLKPNTEYAFRLAARSPQGLGAFTAVVRQRTLQAKPSAPPQDVKCTSL---RSTAILVSWRPPPPETHNGALVGYSVRYRP-LGSEDPDPKEVNNIPPTTTQILLEALEKWTEYRVTAVAYTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPTPGRQHGQIRGYQVHYVRMEGAEARGPPRIKDIML------ADAQEM----VITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPT---LSVQQTPEG-SLLARWEPPADAAEDPVLGYRLQF----GREDAAPATLELAAWERRFAAPAH---KGATYVFRLAARGRAGLGEEAAAALSIPEDAPRGFPQ--ILGAAGNVSAGSVLLRWLPPVPAERNGAIIKYTVSVREAGAPGPATETELAAAAQPGAETALTLRGLRPETAYELRVRAHTRRGPGPFSPPLRYRLARDPVSPKNFKVKMI--MKTSVLLSWEF-PD 1033          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|A4IFW2|PTPRF_DANRE (Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1)

HSP 1 Score: 766.918 bits (1979), Expect = 0.000e+0
Identity = 367/627 (58.53%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRV+L P+             V GSDYIN+N+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q       + G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1330 EHPPISVSELADHIERLKANDALRFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDG-----------VPGSDYINSNYIDGYRKQNAYIATQGPLPETLSDFWRMIWEQRASTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDAVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PSAGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1905          

HSP 2 Score: 310.071 bits (793), Expect = 2.103e-83
Identity = 280/1027 (27.26%), Postives = 455/1027 (44.30%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFE-NQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY---FQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGK-FNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKT 3556
            P  V   ++   +    A F+C   G P P+I W         +RF V +      S+LRI P++   ++    C A NSLG  ++ A L+V    Q IP GFPTI     + V E+     + C   G P   I W KD +P+D   N RI   ++G L+I  ++E D+G YECVATN+ GT  S+   L +RV+   P F     +  V PG SV L C A+G P+P V W  G+  L    +   G+    NV+ L+++ +S    CVA +    I  +  V+++     PT++ VT     S  ++W   N +P+    ++Y+    KT D             N ++ D       S+  L P++ Y   + + +       S  V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D PLS+W K+    S+        T +S +    TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W   P   Q  II Y L Y      + K    FD +    +  +  L+P+T Y+F L+  +    G+    +E  T    P A P  V    LS +    I++ W   P  +    I  Y   +Q+  G  + +  +  IG+      L+ +++   Y+V +         P   + +I T   V    P ++   A+NSTAI V W+   +  +  +   Y++ ++    N E    P + D+ + +     E ++     + A LA ++ Y + + + T +  G   K++ + T      KP  I   +S ++ N  + ++W+        + GYRLRY  L E +   Y++  R  S +    +  D  +G  Y+F ++A N   +G+E    I   E  PS FP N ++     L+ ++   TW   +    NG+  +Y  V+  + S +N    T  T    +TI  L+ D+ Y  RV+ +  K     S +I  +T
Sbjct:   35 PNFVRSPEDQTGISGGVASFVCQAAGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSLGEINTSAKLTVLEENQ-IPHGFPTIDMGPQLKVVERTRTTTMLCAASGNPDPEITWFKDFLPVDINGNGRIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMTGEVELTKDEEMPVGR----NVLELTNIRQSTNYTCVAISSLGMIEATAQVSVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYIIQYRA---KTSD------------TNFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSEPVETRTGEQAPSSPPLHVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTSDLDAPLSAWQKHNTDDSR-------LTTISSLTTGITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRILLTW-LWP--VQDPIIKYELQYWEADSDN-KIHVTFDPA---GSYAVEGLKPDTLYKFSLAARSEMGQGVFTHPIEARTAQSAPSAPPQDVHLLSLSSTS---IKVSWVAPPAASRHGAIVRYTVSYQAVNGEDTERHEVPDIGADASSCVLEGLEKWTEYQVWVRAHTDVGPGPESTAVRIRTNEDVPGAPPRKLEVEALNSTAIRVTWKPPLSGKQHGQIRGYQV-IYSRLENGEPRGHPNIMDVALPEAQWKIE-ESTEYEAVIAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELMGYRLRYKRLEEEN---YEI--REFSRTDDHHTVTDLHKGATYSFHLSARNRAGLGEEYVKDIGTPEDVPSGFPLNLQV---VGLTTSTTRLTWEPPALSERNGRIIHYIVVYRDINSKQNS---TNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRT 1007          

HSP 3 Score: 55.4546 bits (132), Expect = 9.745e-6
Identity = 75/350 (21.43%), Postives = 146/350 (41.71%), Query Frame = 2
Query: 1400 TAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFWDSLPSKSQVN--IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEK-NSKINIRIYF 2434
            TAIRVT+  P S       +  +  Y R +    +    +++  L        + ++YE V    +  L   T+Y+V + +++ + D  +S     TT+   P  P   + + +      LI W PP    G +  Y + Y + ++      + Y ++   ++D     T L   A   TY   +SA+N AG     E +  +  P  V    P + + +  +++   L W+  P+ S+ N  II+Y +VY       +  ++          + I  L+P+TTY+ ++   T+   G  S    + T    P    ++ +    +  + + W E+PE   S++  +I +
Sbjct:  723 TAIRVTWKPPLSGKQHGQIRGYQVIYSRLENGEPRGHPNIMDVALPEAQWKIEESTEYEAV----IAGLASETSYSVTVAAYTTKGDGARSKAKVVTTTGAVPGKP--TMIISTTVGNTALIQWQPPKDMVGELMGYRLRYKRLEE------ENYEIREFSRTDDHHTVTDLHKGA---TYSFHLSARNRAGLG--EEYVKDIGTPEDVPSGFPLNLQVVGLTTSTTRLTWEP-PALSERNGRIIHYIVVYR-----DINSKQNSTNRTSDTQMTIQGLRPDTTYDIRVQAFTSKGGGPISPSIQSRTMSTSPAFATSFGVKAVMKTSVLLTW-EVPENYKSQVPFKILY 1048          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A2T7NQE6 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_16668 PE=4 SV=1)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 376/650 (57.85%), Postives = 469/650 (72.15%), Query Frame = 2
Query: 5189 VPQTLGSLVQFHGQHIQN-RYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQ 7135
            VP  L   V+   QH Q    + + PIP+E L EH+ +LK  D+  F++EYESIEPGQQFTW+ SN+E+N+PKNRYANVIAYDHSRVILQP+             V GSDYINAN++ GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMT+LEER R KCDQYWP  G     T+  ++V +V++ ELA YTIR FH+ +      RE+ QFQFTAWPDHGVP+HP PLLMF+RRV      + G ++VHCSAGVGRTGAFIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAVQCGNTEVP   LA HI+KL Q E       G  +TG+++EF+ L                            AN+  +  P  + +A    N+ KNR++ ILP + +RV + PIRGV+GSDYINAS+IDGY+ +KAY+A Q PL+ET EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+ EYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P S + F+D I QVHKTK Q GQ+GPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQ+QFCY AALEYL  F+ 
Sbjct: 1418 VPPYLVDPVEMRRQHYQTPAMISHPPIPIERLGEHIEMLKAADNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPIDG-----------VPGSDYINANYMDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTKLEERSRIKCDQYWPSRGA---ETYGLMHVQLVEVTELATYTIRTFHLSRYGCPEKREVRQFQFTAWPDHGVPDHPTPLLMFMRRVKVSNPPDTGSMIVHCSAGVGRTGAFIVIDAMLERIKHEKTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVQCGNTEVPARNLAAHIQKLTQPE------PGETVTGMELEFKRL----------------------------ANVKAS--PNRFISANLPVNKFKNRLVNILPYESTRVCLQPIRGVDGSDYINASFIDGYRYKKAYVATQGPLAETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMTEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTVKMLRTQRPAMVQTEDQFQFCYRAALEYLGSFDH 2016          

HSP 2 Score: 415.231 bits (1066), Expect = 2.173e-113
Identity = 366/1386 (26.41%), Postives = 620/1386 (44.73%), Query Frame = 2
Query:  515 KQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRW--RINQSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQ---EIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWN---QKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG--MPSLVECTTT--PKACPMIVKNWDLSISKRGGIEICWREIPEKNSK----INIRIYF-QSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPL--KDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVN-LVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLD 4609
            +  PPKI L  K+ KV  D  A F C   GNP+P I W  R     +   R+ +  + P  S+LRI PV+        TC+A NSLG   + A+L VY   +   E PSG+P I+    +   EK    I++C+  G P  TI WLKD +P+D  + RI   ++G L+I  +QE DE  YEC+A N LG   S    + ++V+   P F  +  DQ V PGS V L C A+G+P+P V W+ G   L  +     G+    NV+ L D+ ES    C A +   +I   + V ++     PT +  + +  +S  +SW+   ++P+    +++K       D+   +N+    + NV           ++ NL  FT+Y   + + S    S  S  +  TT EL P TPP+N+   + S+  ++++WD P+IPNGII  Y ++YT   + P+  W++  VK+  +       T +S +  N TY ISI A +S G  P+S P+ +L   GV   P +  A A S  EI + WD+ P ++  +II Y L Y   +  H ++  RF   P  ++  +  L P+T Y  Q+S  ++   G   P++   T    P+A P  V    +   +   I++ W+  P  N +       +IYF  ++ G       ++ + S      L  +     YK+ +V        P      + T   V  E P +V   A+NST I V W      + +   Y++    Y+    ++++P+  +      T S S     T   +   L PD+ Y I +   TR+  GM      I T       P+ +H+ L    + P V V W+        ++ Y++ + P  + +  + K++  +V    + TS+ D  +G  Y F+V+A N  + G+   D I   +G+PS  P NF   T + L+ TSV  TW+  +++  NG    Y++    L+ +            F+ I  L+ D++Y  +++ +  +    WS+ ++F+T     P P  ++  R S ++ ++TW   P+F +  + + IYY    T    +W    T   +T   +  L     Y +RV + S  G  G +S+ +  T+          +         + +++L W  S +   +  + + +SG+  ++ ENG V  +  + ++  +   +                 S  +  L+P  ++   I  IF       G   H    T    P  +E  ++S +   +  I + L+R + +NG I  Y++VV  LK       SVN +  + T+ +LI ++       S PYIA   + + + P         +  +G     G F N  LD
Sbjct:   11 RGGPPKITLAPKSQKVAEDGTASFFCKASGNPAPSIAWEKRGKTIVSRRTRYEIVDV-PHMSVLRIKPVRAAREDGLYTCVATNSLGEARANATLYVYKKDEVNGEFPSGYPRILLHPKLKSVEKGLSTIMQCEAAGEPDPTIMWLKDYVPVDLSDPRIQLLESGYLQIHNSQESDEATYECLAENELGVAYSYPAMMYVKVRRVPPRFSILPEDQNVMPGSDVNLTCVAVGSPMPLVKWRQGAYDLTDEDNVPVGK----NVLELKDVRESKNYTCEASSDLGNIEHVVQVIVEALPGSPTRLTASEVTASSVKLSWDSGSREPVYSYIIQFKPKHDAAADYTEKRNI----VHNV----------YTVTNLKAFTDYQFRVVAVSNIARSTPSAPLEVTTGELAPGTPPRNIRARAASSTTIVVSWDEPEIPNGIIQGYKVFYTLKPEDPVFFWEQQEVKNDNR------LTTISGLEPNQTYTISILAYSSIGPGPMSHPIQVLTTQGVPYQPLNLHAEAISPNEIVVKWDA-PQEAD-SIISYELYY---NDSHTRQNVRFSIHPPVSSYRLEDLTPDTVYHIQVSAKSSRGEGPRTPTVQVKTHAFVPEAPPQDVSGRPIDEHQ---IKVSWKP-PIANKQNGALAGYKIYFVANEAGKTDNDAIMKNVDSSSLSSILDGLSTWTEYKIWVVAYTAVGDGPASPPIVVQTDEDVPGE-PRKVKVEAINSTGIFVEWTEPKEPNGKIRGYQV----YYIEVNSNDEPIPGRAERYHDTFSGS-----TKEAVITGLDPDTRYLIQVAGYTRKGDGMRSNPRIITTKGAVPTPPRNLHVNL-IQEDPPSVKVTWQRPRDTYGSLENYKIIWGP--QGERYEEKIMSADV--YSYVTSTLD--RGTTYEFRVSAKNNVDYGERAVDTIRTPDGAPSGAPQNF---TATGLTETSVRLTWDLPARNLRNGDIVMYQITYHKLA-DAINEEDLNITDTFVDIVGLEMDTDYIFKIKAYTSRGAGPWSNRLHFRTFGRMPPPPQNVKVRRTSSTSIEVTWD-EPNFPV--AGYKIYYNMFATPAMYVWQQMETG-PYTVADIGGLEPHTVYAVRVQAKSVDGRFGNLSETV--TTDVKEVQRDNVVQNFHVTQRLTNLVRLSWSPS-EKPGVNIYLLKYSGVKTYR-ENGQVKQINQDPQEVRIPGQMT----------------SWTVKNLQPKMKFEFNISVIF--QDGETGPDVHITTETLINAPPYVEAPVVSAVEGGT--IVLKLERASEKNGPISHYHIVVVPLKSG-----SVNKMPSDFTMDDLIYDNMGMDKPASRPYIAARFEAQALPP---------QFYLGNGQEYGAFVNRPLD 1299          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A1S3HRJ8 (tyrosine-protein phosphatase Lar isoform X2 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 781.941 bits (2018), Expect = 0.000e+0
Identity = 374/628 (59.55%), Postives = 459/628 (73.09%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIPVE L+EH+  LK  D+  F++EYESIEPGQQFTW+ SN+E+N+PKNRYANVIAYDHSRVILQPL             ++GSDYINAN++ GY    AYIATQGPL ET  DFWRM+WEQ S+ IVMMT+LEER R KCDQYWPL G      +  + VTI+DI++LA YTIR F + +      RE+ QFQFTAWPDHGVP+HP PLLMF+RRV +    + GP++ HCSAGVGRTGAFIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTE+P   L  H++KL Q E       G  +TG+++EF+ L                          AH    T   P  + +A    N+ KNR++ ILP + +RV + PIRGV+GSDYINAS+IDGY+ R AYIA Q PL ET EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ALS ++ERM+ E V+DLFQTV++LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1419 ISHPPIPVEQLAEHIDRLKAQDNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPL-----------DAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRG---TENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPE------PGETVTGMELEFKRL--------------------------AH----TKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1995          

HSP 2 Score: 304.679 bits (779), Expect = 3.236e-79
Identity = 286/1134 (25.22%), Postives = 491/1134 (43.30%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQS--FTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQI-VTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTK-SLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT------QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS-LVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIP--EKNSKIN---IRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIED-PIEVHTRAVNSTAIEVFWQTNS-NKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNIT----MRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATIS-YVIRVSSVSNRGIEGPMSD 3838
            P I+   ++ K        F C   GNP+P I+W+ N +   T  +R+ V  + P  S+LRI PV+   +    TC A N +G +  + A L+VY N  E+P   P I+ + ++   EK+    ++C  +G P   I+WLKD IP+D  + RI  S++G L I+ +++ D+G YECVA N  G   S    L +RV+  +P F     + + V PG  + + C A+G+P+P V W+ G T L   +    G+     +IL D+ +S    C A +   +I     V ++     P  + ++ +   S  +SW   N  PI    + YK    K K  + +K+++              V+T+ ++  L+ +T Y   + + +       S     TT E  P TPP+NV    +S   + + WD P+IPNG+I  Y +YYT         ++P  +W    V          +   +  ++ N TY + +  + S G  P SE + +L R GV + P++ +   +   +I + W+  P  S   I  Y L Y   S    + + R    P   + L+  L P T Y   +   +    G  S +V+ TT   TP A P  V      I     I I W   P   +N +I    IR Y +++ G    + S+ T+  +     ++ +K    Y + +    R    P  +S  I  ++   +   P  V    VNSTAI V W + + +K        + ++G             DI   + + + +   I+       +   L PDS Y+  + ++T +  G+  K +  KT      +P+   + L  + + P V + W+        ++ Y+L Y  +  +   K++ +     + +   +S D  +G  Y F+++A N  + G++    I   +  P  +P NF   T S  + T    +W        NG+   YE+  +    ++  S +         ++ L+ +  Y  +++ +  K    WS    FKT      AP  I+  R S ST Q+TW   P+F I    + I+Y+   +F N+   + +  T       D +  T S Y +RV + S  G  G +SD
Sbjct:   34 PSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKWQKNGNDLGTSKQRYLVFDM-PFGSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEKDRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSESGTLNIMNSRKSDQGKYECVAENEAGVAYSYAANLYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNV---LILKDVQQSANYTCFAASDLGNIEAITQVKVKALPNPPVHLEISEVTATSVKLSWDEGNNDPIDSYIINYKP---KYKQGVESKSISG------------IVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTD--------KVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEK-PENSDDIITSYELYYQSPS----RGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTG---EIEGATAIIIKWSPPPLNARNGQITEYKIR-YVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGP--NSVPIVVRTDEAVPGRPERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKI-----------DISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSKGKIAKTLGAVPERPRSFRVNL-INEDPPMVQLVWQRPRNIYGALQAYKLEYGKVGSD---KFETIALEAEQYQRTVTSLD--RGAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNF---TMSAKTSTVAQLSWKPPPADQCNGRIIMYEIE-YYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTWN-APNFPI--KGYRIFYS---SFPNRDMDLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLDGRFGNLSD 1102          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A1S3HQ46 (receptor-type tyrosine-protein phosphatase delta isoform X4 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 374/628 (59.55%), Postives = 459/628 (73.09%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIPVE L+EH+  LK  D+  F++EYESIEPGQQFTW+ SN+E+N+PKNRYANVIAYDHSRVILQPL             ++GSDYINAN++ GY    AYIATQGPL ET  DFWRM+WEQ S+ IVMMT+LEER R KCDQYWPL G      +  + VTI+DI++LA YTIR F + +      RE+ QFQFTAWPDHGVP+HP PLLMF+RRV +    + GP++ HCSAGVGRTGAFIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTE+P   L  H++KL Q E       G  +TG+++EF+ L                          AH    T   P  + +A    N+ KNR++ ILP + +RV + PIRGV+GSDYINAS+IDGY+ R AYIA Q PL ET EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ALS ++ERM+ E V+DLFQTV++LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1337 ISHPPIPVEQLAEHIDRLKAQDNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPL-----------DAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRG---TENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPE------PGETVTGMELEFKRL--------------------------AH----TKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1913          

HSP 2 Score: 305.064 bits (780), Expect = 2.639e-79
Identity = 287/1139 (25.20%), Postives = 492/1139 (43.20%), Query Frame = 2
Query:  512 YKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQS--FTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQI-VTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTK-SLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT------QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS-LVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIP--EKNSKIN---IRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIED-PIEVHTRAVNSTAIEVFWQTNS-NKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNIT----MRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATIS-YVIRVSSVSNRGIEGPMSD 3838
            Y    P I+   ++ K        F C   GNP+P I+W+ N +   T  +R+ V  + P  S+LRI PV+   +    TC A N +G +  + A L+VY N  E+P   P I+ + ++   EK+    ++C  +G P   I+WLKD IP+D  + RI  S++G L I+ +++ D+G YECVA N  G   S    L +RV+  +P F     + + V PG  + + C A+G+P+P V W+ G T L   +    G+     +IL D+ +S    C A +   +I     V ++     P  + ++ +   S  +SW   N  PI    + YK    K K  + +K+++              V+T+ ++  L+ +T Y   + + +       S     TT E  P TPP+NV    +S   + + WD P+IPNG+I  Y +YYT         ++P  +W    V          +   +  ++ N TY + +  + S G  P SE + +L R GV + P++ +   +   +I + W+  P  S   I  Y L Y   S    + + R    P   + L+  L P T Y   +   +    G  S +V+ TT   TP A P  V      I     I I W   P   +N +I    IR Y +++ G    + S+ T+  +     ++ +K    Y + +    R    P  +S  I  ++   +   P  V    VNSTAI V W + + +K        + ++G             DI   + + + +   I+       +   L PDS Y+  + ++T +  G+  K +  KT      +P+   + L  + + P V + W+        ++ Y+L Y  +  +   K++ +     + +   +S D  +G  Y F+++A N  + G++    I   +  P  +P NF   T S  + T    +W        NG+   YE+  +    ++  S +         ++ L+ +  Y  +++ +  K    WS    FKT      AP  I+  R S ST Q+TW   P+F I    + I+Y+   +F N+   + +  T       D +  T S Y +RV + S  G  G +SD
Sbjct:   45 YVTHEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKWQKNGNDLGTSKQRYLVFDM-PFGSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEKDRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSESGTLNIMNSRKSDQGKYECVAENEAGVAYSYAANLYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNV---LILKDVQQSANYTCFAASDLGNIEAITQVKVKALPNPPVHLEISEVTATSVKLSWDEGNNDPIDSYIINYKP---KYKQGVESKSISG------------IVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTD--------KVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEK-PENSDDIITSYELYYQSPS----RGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTG---EIEGATAIIIKWSPPPLNARNGQITEYKIR-YVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGP--NSVPIVVRTDEAVPGRPERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKI-----------DISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSKGKIAKTLGAVPERPRSFRVNL-INEDPPMVQLVWQRPRNIYGALQAYKLEYGKVGSD---KFETIALEAEQYQRTVTSLD--RGAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNF---TMSAKTSTVAQLSWKPPPADQCNGRIIMYEIE-YYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTWN-APNFPI--KGYRIFYS---SFPNRDMDLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLDGRFGNLSD 1118          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A1S3HSZ8 (receptor-type tyrosine-protein phosphatase delta isoform X5 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 374/628 (59.55%), Postives = 459/628 (73.09%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIPVE L+EH+  LK  D+  F++EYESIEPGQQFTW+ SN+E+N+PKNRYANVIAYDHSRVILQPL             ++GSDYINAN++ GY    AYIATQGPL ET  DFWRM+WEQ S+ IVMMT+LEER R KCDQYWPL G      +  + VTI+DI++LA YTIR F + +      RE+ QFQFTAWPDHGVP+HP PLLMF+RRV +    + GP++ HCSAGVGRTGAFIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTE+P   L  H++KL Q E       G  +TG+++EF+ L                          AH    T   P  + +A    N+ KNR++ ILP + +RV + PIRGV+GSDYINAS+IDGY+ R AYIA Q PL ET EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ALS ++ERM+ E V+DLFQTV++LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1332 ISHPPIPVEQLAEHIDRLKAQDNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPL-----------DAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRG---TENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPE------PGETVTGMELEFKRL--------------------------AH----TKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1908          

HSP 2 Score: 240.35 bits (612), Expect = 1.462e-59
Identity = 185/675 (27.41%), Postives = 303/675 (44.89%), Query Frame = 2
Query:  512 YKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQS--FTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQI-VTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTK-SLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT------QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWRE-IPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSK 2491
            Y    P I+   ++ K        F C   GNP+P I+W+ N +   T  +R+ V  + P  S+LRI PV+   +    TC A N +G +  + A L+VY N  E+P   P I+ + ++   EK+    ++C  +G P   I+WLKD IP+D  + RI  S++G L I+ +++ D+G YECVA N  G   S    L +RV+  +P F     + + V PG  + + C A+G+P+P V W+ G T L   +    G+     +IL D+ +S    C A +   +I     V ++     P  + ++ +   S  +SW   N  PI    + YK    K K  + +K+++              V+T+ ++  L+ +T Y   + + +       S     TT E  P TPP+NV    +S   + + WD P+IPNG+I  Y +YYT         ++P  +W    V          +   +  ++ N TY + +  + S G  P SE + +L R GV + P++ +   +   +I + W+  P  S   I  Y L Y   S    + + R    P   + L+  L P T Y   +   +    G  S V   TT +  P   +   +       I + W    P+K + I IR Y     G   +  S+Q IGS+
Sbjct:   45 YVTHEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKWQKNGNDLGTSKQRYLVFDM-PFGSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEKDRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSESGTLNIMNSRKSDQGKYECVAENEAGVAYSYAANLYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNV---LILKDVQQSANYTCFAASDLGNIEAITQVKVKALPNPPVHLEISEVTATSVKLSWDEGNNDPIDSYIINYKP---KYKQGVESKSISG------------IVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTD--------KVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEK-PENSDDIITSYELYYQSPS----RGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFIPGRPERVRVETVNSTAIRVRWSSPAPDKRNGI-IRAYV-VIYGKIDIS-SMQLIGSR 684          

HSP 3 Score: 122.865 bits (307), Expect = 9.482e-24
Identity = 236/1122 (21.03%), Postives = 429/1122 (38.24%), Query Frame = 2
Query:  746 CLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTK-------VILECKVQGVPTLTIFWLKDSIPIDFENQR-----INTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMI-----RVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLT-GQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVK----KSDYEFVKTK-SLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSEL--------------PPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG---PKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTIL-----IGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKI--NIRIYFQSKLGN---FSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIED-PIEVHTRAVNSTAIEVFWQTNS-NKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNIT----MRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATIS-YVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRW 3940
            CLA   L   D     ++ AN   +   F   ++    I+    +K       V   CK  G P   I W K+   +    QR     +       +E +R + DD   + C ATN +G   S+  +L +      +   +P  +     + V      +++C   G P P +YW      +      +T  +    N++ S  S+  K  CVA+N +  ++ S +  +         +RV  + P                     F ++  + L   ++  G  IN+      S    V+ K  + +L P  +  +      ++     +N   F  S+L              P   PP ++E+  ++  +V ++WD  +  N  I +Y I Y     KP     K  V+S   S   +    ++ + + T Y   + A N+ G    SEP       G  Q    P++ RA   S++ + + WD  P      I+ Y + Y  +       E+ + Y+ Q   +      I +L PN TY   +   T+  +G PS      T +  P   +N    +     I + W E PE +  I  +  +Y+QS        ++QP +++         L+++     Y + ++ K      P   S  +   +  FI   P  V    VNSTAI V W + + +K        + ++G             DI   + + + +   I+       +   L PDS Y+  + ++T +  G+  K +  KT      +P+   + L  + + P V + W+        ++ Y+L Y  +  +   K++ +     + +   +S D  +G  Y F+++A N  + G++    I   +  P  +P NF   T S  + T    +W        NG+   YE+  +    ++  S +         ++ L+ +  Y  +++ +  K    WS    FKT      AP  I+  R S ST Q+TW   P+F I    + I+Y+   +F N+   + +  T       D +  T S Y +RV + S  G  G +SD  +E +        + +   +    SS  + L W
Sbjct:   17 CLASCRLSEADD---GNLRANTSTLEFRFVNYVTHEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKWQKNGNDLGTSKQRYLVFDMPFGSVLRIEPVRQRRDD-AMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEKDRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSESGTLNIMNSRKSDQGKYECVAEN-EAGVAYSYAANLY--------VRVRNVAPR--------------------FSIQPPEML---DVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNVLILKDVQQSANYTCFAASDLGNIEAITQVKVKALP--NPPVHLEISEVTATSVKLSWDEGN--NDPIDSYIINY-----KPKY---KQGVESKSISGIVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTT--GEQQPSTPPRNVRARPLSTSTLYVQWDE-PEIPNGLILGYQVYYTLKEEGENLAERPY-YTWQNMAVTDKVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTW-EKPENSDDIITSYELYYQSPSRGKVRVTIQPPVESY-------LLEDLIPATVYNIHVLAKSERGTGP--ESPVVQATTQEFIPGRPERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKI-----------DISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSKGKIAKTLGAVPERPRSFRVNL-INEDPPMVQLVWQRPRNIYGALQAYKLEYGKVGSD---KFETIALEAEQYQRTVTSLD--RGAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNF---TMSAKTSTVAQLSWKPPPADQCNGRIIMYEIE-YYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTWN-APNFPI--KGYRIFYS---SFPNRDMDLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLDGRFGNLSD--QEENCEQPPEIPQCVRSFTAVDTSSDYVVLDW 1047          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A1S3HQ57 (tyrosine-protein phosphatase Lar isoform X1 OS=Lingula unguis OX=7574 GN=LOC106157176 PE=4 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 374/628 (59.55%), Postives = 459/628 (73.09%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + + PIPVE L+EH+  LK  D+  F++EYESIEPGQQFTW+ SN+E+N+PKNRYANVIAYDHSRVILQPL             ++GSDYINAN++ GY    AYIATQGPL ET  DFWRM+WEQ S+ IVMMT+LEER R KCDQYWPL G      +  + VTI+DI++LA YTIR F + +      RE+ QFQFTAWPDHGVP+HP PLLMF+RRV +    + GP++ HCSAGVGRTGAFIVID MLER+R+E TVDIY +VT +R+QRNYMVQTEDQYIFI++ LLEAV CGNTE+P   L  H++KL Q E       G  +TG+++EF+ L                          AH    T   P  + +A    N+ KNR++ ILP + +RV + PIRGV+GSDYINAS+IDGY+ R AYIA Q PL ET EDFWR LWEHNS+I+VMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ALS ++ERM+ E V+DLFQTV++LR QRPA++QTEDQYQFCY AALEYL  F+
Sbjct: 1435 ISHPPIPVEQLAEHIDRLKAQDNLKFSQEYESIEPGQQFTWDNSNLEVNKPKNRYANVIAYDHSRVILQPL-----------DAITGSDYINANYMDGYRKQNAYIATQGPLPETFCDFWRMVWEQRSATIVMMTKLEERSRIKCDQYWPLRG---TENYGVMQVTILDIMDLATYTIRTFQLSRQGYPEKREVKQFQFTAWPDHGVPDHPTPLLMFMRRVKASTPPDSGPMITHCSAGVGRTGAFIVIDAMLERIRHERTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEIPARNLYAHLQKLTQPE------PGETVTGMELEFKRL--------------------------AH----TKANPSRFVSANLPVNKFKNRLVNILPYENTRVCLQPIRGVDGSDYINASYIDGYRYRGAYIATQGPLGETTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPSERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFIALSIVLERMRYEGVVDLFQTVRMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 2011          

HSP 2 Score: 305.064 bits (780), Expect = 2.979e-79
Identity = 287/1139 (25.20%), Postives = 492/1139 (43.20%), Query Frame = 2
Query:  512 YKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQS--FTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLG-STDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQI-VTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTK-SLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYT------QFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS-LVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIP--EKNSKIN---IRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIED-PIEVHTRAVNSTAIEVFWQTNS-NKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNIT----MRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATIS-YVIRVSSVSNRGIEGPMSD 3838
            Y    P I+   ++ K        F C   GNP+P I+W+ N +   T  +R+ V  + P  S+LRI PV+   +    TC A N +G +  + A L+VY N  E+P   P I+ + ++   EK+    ++C  +G P   I+WLKD IP+D  + RI  S++G L I+ +++ D+G YECVA N  G   S    L +RV+  +P F     + + V PG  + + C A+G+P+P V W+ G T L   +    G+     +IL D+ +S    C A +   +I     V ++     P  + ++ +   S  +SW   N  PI    + YK    K K  + +K+++              V+T+ ++  L+ +T Y   + + +       S     TT E  P TPP+NV    +S   + + WD P+IPNG+I  Y +YYT         ++P  +W    V          +   +  ++ N TY + +  + S G  P SE + +L R GV + P++ +   +   +I + W+  P  S   I  Y L Y   S    + + R    P   + L+  L P T Y   +   +    G  S +V+ TT   TP A P  V      I     I I W   P   +N +I    IR Y +++ G    + S+ T+  +     ++ +K    Y + +    R    P  +S  I  ++   +   P  V    VNSTAI V W + + +K        + ++G             DI   + + + +   I+       +   L PDS Y+  + ++T +  G+  K +  KT      +P+   + L  + + P V + W+        ++ Y+L Y  +  +   K++ +     + +   +S D  +G  Y F+++A N  + G++    I   +  P  +P NF   T S  + T    +W        NG+   YE+  +    ++  S +         ++ L+ +  Y  +++ +  K    WS    FKT      AP  I+  R S ST Q+TW   P+F I    + I+Y+   +F N+   + +  T       D +  T S Y +RV + S  G  G +SD
Sbjct:   45 YVTHEPSIIQSPQSKKAPNGGIVSFFCKASGNPAPDIKWQKNGNDLGTSKQRYLVFDM-PFGSVLRIEPVRQRRDDAMFTCTATNGVGEAASAQAQLTVYPNDMEMPRTAPKIVVQPNLKSVEKDRPASMQCATEGTPPPRIYWLKDYIPVDISDPRITVSESGTLNIMNSRKSDQGKYECVAENEAGVAYSYAANLYVRVRNVAPRFSIQPPEMLDVMPGGDINITCVAVGSPMPVVRWKLGVTDLAPVADAPLGKNV---LILKDVQQSANYTCFAASDLGNIEAITQVKVKALPNPPVHLEISEVTATSVKLSWDEGNNDPIDSYIINYK---PKYKQGVESKSISG------------IVETEHTITGLVSYTIYEFRVVAVNNIGRGRPSEPKECTTGEQQPSTPPRNVRARPLSTSTLYVQWDEPEIPNGLILGYQVYYTLKEEGENLAERPYYTWQNMAVTD--------KVANIRNLSPNRTYVVCVLGRTSVGDGPPSEYVEVLTRQGVPEQPRNLQTEVRGPDQIYVTWEK-PENSDDIITSYELYYQSPS----RGKVRVTIQPPVESYLLEDLIPATVYNIHVLAKSERGTGPESPVVQATTQEFTPSAPPQDVTG---EIEGATAIIIKWSPPPLNARNGQITEYKIR-YVETESGQQLQEASVVTVLGEKDSVVIRNLKIWTKYTIWVQAATRVGPGP--NSVPIVVRTDEAVPGRPERVRVETVNSTAIRVRWSSPAPDKRNGIIRAYVVIYGKI-----------DISSMQLIGSRKRHTISGGQVTETVITGLQPDSSYKFQVAAVTGKGDGIYSKGKIAKTLGAVPERPRSFRVNL-INEDPPMVQLVWQRPRNIYGALQAYKLEYGKVGSD---KFETIALEAEQYQRTVTSLD--RGAEYEFRLSARNTVDYGEKAVQNIKTPDSVPYGYPMNF---TMSAKTSTVAQLSWKPPPADQCNGRIIMYEIE-YYKKLDDINSFSLNVSQMETEVSGLETNEVYLFQIKAYTSKGPGPWSPKYQFKTYKQLPAAPTNIKLRRTSHSTIQVTWN-APNFPI--KGYRIFYS---SFPNRDMDLWTKKTIPPVTATDLIQLTDSCYYVRVQAQSLDGRFGNLSD 1118          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: ptprfb (protein tyrosine phosphatase receptor type Fb [Source:NCBI gene;Acc:799867])

HSP 1 Score: 768.459 bits (1983), Expect = 0.000e+0
Identity = 369/627 (58.85%), Postives = 451/627 (71.93%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PIPV  L++H+  LK ND   F++EYESI+PGQQFTW  SNME+N+PKNRYANVIAYDHSRVIL           +    V GSDYINAN+I GY    AYIATQGPL ET+ DFWRM+WEQ +S IVMMTRLEE+ R KCDQYWP+ G     T+  I VT++D +ELA Y++R F + K   +  REI QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG  IVID MLER+++E +VDIY +VT +RSQRNYMVQTEDQY+FI+E LLEA  CGNTEVP   L  HI+KL+Q         G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + SRV + PIRGVEGSDYINAS IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct: 1232 EHPPIPVSDLADHIERLKANDGLRFSQEYESIDPGQQFTWENSNMEVNKPKNRYANVIAYDHSRVIL-----------TSVDAVPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPIRG---TETYGMIQVTMLDTVELATYSVRTFALYKNGSSEKREIRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCLIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGNTEVPARNLYAHIQKLSQ------PPPGDTVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFETSRVCLQPIRGVEGSDYINASCIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1807          

HSP 2 Score: 232.646 bits (592), Expect = 1.391e-60
Identity = 258/1068 (24.16%), Postives = 451/1068 (42.23%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKI-SPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILE-CKVQGVPTLTIFWLKDSI--PIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM-PSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIP---EKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTN-SNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKF-NYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIY 3679
            P  V   ++   +    A F+C   G+P P+I W         +RF V +      S+LRI P++   ++    C A NS G  ++ A L+V                     + E+   V ++ C   G P   + W  +SI  P+ F +  I+   +G L+I  ++E D+G YECVA N+ GT  S+   L +RV+   P F     +Q V PG S+ L C A+G P+P V W  G+  L  + +   G+    NV+ L+++ +S    CVA +    +     VT++     PT++ VT     S  ++W   N +P+    ++Y+               +  T  + ++ D       S+  L P++ Y   + + +       S+ V   T E  P +PP +V+   +S   +L+ W+PP+ PNG I  Y IYYT   D  LS+W K+    S+        T +S +  + TY + +    S G  P S+ L +                                K+Q        +Y  + M     +    + P     + G L+PNT Y+F L+  ++   G+    +E  T   TP A P  V+   LS +    I++ +   P      + +   I +Q+  G  + +  ++ IG       L  +++   YKV +         P   + +I T+  V    P ++   A+NSTAI V W+   SNK    +H +I+ +    +R  + +P     I   ++  E+Q      +   L  ++ Y + + + T +  G   K++ IKT      KP  I   +S ++ N  + ++W+        + GY+LRY  +   DE  + V E   ++  +  +    ++G  Y F ++A N    G+E   +I   E +PS FP NF +     L+ T+   TW   +    NG+  NY  V+  + S +N    T +T    +TI+ LK D+ Y  RV+ +  +     S +I  +T         +     + +++  +TW+   +F       I+Y
Sbjct:    2 PTFVKTPEDQTGISGGVASFVCQAVGDPKPRITWMKKGKKVSSQRFEVIEFDGGSGSVLRIQPLRTHRDEAIYECTATNSAGDINTSAKLTV---------------------LEEQYFGVFVKLCGGAGRPRDAVGWRMNSIYSPL-FCSPAIHQVSSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPTNQEVMPGGSINLTCVAVGAPMPYVKWMVGEVELTKEEEMPIGR----NVLELTNIRQSANYTCVAISSLGMVETVAQVTVKALPKPPTSLTVTETTATSVTLTWDSGNPEPVSYYMIQYR---------------SKATDNSFQEVDGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSDPVETRTGEQAPSSPPLSVQARMLSASTMLVQWEPPEEPNGQIRGYRIYYTTDPDTQLSAWHKHNTDDSR-------LTTISGLITDVTYSLRVLGFTSVGDGPPSDVLQV--------------------------------KTQQGGCDLQTLYFFKFMLFFFPQILVTFDPAGFYAVEG-LKPNTLYKFSLAARSDMGLGVFTKPIEARTAQSTPSAPPQDVRLESLSSTS---IKVSYVAPPAASRHGAIVRYSISYQAASGEDTERHEVKDIGVDTLSYVLDGLEKWTEYKVCVRAHTDVGPGPESPAVRIKTREDVPGAPPRKLEVEALNSTAIRVTWKPPLSNK----QHGQIRGYQVIYSRLENGEPRGQPNILD-VALPEAQEA----VITGLLSETSYSVTVAAYTTKGDGARSKAKVIKTTGAVPGKPTMI---ISTTVGNTAL-IQWQPPKDMVGELVGYQLRYKRV---DEEAFTVRELRRTDDHYTVTGL--YKGATYTFHLSARNRAGNGEEHVKEISTQEEAPSGFPLNFSV---VGLTTTTTRLTWEPPALSERNGRIVNYVVVYRDINSQQNS---TNSTAETQMTIHGLKPDTTYDIRVQAFTSRGGGPISPSIQSRTMSTSPAFATSFGVKAVMKTSVLLTWELPENFKSQVPFKILY 961          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 361/629 (57.39%), Postives = 454/629 (72.18%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQ 7135
            + + PIP+  L+EH  LLK ND+   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVIL P+             ++GSDYINAN+I GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+    VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPI+ HCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQY FI++ LLEAV CGNTEV    L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRG+EGSDYIN+S+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+ 
Sbjct:  924 MNHPPIPITELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEG-----------ITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRG---TETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDH 1501          

HSP 2 Score: 219.935 bits (559), Expect = 6.161e-57
Identity = 168/612 (27.45%), Postives = 281/612 (45.92%), Query Frame = 2
Query:  584 FICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAK---NIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWR 2389
            F+C   G+P P++ W         +R    +      ++LRI P++   ++    C+A+NS G     A L++   +  +P GFP I     + V E+     + C   G P   I W KD +PID    N RI   ++G L+I  T+E D+G YECVA+N  G   SS   L +RV+   P F  +     + PG SV + C A+G+P+P V W      L  +     G+    NV+ L+ + ES    CVA     I E++S+ I  ++ +P   P    VT     S  I+W   N +P+    ++Y+   + +K           T+ ++  + Y      S+  L P T Y + + +F+       S  V   T E  P +PP+N++   IS   +++ W+ P+ PNG I  Y +++T    +P+S W  + V  S        TTI + +A+  TY I + A  S G  P S+P+ + +  GV   P  F+    + T IEL W+      +  I  Y L Y   S   +  +    +SP  + ++ G L+ NT Y F L+ ++N   G+ +     +   +   + KN+ + ++ R  + + W+
Sbjct:   53 FVCQATGDPKPRVSWNKKGKRVNSQRIETIEFDEGAGAVLRIQPLRAPRDENIYECVAENSEGEVSVQAKLTII-REDLLPPGFPNIDMGPQLKVVERTRTANMLCAASGNPDPEITWFKDFLPIDPSASNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPASHEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDDMPVGR----NVLELNSVRESANYTCVAMSSLGIIEAVSQIIVKSLPKPPGTPI---VTETTATSITITWDSGNPEPVSHYIIQYRAKTLDSK---------FETMDSITTTRY------SIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVI------TTIQNLVASE-TYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTWEPF---EKEGITRYELHYKEGSQGSMVTKT---FSPSSSYMVEG-LRANTEYFFSLAAVSN--KGIGAFTNEISQKTSQANVPKNFTVKLATRTTVLLTWK 625          

HSP 3 Score: 71.2478 bits (173), Expect = 1.435e-11
Identity = 134/604 (22.19%), Postives = 262/604 (43.38%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDD----NKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTP--GSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKES-ISRSISVTI--QEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLR-YKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG 2281
            P I +  +   V R   A  +CA  GNP P+I W   + F LP   S +    K+  LR   +++++    ++ +  C+A N  G   S +  ++Y   + +P  F +I+  S  I+      V + C   G P   + W+ +S  +  E+  +   +N  LE+   +E     Y CVA ++LG ++ +V +++++      +  K  G  IVT    +S+T+   + GNP P  ++     I+Q ++K L  +    + I         LS  +E    +     I +   S  +      Q P++ P  I+   I  ++  + W +       ++ Y+VF   T D   ++ ++   I NV  S        ++QNL+    YT+ + +F+   D   S+ +     +  P  P K  ++G +++  + +TW+P +     IT Y ++Y +     + +          K+ SP  + ++  +  NT Y+ S++A ++ G    +  ++       V  PK+F     + T + L W    S+ +           P S       ++ +   +    LI +L+PN+TYEF +S   ++++G
Sbjct:  136 PNIDMGPQLKVVERTRTANMLCAASGNPDPEITWF--KDF-LPIDPSASNGRIKQ--LRSGALQIENTEETDQGKYECVASNVEGVRYS-SPANLYVRVRRVPPRF-SILPASHEIM--PGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDD-MPVGRN-VLELNSVRES--ANYTCVAMSSLG-IIEAVSQIIVK------SLPKPPGTPIVTETTATSITITWDS-GNPEPVSHY-----IIQYRAKTLDSKFETMDSITTTRYSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFF--TMD--PSQPVSMWQIHNVHDS-----VITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSK-FQIGEVTDTTIELTWEPFEKEG--ITRYELHYKEGSQGSMVT----------KTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQANV--PKNFTVKLATRTTVLLTWKFSDSRFR----------QPYSCKIEYNRQKVNIDARMTKELITNLRPNSTYEFHISCPLDSSDG 679          

HSP 4 Score: 55.4546 bits (132), Expect = 1.047e-6
Identity = 118/583 (20.24%), Postives = 231/583 (39.62%), Query Frame = 2
Query: 2948 KKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEG--SPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXX---XXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWK-WNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPS-SLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRN-----------EISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIA 4642
            K LPKP    +    +  +  +T+ W  D  N + +  Y ++Y    +  + K++ ++ +++ +++            Y  +VAAFN    G   ++ ++   G  +P+  P N + +    +S +++M  W +  +   NG+   Y V+ F +      S         +   TI NL     Y  RV  +       +SD I+ K        P   +   ++ +T ++TW+ +  + +  Y    ++Y       ++  ++  T +  +  +++ L A   Y   +++VSN+GI G  ++ I + + + +N P  F  +L+    + T + L W  S      + FR  +S   ++  +   +    D +    L++N                        L+PN+ Y   I     P  +  G S H + +  +  PS  +    L    +  N I I+L  P      I   YVVV  LK+    +R+   +D   +  L ++ +  +            ++  PYIA S +     P S P        +G   +   F+N  L+P   Y F I+A
Sbjct:  317 KSLPKPPGTPIVTETTATS--ITITW--DSGNPEPVSHYIIQYR--AKTLDSKFETMD-SITTTRYSIGGLS--PNTEYEIRVAAFNTIGQGPA-SEPVEARTGEQAPASPPRNIQARI---ISQSTMMVRWEEPEEP--NGQIKGYRVF-FTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTWEPFEKEGITRYE---LHYKEG----SQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGI-GAFTNEISQKT-SQANVPKNFTVKLA----TRTTVLLTWKFSD-----SRFRQPYSCKIEYNRQKVNI----DARMTKELITN------------------------LRPNSTYEFHIS---CPLDSSDGGSRHRLVA--RTAPSIPVNKPELDTQREPDNTITIILP-PLQNREMIKSVYVVVVPLKKGRGPMRNPEEMD---LDELFKDVNIKQRHVRTARQLRQIDMKKPYIAASFR-----PTSMP----STFTLGNQMVYNGFENRMLEPGLEYVFFILA 819          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 361/629 (57.39%), Postives = 454/629 (72.18%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQ 7135
            + + PIP+  L+EH  LLK ND+   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVIL P+             ++GSDYINAN+I GY    AYIATQGPL ET GDFWRM+WEQ S+ +VMMTRLEE+ R KCDQYWP  G     T+    VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPI+ HCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQY FI++ LLEAV CGNTEV    L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRG+EGSDYIN+S+IDGY+ +KAYIA Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+ 
Sbjct:  899 MNHPPIPITELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEG-----------ITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWPSRG---TETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVE------PGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDH 1476          

HSP 2 Score: 222.631 bits (566), Expect = 9.691e-58
Identity = 172/632 (27.22%), Postives = 287/632 (45.41%), Query Frame = 2
Query:  524 PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAK---NIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWR 2389
            PPK      +M  +      F+C   G+P P++ W         +R    +      ++LRI P++   ++    C+A+NS G     A L++   +  +P GFP I     + V E+     + C   G P   I W KD +PID    N RI   ++G L+I  T+E D+G YECVA+N  G   SS   L +RV+   P F  +     + PG SV + C A+G+P+P V W      L  +     G+    NV+ L+ + ES    CVA     I E++S+ I  ++ +P   P    VT     S  I+W   N +P+    ++Y+   + +K           T+ ++  + Y      S+  L P T Y + + +F+       S  V   T E  P +PP+N++   IS   +++ W+ P+ PNG I  Y +++T    +P+S W  + V  S        TTI + +A+  TY I + A  S G  P S+P+ + +  GV   P  F+    + T IEL W+      +  I  Y L Y   S   +  +    +SP  + ++ G L+ NT Y F L+ ++N   G+ +     +   +   + KN+ + ++ R  + + W+
Sbjct:   21 PPKFTKVPVDMIGVSGGVVSFVCQATGDPKPRVSWNKKGKRVNSQRIETIEFDEGAGAVLRIQPLRAPRDENIYECVAENSEGEVSVQAKLTII-REDLLPPGFPNIDMGPQLKVVERTRTANMLCAASGNPDPEITWFKDFLPIDPSASNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPASHEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDDMPVGR----NVLELNSVRESANYTCVAMSSLGIIEAVSQIIVKSLPKPPGTPI---VTETTATSITITWDSGNPEPVSHYIIQYRAKTLDSK---------FETMDSITTTRY------SIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNVHDSVI------TTIQNLVASE-TYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTWEPF---EKEGITRYELHYKEGSQGSMVTKT---FSPSSSYMVEG-LRANTEYFFSLAAVSN--KGIGAFTNEISQKTSQANVPKNFTVKLATRTTVLLTWK 613          

HSP 3 Score: 72.0182 bits (175), Expect = 9.381e-12
Identity = 134/604 (22.19%), Postives = 262/604 (43.38%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDD----NKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTP--GSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKES-ISRSISVTI--QEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLR-YKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG 2281
            P I +  +   V R   A  +CA  GNP P+I W   + F LP   S +    K+  LR   +++++    ++ +  C+A N  G   S +  ++Y   + +P  F +I+  S  I+      V + C   G P   + W+ +S  +  E+  +   +N  LE+   +E     Y CVA ++LG ++ +V +++++      +  K  G  IVT    +S+T+   + GNP P  ++     I+Q ++K L  +    + I         LS  +E    +     I +   S  +      Q P++ P  I+   I  ++  + W +       ++ Y+VF   T D   ++ ++   I NV  S        ++QNL+    YT+ + +F+   D   S+ +     +  P  P K  ++G +++  + +TW+P +     IT Y ++Y +     + +          K+ SP  + ++  +  NT Y+ S++A ++ G    +  ++       V  PK+F     + T + L W    S+ +           P S       ++ +   +    LI +L+PN+TYEF +S   ++++G
Sbjct:  124 PNIDMGPQLKVVERTRTANMLCAASGNPDPEITWF--KDF-LPIDPSASNGRIKQ--LRSGALQIENTEETDQGKYECVASNVEGVRYS-SPANLYVRVRRVPPRF-SILPASHEIM--PGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDD-MPVGRN-VLELNSVRES--ANYTCVAMSSLG-IIEAVSQIIVK------SLPKPPGTPIVTETTATSITITWDS-GNPEPVSHY-----IIQYRAKTLDSKFETMDSITTTRYSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFF--TMD--PSQPVSMWQIHNVHDS-----VITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSK-FQIGEVTDTTIELTWEPFEKEG--ITRYELHYKEGSQGSMVT----------KTFSPSSSYMVEGLRANTEYFFSLAAVSNKGIGAFTNEISQKTSQANV--PKNFTVKLATRTTVLLTWKFSDSRFR----------QPYSCKIEYNRQKVNIDARMTKELITNLRPNSTYEFHISCPLDSSDG 667          

HSP 4 Score: 55.4546 bits (132), Expect = 8.818e-7
Identity = 118/582 (20.27%), Postives = 230/582 (39.52%), Query Frame = 2
Query: 2948 KKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEG--SPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXX---XXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPS-SLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRN-----------EISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIA 4642
            K LPKP    +    +  +  +T+ W  D  N + +  Y ++Y    +  + K++ ++ +++ +++            Y  +VAAFN    G   ++ ++   G  +P+  P N + +    +S +++M  W +  +   NG+   Y V+ F +      S         +   TI NL     Y  RV  +       +SD I+ K        P   +   ++ +T ++TW+  P      + + ++Y       ++  ++  T +  +  +++ L A   Y   +++VSN+GI G  ++ I + + + +N P  F  +L+    + T + L W  S      + FR  +S   ++  +   +    D +    L++N                        L+PN+ Y   I     P  +  G S H + +  +  PS  +    L    +  N I I+L  P      I   YVVV  LK+    +R+   +D   +  L ++ +  +            ++  PYIA S +     P S P        +G   +   F+N  L+P   Y F I+A
Sbjct:  305 KSLPKPPGTPIVTETTATS--ITITW--DSGNPEPVSHYIIQYR--AKTLDSKFETMD-SITTTRYSIGGLS--PNTEYEIRVAAFNTIGQGPA-SEPVEARTGEQAPASPPRNIQARI---ISQSTMMVRWEEPEEP--NGQIKGYRVF-FTMDPSQPVSMWQIHNVHDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVTDTTIELTWE--PFEKEGITRYELHYKEG----SQGSMVTKTFSPSSSYMVEGLRANTEYFFSLAAVSNKGI-GAFTNEISQKT-SQANVPKNFTVKLA----TRTTVLLTWKFSD-----SRFRQPYSCKIEYNRQKVNI----DARMTKELITN------------------------LRPNSTYEFHIS---CPLDSSDGGSRHRLVA--RTAPSIPVNKPELDTQREPDNTITIILP-PLQNREMIKSVYVVVVPLKKGRGPMRNPEEMD---LDELFKDVNIKQRHVRTARQLRQIDMKKPYIAASFR-----PTSMP----STFTLGNQMVYNGFENRMLEPGLEYVFFILA 807          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 366/626 (58.47%), Postives = 452/626 (72.20%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+ KNRYANVIAYDHSRV+L           S    + GSDYINAN+I GY    AYIATQG L ET GDFWRM+WEQ S+ IVMMT+LEER R KCDQYWP  G     T+  I VT++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQY+FI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              AN  +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1345 HPPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL-----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRG---TETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ANTKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1919          

HSP 2 Score: 293.123 bits (749), Expect = 4.187e-79
Identity = 266/1030 (25.83%), Postives = 446/1030 (43.30%), Query Frame = 2
Query:  512 YKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDF--ENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVN-IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMI-VKNWDLSISKRGGIEICWREIP-EKNSKINIR--IYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLH--GYFPNRENHNKPLKDIYIKKTM-SNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIEN-PCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEV-WCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTR 3559
            + + PPK +    +   ++   A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G   +   L+V    Q +P+GFPTI     + V E+     + C   G P   I W KD +P++    N RI   ++G L+I +++E D+G YECVATNN GT  S+   L +RV+   P F     D  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P  + VT     S  ++W+      E + Y +   K+K        +   I  V  + Y      S+  L P+++Y   + + +       S  +   T+E  P T P+ V    +S    +I W+ P+  NG I  Y +YYT    + ++ W+K  V+++           +  +  N TYYI + A  S G  P+S  L I+ + GV   P  F+A AKS T I L W + P   Q N I  Y L+Y  +     K+EKR  +     T L+  L+P TTY FQL+  +    G  +      TP+  P    +    S      I + W+  P E  + I I+  I + +  G  +    +  I  +     L+ +++   Y+V +         P      I T+  V    P +V   AVNS++++V W++     +  +    Q+H    F      +  +KDI I        +S    M  +  +L  ++ Y + + + T +  G   K + + T      KP     RL  S  N     ++W         ++GYRLR+      D     V+E    E+ + T      +G  Y F+++A N+   G+E   +I   E +PS FP +   ++ +    T++  +W  V     NG    Y + +  + S  + +          + ++ LK D+ Y  ++  +  K    +S +I F+T+
Sbjct:   24 HAETPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLREDQ-LPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSG--NPEPVSYYIIQHKSK----YSEDSYKEIDGVATTRY------SVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNAN-------FLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDE---KEEKRVSFE-STTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLENLEKWTEYRVTVTAHTDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEM--VLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMGAVPEKP-----RLMVSPTNMGTALLQWHPPPNTHGPLQGYRLRF---GRKDVEPLTVIEFPERENHYTTKEIH--KGASYTFRLSARNKVGFGEETVKEISTSEDTPSGFPQSIVAESATT---TTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQ 1010          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 366/626 (58.47%), Postives = 452/626 (72.20%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+PGQQFTW  SN+E+N+ KNRYANVIAYDHSRV+L           S    + GSDYINAN+I GY    AYIATQG L ET GDFWRM+WEQ S+ IVMMT+LEER R KCDQYWP  G     T+  I VT++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQY+FI++ LLEAV CGNTEVP   L  +I+KL QIE       G  +TG+++EF+ L              AN  +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1331 HPPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL-----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRG---TETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIET------GENVTGMELEFKRL--------------ANTKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1905          

HSP 2 Score: 293.508 bits (750), Expect = 3.186e-79
Identity = 265/1030 (25.73%), Postives = 447/1030 (43.40%), Query Frame = 2
Query:  512 YKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVN-IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMI-VKNWDLSISKRGGIEICWREIP-EKNSKINIR--IYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQT--NSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTM-SNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIEN-PCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEV-WCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTR 3559
            + + PPK +    +   ++   A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G   +   L+V    Q +P+GFPTI     + V E+     + C   G P   I W KD +P++  N   RI   ++G L+I +++E D+G YECVATNN GT  S+   L +RV+   P F     D  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P  + VT     S  ++W+      E + Y +   K+K        +   I  V  + Y      S+  L P+++Y   + + +       S  +   T+E  P T P+ V    +S    +I W+ P+  NG I  Y +YYT    + ++ W+K  V+++           +  +  N TYYI + A  S G  P+S  L I+ + GV   P  F+A AKS T I L W + P   Q N I  Y L+Y  +     K+EKR  +     T L+  L+P TTY FQL+  +    G  +      TP+  P    +    S      I + W+  P E  + I I+  I + +  G  +    +  I  +     L+ +++   Y+V +         P      I T+  V    P +V   AVNS++++V W++   + +  +   Y++     F      +  +KDI I        +S    M  +  +L  ++ Y + + + T +  G   K + + T      KP     RL  S  N     ++W         ++GYRLR+      D     V+E    E+ + T      +G  Y F+++A N+   G+E   +I   E +PS FP +   ++ +    T++  +W  V     NG    Y + +  + S  + +          + ++ LK D+ Y  ++  +  K    +S +I F+T+
Sbjct:   24 HAETPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLREDQ-LPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGR----NVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSG--NPEPVSYYIIQHKSK----YSEDSYKEIDGVATTRY------SVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVRNAN-------FLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQIIAKTGVPSQPMDFKAEAKSETSILLSWVAPPQSGQDNQITGYELLYKRKDE---KEEKRVSFE-STTTYLLKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLENLEKWTEYRVTVTAHTDVGPGPESLPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWRSPVPNRQHGQIRGYQVHYVRMFNGEPVGHPVIKDILIDDAQWEYDDSTEYEM--VLTDLQAETTYSVTVAAYTTKGDGARSKPKLVTTMGAVPEKP-----RLMVSPTNMGTALLQWHPPPNTHGPLQGYRLRF---GRKDVEPLTVIEFPERENHYTTKEIH--KGASYTFRLSARNKVGFGEETVKEISTSEDTPSGFPQSIVAESATT---TTIQVSWQPVLLAERNGIIIKYALQYKDINSPRSPSELFIAAPESTVILDGLKADTTYDIKMCAFTSKGPGPYSPSIQFRTQ 1010          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 483.411 bits (1243), Expect = 1.300e-149
Identity = 283/687 (41.19%), Postives = 391/687 (56.91%), Query Frame = 2
Query: 5105 RFKNHGANYLDV-----NKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQ-QFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQG--PLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLND----NNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFF 7129
            ++K++G N L +        ++ S P LL RS  P T             NR  +Y P+ V+ L E  +    +D+KLF +E+ S+     Q T   ++ E N+ KNRY N++ YD+ RV L  L             V  SDYINA++++GY     +IA QG  P  ET+ D+WRM+WE N++ IVM+T L+ER   KC QYWP  G     T+  + V++ D+  L  YTIRKF IQ + D       R I QF FT+WPD GVP  P  +L FL++V +      GPIVVHCSAGVGRTG FIVID ML+ ++ E  VD++ +VT IR+QR  MVQT+ QY+FIY+ LLE    G+TE+ V  L  H++KL     N  T  G   TGL+ EF+ L                                   Q     T     N  KNR+LQI+P DF+RV I   RG E +DYIN S+IDGY+ + A++A Q PL +T EDFWR +WE  S  +VMLT+L+E  +E+  +YWP + +  Y   I++   E +  +Y +R+F +++TR+++SR IRQF F  W E   IP   +  + LI  V K +   G + PI VHCSAG+GRTG F AL  I+ER+K E ++D+FQTVK LR QRP ++QT +QY+FCY    EY++ F
Sbjct:  127 KYKHNGTNSLRLANGRGEDAEMQSMP-LLARS--PST-------------NR--KYPPLAVDRLEEEFNRRSADDNKLFREEFNSLPSCPIQATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEG-----------VPDSDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWPDQG---CWTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKL----YNKNTPTGC--TGLEDEFKKLT------------------------------TVKIQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEI-GIPEDGKGMISLIAAVQKQQQHTG-NHPITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAF 743          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 445.662 bits (1145), Expect = 2.460e-138
Identity = 232/471 (49.26%), Postives = 299/471 (63.48%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSE--ISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKS-RKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNR 6658
            + PIPV   + HV  LK ND+ LF++EYESI+PGQQFTW+ SN+EIN+ KNRYANV+AYDHSRVIL  +             V GSDYINAN+I GY    AYIA+QGPLA+T+ DFWRM+WEQ SS IVMMT+LEER R KCDQYWP   +GS  ++  + VT+ D +ELA Y+ R F + +      R++ QFQFTAWPDHGVP  P P+L FLRRV +    S + GP++VHC       G F V  +M E      TV +Y  VT +R+QRNYMVQTE+QY F++  L+EAV  G TE P   L  H+++L+Q  ++H      + TGL +EF+ L +S                                +  T  +    CN++KNR+L ++PPD SRV +  IRG +GSDYINAS+IDGY+S ++AYIA Q PL ET ED WR LWE NS+IVVMLT+L+E  R
Sbjct:  177 HPPIPVSEFAGHVERLKANDNMLFSQEYESIDPGQQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDG-----------VPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWP--NRGS-ESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQ-SVSHTEP---RTTGLHLEFQRLQMS------------------------------KLRVSTAPSGALPCNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLREMGR 599          

HSP 2 Score: 168.703 bits (426), Expect = 1.364e-43
Identity = 92/247 (37.25%), Postives = 132/247 (53.44%), Query Frame = 2
Query: 6374 QPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALE 7114
            Q  T++ +    N+ KNR   ++  D SRV +  I GV GSDYINA++IDGY+   AYIA+Q PL++T  DFWR +WE  SS +VM+T+L+E  R +  QYWP + S  Y    V       + TY  R F LT +  ++ R +RQFQFT W +   +P      L  + +V          GP++VHC   S   G F     + E       + L+  V  +R QR  ++QTE+QY F + A +E
Sbjct:  211 QQFTWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPD-HGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVE 456          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 381.719 bits (979), Expect = 5.250e-115
Identity = 228/646 (35.29%), Postives = 343/646 (53.10%), Query Frame = 2
Query: 5264 IPVEALSEHVSLLKENDSKLFNKEYESIE---PGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQ--KLNDN-----------NVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHC--SAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCEL-AHHIEKLN--QIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSS-RYQFFIV-----DPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYL 7120
            +PV+  + HV  + E     F++E+E ++        T   SN   N+ KNRY N++AYDHSRV L+PL  + + +         SDYINAN++ GY   KAYIA QGPL  T  DFWRM+WEQN+ +IVM+T L E+ R KCDQYWP     S   +  I VT+     LA YT+R F I+  KL              N R + QF +T WPD G P++  P+L F+R+  +  +   GP+VVHC  SAGVGRTG +IV+D ML+++R   TV++  ++ +IR+QRNY+VQ ++QY FI+E+LLEAV  G TEV   +L A++   L+    ++        + T L+ +F  +                  + CS   +             + +AT+ CN+ KNR   I+P + SRV +  + G+EG+DYINAS+I GY     +I  Q PL  T  DFWR +W+HN+ I+VML   +    + S  YWP +  +     F V     D +   N    +I +F L   +D     +R +Q   W ++E    +    +++I +   T+     DGP ++H   G    G F AL+ ++ +++ +  +D+FQ  K++   RP +    +QY F Y AAL  +
Sbjct:   71 LPVKLFARHVGEMHEGALHSFSQEFEEVQRCTADLGITAEHSNHPENKHKNRYVNIVAYDHSRVRLRPLPGKDSKH---------SDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWP---SESNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSILSPAATDVTRPVVTATENTHLEKQFRLV------------------TQCSVRQSE------------FFSATKHCNKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDESV-YWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEGPLSNAFEIINVIREEATTR-----DGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRAALSLI 668          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 383.645 bits (984), Expect = 3.563e-109
Identity = 228/625 (36.48%), Postives = 330/625 (52.80%), Query Frame = 2
Query: 5270 VEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCEL-AHHIEKLN---QIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYII-REFKLTDTRDSQS--RVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLK 7123
            V  L EH+  +K  +   F +EYES   GQ   W+ +  + NR KNRY N+IAYDHSRV+L  L +++NS           DYINAN++ GY     YIATQGPL +T+G FWRM+W++ S+ I+M+T L E  R KC +YWP G       +  I VT+ D   L+ Y IR F +++    ++RE+ QF FT WPDHGVP H   LL F+RR+ +    + GP+VVHCSAG GRTG ++VID ML+    E  +DIYN V  +R++R  MVQTE+QY+FI++ +LEA  CG+T +P  +  A + E L    Q   NH          ++ EF+ L +                    TP     +      P  +E         KNR   +LPPD     +  I G + S+YINA+ +D Y+   A+I  Q PL  T +DFWR +++++ + +VML +L  N  +   QYWP +    +    V+ VA +NM   II R F++ +    Q   R++ QF +  W     +P S   FL L+    + + + G DG  +VHC     R      LS +     +   I + + V+ +      L+  + QYQFCY  ALEYL+
Sbjct:  900 VADLLEHIGQMKTGEGYGFKEEYESFFEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVMLNVLDEEQNS-----------DYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGS----DVYGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGDFRAAYAEMLRPDPQSSSNH----------IKDEFQTLNM-------------------VTPPLRVEDCSIALLPRNHE---------KNRYHDVLPPDRCLPFLITING-DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSN--KYCPQYWPEEGMLCHGPIQVEFVA-FNMEGDIITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAIYKGLVNLQSQYQFCYDVALEYLE 1467          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.043 bits (876), Expect = 4.949e-103
Identity = 209/612 (34.15%), Postives = 314/612 (51.31%), Query Frame = 2
Query: 5264 IPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFIS-GYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHC--SAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVA---EYNMTTYIIREFKLTDTRDSQSRV--IRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLG-QDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQ 7072
            I V  L +H+  +K  +   F +EYES   GQ   W  +  + NR +NRY N+IA  HS+ +   +  QR         V   DY  A     GY   + YIATQGPL ET  DFWRM+W++ SS IVM+T L E  R KC +YWP            I VT++    LA Y IR F +++    +  E+ QF FT WPDHGVP     LL F+RRV +      GPI+ HC  SAG GRTG ++VID MLE    E  +D+YN V  +R QR  MVQTE+QY+FI++ LLEA  CG+T +P         +L +++    +      T L+ EF  L                   +  TP+    +      P          N  KNR+ + LPPD     +  + G + S+YINA+ +D Y    A+I  Q PL  T +DFWR +++++ + V+ML +++ +  E   QYWP + S +Y    V+ ++   + ++ + I R   ++  +D    V  ++  Q+  W      P S   FL +  +V +   +L  ++G  +VHC +G GR+G + A+S + + +K +SV+D+F  VK LR  +P +++
Sbjct:    3 IRVADLLQHIGQMKSTEGCGFKEEYESFLDGQSAPWQVAKKDENRGRNRYGNIIALKHSQKL--KVRKQR---------VLSQDYTEAYVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWP----DDTQQLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLEACLCGDTAIPAANFRSAYLELTRLDPQTHS------TPLKEEFMTL-------------------NTVTPALRAEDCSIALLPR---------NSSKNRVKEALPPDRCLPFLLTLEG-DSSNYINAALLDSYHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEMRPS--ETCPQYWPEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKPDMVE 562          

HSP 2 Score: 131.339 bits (329), Expect = 1.693e-31
Identity = 82/251 (32.67%), Postives = 130/251 (51.79%), Query Frame = 2
Query: 6374 QPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWID--GYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHC--SAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALE 7114
            Q   ++ A +  N+ +NR   I+    S+      + V   DY  A +++  GY+ ++ YIA Q PL ET  DFWR +W+  SS +VM+T L E  R + F+YWP   + +     V  +    +  Y+IR F +       +  +RQF FT W +   +P      L  + +V  +     + GPI+ HC  SAG+GRTG ++ +  ++E    E VID++  V+ LR QR  ++QTE+QY F +   LE
Sbjct:   34 QSAPWQVAKKDENRGRNRYGNIIALKHSQKLKVRKQRVLSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWP-DDTQQLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPD-HGVPAFATGLLSFVRRVKASNPP--EAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLE 279          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 139.043 bits (349), Expect = 6.512e-36
Identity = 99/286 (34.62%), Postives = 142/286 (49.65%), Query Frame = 2
Query: 5393 NRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFI-----SGYLNPKAYIATQGPLAETIGDFWRMMWEQ---NSSVIVMMTRLEERDRTKCDQYWPLGG----------------KGSISTF-SYINVTIVDIIELA-YYTIRKFHIQKLND--NNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYML----------ERLRY------ENTVD-IYNYVTNIRSQRNYMVQTEDQYIFIY 6115
            N  +NRY N++ Y+ +RV L+ L              SG+DYINA+++        + P  YIATQGP  +T   FW+M +     ++ VIVM+T L E +R KC QYWP GG                   ++ F S + +  V++ ++  YYT+    +   +     V+ +  F F  W D   P    P++      HS  SR   PI+VHCSAGVGRTG FI +D+++          ER R+      E T D I   V  +RSQR  MVQT+DQ++FIY
Sbjct:   52 NDARNRYVNIMPYERNRVHLKTL--------------SGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNKPEEVVPIMELCAHSHSLNSRG-NPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          

HSP 2 Score: 107.842 bits (268), Expect = 2.625e-25
Identity = 88/290 (30.34%), Postives = 137/290 (47.24%), Query Frame = 2
Query: 6410 NQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWID----------GYKSRKAYIAAQSPLSETCEDFWRTLWEH---NSSIVVMLTQLKENNRERSFQYWP-------VKRSSRYQ------------------FFIVDPVAEYNMTTYIIREFKLTDTRD--SQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALS----------NIIERMKN------ESVIDLFQTVKL-LRWQRPALLQTEDQYQFCYVAA 7108
            N  +NR + I+P + +RV++   + + G+DYINAS++           GY     YIA Q P  +T + FW+  + +   ++ ++VM+T L E NRE+ +QYWP       V+ +S+++                  F  V  V +Y    Y + + KLT T       + +  F F  W++    P      ++L    H       +  PI+VHCSAG GRTG F+AL           NI ER ++      E   DL + + L LR QR  ++QT+DQ+ F Y AA
Sbjct:   52 NDARNRYVNIMPYERNRVHL---KTLSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDY----YTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMNK-PEEVVPIMELCAHSHSLN---SRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHAA 325          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 110.153 bits (274), Expect = 1.529e-24
Identity = 102/356 (28.65%), Postives = 153/356 (42.98%), Query Frame = 2
Query: 5333 EYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQ-----PLFDQRNSNFSET-------PI------VSGSDYINANFIS-GYLNPK-AYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIV------DIIELAYYTIRKFHIQKL---NDNNVRE---------------------IFQFQFTAWPD------------HGVPN----HPAPLLMFLRRV----------HSEI---SRNCGPIVVHCSAGVGRTGAFIVIDYMLERL----RYENTVDIYNY--------VTNIRSQRNYMVQTEDQYIFIYETLL 6127
            +YE  E  Q FT           KNRY+N++ Y+HSRV L      P   + ++  ++T       P+         +DYINAN++    +NP   YIATQ PL  T+ DFW+++      VI+ +   +E +  K D YW        +  SY N TI       +I  +    +R F ++K    NDN  ++                     ++Q Q+  W D            H V N    +P   +  L +           +SE+   + N  P++VHCSAG GRTG F+ +D++L  L     + N +D++N         V  +R QR  MVQ   QYI  YE LL
Sbjct:  399 DYELTEGIQSFT-----------KNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYW--------NNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALL 735          

HSP 2 Score: 76.2554 bits (186), Expect = 4.718e-14
Identity = 84/346 (24.28%), Postives = 136/346 (39.31%), Query Frame = 2
Query: 6386 YETATQICNQMKNRILQILPPDFSRVNI-------------------------CPIRG----VEGSDYINASWIDGYKSRK--AYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEY-NMTTYIIREFKLTDTRD------------------------SQSRVIRQFQFTDWQES---------------ESIPHSTQVFL----------DLINQVH-KTKIQLGQDGPIMVHCSAGSGRTGIFLALS---NIIERMKNES-VID--------LFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIR 7141
            YE    I +  KNR   ILP + SRV +                         CP+       + +DYINA+++   +      YIA Q+PL  T +DFW+ +  +   +++ L    E N  +   YW     S +   + +      N+   ++R F++  T                          S+  ++ Q Q+ +W +S                S+  + Q F+          DLI+  + +  +      P++VHCSAG GRTG+F+ L    +I+    N S  ID        +F  V  LR QR +++Q   QY  CY A L Y    +QI+
Sbjct:  400 YELTEGIQSFTKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYFALQKQIK 745          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 60.4622 bits (145), Expect = 2.831e-9
Identity = 46/141 (32.62%), Postives = 65/141 (46.10%), Query Frame = 2
Query: 5780 IRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRR----VHSEISRN------CGPIVVHCSAGVGRTGAFIVIDYMLE-------------RLRYENTV-DIYNYVTNI-RSQRNYMVQTEDQYIFIYETLL 6127
            IRK  +   +     E+ Q Q   WPD G   +P  +L  +      + +  +RN         I+VHCSAG GRTG    ID +L              +L+Y   + D  ++  NI R QR  MVQ  +Q+IFIY+ LL
Sbjct:  736 IRKILLTYHDQEKPYELLQIQVKNWPDLGTLLNPISILQAINVKNHIIDTLFARNYYQNDQLPTILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLL 876          

HSP 2 Score: 52.373 bits (124), Expect = 1.079e-6
Identity = 37/125 (29.60%), Postives = 55/125 (44.00%), Query Frame = 2
Query: 5402 KNRYANVIAYDHSRVILQP-LFDQRNSNFSETPIVSG--SDYINANFIS----------------GYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSI 5719
            KNRY ++  Y+HSRVIL+  L   +    S +    G   +YINAN++S                       YIATQ P+  T+ DF+  +      +++ +T   E    KC +YW  G    I
Sbjct:  530 KNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGNYNGI 654          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 321/629 (51.03%), Postives = 412/629 (65.50%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQ 7135
            +++ PI V  L +H+++LK +++  F +EYESIEPGQ FT + S ME N+ KNRY N+ AYDHSRV L           S    + GSDYINANF  GY   +AYIATQGP+  T  DFWRM+WEQ +  IVM+TR EER R KCDQYWP  G      +  I V++VD +ELA YTI    I K   +  RE+  FQFT WPDHGVP HP P L FLRRV      + GPIVVHCSAGVGRTG FIVID MLERLR+E TVDIY +VT +R+QRNYMVQT++QYIF ++ +LEAV CGNTEV    L HHI+KL ++          ++TGL+ EF+ +                       PS A  +         Y  AT   N+ KNR+  ILP + +RV+I P+RGVEGSDYINAS+IDGY+ R  +IA Q PL +T +DFWR L E NS+I+VMLTQL E   E+ ++YWP  RS+R+Q++IVDP+AE+    ++IR+FK+ D R    R I+QF F  W E+  +P S +  +DLI QV +   Q  ++GPI VHCS G GRTG+F AL  ++ERM++E V+DLFQTVKLLR QRPA++Q+++QY FCY  ALEYL  F+ 
Sbjct: 1295 IDHPPISVLDLPKHIAILKADNNSQFTQEYESIEPGQTFTADSSQMECNKGKNRYPNIHAYDHSRVRL-----------SYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDG---TDVYEGIEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTELGKG-------EVTGLEEEFKVV----------------------DPSQAKKH--------KYGAATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPET-GVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYLGSFDH 1871          

HSP 2 Score: 212.616 bits (540), Expect = 6.822e-55
Identity = 213/894 (23.83%), Postives = 360/894 (40.27%), Query Frame = 2
Query:  584 FICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGN-LEIIRTQEDDEGGYECVATNNLGTVVSS-------VIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTT----PKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKL-GNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKED--------IKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAA 3202
             IC + G+P P + W  N S     R  +  + P   L+RI P++   +K    C A N +G     +S  +       P+GFP I    S         V   C   G PT  I W KD +PI   + R++   +G  L I   +E D G Y CVA N LG V SS        I L + V    P F     D+ V P + V LKC A G+P P + W+            ++GQ  E  +I+  +  S    C+A +    +     VT++     P+      I  ++  I+W+ +          V       + +        I NV+      +++  +  L PF++Y   + + +    S  S +  +TTSE  P + P+N+E   +S+ +    W PP   NG I  Y +YY+    + +S W ++   S+        +T ++ +   TT++  I A N AG  P+SE +A+  + GV   P+S +    SST I + W   P +   + I+ Y VY  +S   +        + Q NT  I  L P T Y+  ++  ++   G  S V    T    P   P  ++      +    +EI W + P    +  +  +F  K            T+ +      L  + +  NY + +    +    P      + T   V    P +V  R  NST + V W   + K        +  +    ++ N  +P      K +MS  E+  + +      LAP++ YQI + + T +  G    +   KT  +  P P F++L  +       VT+ W+          ++  K ++  R R    ++  EIK+K    + ++ KF++ +   W  F  + +  A
Sbjct:   20 MICNVTGSPMPTLTWYKNGSVIRNSRIQIFTM-PYGGLIRIGPLRAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKHPSFKQRRSGDDVTFTCAAVGTPTPNITWFKDRLPIVLNDPRVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEV-------DGSRISGQNGE--LIIRGIQRSGNYSCIADSNMGRVQAYAYVTVRLLPFAPSRPNAASITSDAIKITWHPRGAH-------VVTSYEVQYRLKGKTEWQEITNVRG-----MQSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQW-RFMASST-------NSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPGQPRSVQLSVLSSTAIRVTWS--PPRYPGDGIFGYDVYYNKSKQDMDT---VIGAFQMNTKEIMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTT---LEISW-DPPRPEHRNGLITHFTIKYRAKGQRGAKYLTVDATKTSVVLHNLDKFTNYFIWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHNSTTMTVKWNPPTTKQDGKILGYMVFYTRVDDQGNQLRPPAQPESKDSMSE-ENHKVHL----TGLAPETTYQIEVAAYTIKGDGARSVTRLAKTMAQS-PDPPFVYLERASGDPISDVTLAWRTSATGVIEYKVRYAKSVRRLRGRDQGNLKMKEIKFK---SHTTKQKFQSLANGIWYLFNVSLRTKA 865          

HSP 3 Score: 96.2857 bits (238), Expect = 1.317e-19
Identity = 140/624 (22.44%), Postives = 255/624 (40.87%), Query Frame = 2
Query:  572 DQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSL------LRINPVKLDDNKTRITCLAQNSLGSTDS----------YASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSP----------NFIKVS----GDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEAN-----VILSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILI---RPGVVQGPKSFRAIAKSSTEIELFWD-SLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACP 2326
            D   F CA  G P+P I W          R  +    P+ S+      LRI  ++  DN  + +C+A+N+LG   S          Y +LSV  +K E      T+  +   +  + +T V L+C  +G PT +I W       + +  RI + +NG L I   Q    G Y C+A +N+G  V +   + +R+  F+P          + IK++    G  +VT   S  ++ R  G    +  WQ    +   QS  ++G R  ++       ++ L  S   +       E+   S    I+      T+ +  ++ P S N       IR   L Y + ++  +D    + + S T             + ++  L   T +   + ++++  D   S +V   T +  P   P++V+L  +S+ A+ +TW PP  P   I  Y++YY + K       D  TV  + + ++ +   +  Y    T Y ++++A++  G  P+S  L       RP     P++ +  ++ ST +E+ WD   P      I ++ + Y  +     +  K       K ++++ +L   T Y   +   T   +G  S     +T +  P
Sbjct:  117 DDVTFTCAAVGTPTPNITW-------FKDRLPIVLNDPRVSVLSDGRKLRITDLRESDNG-KYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEF-----TLRPQDKTV--DPDTDVELKCSARGSPTPSIVW-------EVDGSRI-SGQNGELIIRGIQR--SGNYSCIADSNMGR-VQAYAYVTVRLLPFAPSRPNAASITSDAIKITWHPRGAHVVT---SYEVQYRLKG----KTEWQEITNVRGMQSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGR-----IRGYRLYYSLDLL--EDISQWRFMASST------------NSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVP-GQPRSVQLSVLSSTAIRVTWSPPRYPGDGIFGYDVYYNKSKQ------DMDTVIGAFQMNTKEIMGLTPY----TVYKVAVAAKSDKGVGPMSFVLTARTDEDRPS--DAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAKGQ---RGAKYLTVDATKTSVVLHNLDKFTNYFIWVQASTKQGDGPFSDKHTVSTAEDVP 672          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 536.954 bits (1382), Expect = 1.291e-170
Identity = 280/625 (44.80%), Postives = 382/625 (61.12%), Query Frame = 2
Query: 5264 IPVEALSEHVSLLKENDSKLFNKEYESIEPGQQ-FTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNN-VREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            IPVEA + HV  +  +    F++EYE ++P  + FTW+ S    N+ KNRYAN++AYDHSRV+L PL             V  SDYINAN+I GY    A+IA+QGPL ET  DFWRM+WEQ S++IVM+T+LEER R KCDQYWP  G      +  + VT  +   ++YY +R F +  + +    R++ Q+ +T+WPDHGVP HPAPLL  +R V S      GP++VHCSAGVGRTG FI +D ML+R   E T+D++ +V  +R++RN MVQTE QY+FI++ L+EAV CG TEV   +LA  I +L +++ N      I  T + +EFE L                                    P  +++A   CN  KNR   ILP + +RV +    G  GSDYINAS+IDG    KAYIA Q+P+  T EDFWR LWE  S+++VMLT+ +E  + +  +YWP   S  Y   +V+   E   + Y++R+F LT T +  SR++RQFQ TDW +S  +P S    +DLI QV K + Q G +  I VHCS G GRTG+F A+S +IER+K E +ID+FQTV+ LR QRPA++QT+DQY+FCY    EYL+ F+
Sbjct:    2 IPVEAFAMHVRRMHMDGDIGFSEEYEMVQPNDETFTWHHSLHPANKYKNRYANIVAYDHSRVLLTPLEG-----------VLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWPDRG---TRNYGALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPN------IGTTYMDLEFERLTRDER------------------------------HPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDS-GLPESGVGLIDLIGQVEKWQQQSG-NTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFD 574          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 509.22 bits (1310), Expect = 9.204e-161
Identity = 268/624 (42.95%), Postives = 378/624 (60.58%), Query Frame = 2
Query: 5264 IPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHS-EISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            +PV+   EHV  L  N   LF++EY +       T + S  + NR KNRY N+ A+DH RV+LQP+           P    SDYINAN++ GY   + YIA QGPL ET  DFWRM+WEQNS VIVM+T  EER R KC QYWP  G      +  I+V ++  +EL+ YTIR F +++      R + Q+ +TAWPDHGVPN    +L F+R+  +  ++ + GP+VVHCSAGVGRTG ++VID  L+R++ E TVD+YNYV  +R QRN MVQ EDQY+ I++ LLEA+ CG+TE+   +L   I++L       + +     T +  EF+ L                  S    P            P  +++A    N+ KNR   +LP D +RV +      EGSDYINA++IDGY S+KA+IA Q+P+ +T  DFWR +WE +   +VML+Q  E+ + +  +YWP K+ +     +V+ + +     YI+REFK+T+T++S SRV+RQ+QFT W +  S P S    +DLI QV + + + G      VHCSAG GRTG+F A+S +IER+K E+++D+FQTVK LR QRPA++QT++QY+FCY    EYL  F+
Sbjct:    1 MPVDEFEEHVRRLHANGELLFSQEYGAFRSPDTVTSHHSLNQANRFKNRYNNITAFDHCRVLLQPI--------EGDPT---SDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSSGS---QNYGVIHVNMMSTVELSDYTIRSFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKEL------MRPSTDTGQTEMDAEFQRL------------------SRNKAP------------PSKFQSANLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGS-PDSGGGLIDLIGQVQRWQQKCGVQ-LTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYLHSFD 572          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 501.901 bits (1291), Expect = 2.837e-158
Identity = 272/625 (43.52%), Postives = 367/625 (58.72%), Query Frame = 2
Query: 5264 IPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPH--STQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            I ++   +HV+ ++ +    F  EYE I   +  T   S   +N+ KNRY N++AYDHSRV LQ        +F + P   GSDYINANF+ GY    AYIA QGPLAET  DFWRM+WEQNS  I+M+T L+ER R KC QYWP   +GS+S +  I VT+  + EL  Y +R   +Q+   ++VR++ QF FT+WPDHGVP     LL F+R          GP+VVHCSAGVGRTG FIVID ML+++  E TVDI  +V+ +R  RN MVQTE QYIFI++ LL+A+  G TE    +L  HI +L + +           T +  EF+ L                  S C   S            L+   AT   N+ KNR   +LP D +RV +    GVEGSDYINA++IDGY +++ +IA Q+P+ ET  DFWR +WE N   +V L Q  E  + +  +YWP K+   +   +V+   +      ++R FKLT+T  S SR +RQF +T W E   +    S    +DLI QV   + + G+  PI+VHCSAG GRTG+F A+S +IER+K E+++D+FQTVK LR QRPA++QT+ QY FCY   LEYL  FE
Sbjct:    1 ISIDDFEQHVARMRRSGDLFFTTEYERIPVPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKLQ--------DFEDEP---GSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWP--SRGSLS-YEDITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQEQDPESG------YTPMFTEFQKL------------------SRCINSS------------LSLNAATHPVNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESGRH-PIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYLASFE 574          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO45081 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS6])

HSP 1 Score: 469.159 bits (1206), Expect = 4.725e-146
Identity = 261/660 (39.55%), Postives = 375/660 (56.82%), Query Frame = 2
Query: 5261 PIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVI---LQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLN---DNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQ------------------------------YWPVKRS-SRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFF 7129
            PIPV  L+E+  +     +K F +E+  I     F+W+ S  E N+PKNRY N++A    R+    +  + D      SE   + GSDYINANFI GY +   +IATQGP++ T  DFWRM+WE   S IVM+T + ER + KC +YWP     +   +  + VT ++  EL++Y IRKF I+  N   ++  REI Q+ +TAWPDHGVP H   LL F+RR+ + +SR+ GPIVVHCSAGVGRTG +IV+D ML+++  E  VDI+ +V++ R QRN MVQTE QYIFI++ L+EA +CGNTE  V +L   I+ L   + +         T +  EF+NL +                                    T+++A+   N+ KNR L +LP D +RV + P  GV GSDYINAS+ID Y+ R+A++A Q+PL  T  DFWR LWE+ S  VVML +  EN + R  Q                              Y P K     Y   +V+  +E     YI R+ K+++T+ S+ R +  FQ+ DW E + +P   ++ +D++  + + + Q G +GPI VHCS GSGRTG F A+S  +ER+K ++ ID+FQTV+ LR QRP ++QT +QY+FCY     +++ F
Sbjct:    1 PIPVNKLAEYCQIHHSTGNKSFKEEFMCIRTPGNFSWDHSLKEENKPKNRYQNIVACKLFRLTNPCVNSVDDHTRVAISELDGIPGSDYINANFIDGYNHRNKFIATQGPVSNTFDDFWRMVWEHGCSCIVMVTNIVERGKLKCQKYWP---SANPEEYGRLVVTPLEEEELSHYVIRKFCIEIANSDVESPAREIVQYHYTAWPDHGVPTHATSLLAFIRRIRNSVSRDAGPIVVHCSAGVGRTGTYIVLDAMLDQMSKEGAVDIFGFVSHTRLQRNMMVQTEAQYIFIHDALMEAAKCGNTEFKVQDLHDRIKALQSRDPDSGE------TYIAKEFKNLDIGDSDV------------------------------ETFDSASMPENKSKNRFL-VLPYDRTRVKLWPYPGVLGSDYINASFIDSYQQREAFLATQAPLETTINDFWRMLWEYESYTVVMLNKDSENIKVRLKQTPGKTEIIIVQQRFFFLLISPKHVLYQGQSYLPDKGEFVVYGLLMVEVESEERQEGYIKRQLKISNTKSSEVRNVFHFQYEDWPE-DGVPQDGKLVIDMLKHIARAQQQTG-NGPITVHCSDGSGRTGTFCAISIALERVKLDATIDMFQTVRNLRTQRPIMVQTPEQYKFCYEVVRHFVEAF 618          

HSP 2 Score: 167.933 bits (424), Expect = 5.703e-43
Identity = 110/360 (30.56%), Postives = 167/360 (46.39%), Query Frame = 2
Query: 5174 LVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKEND----SKLFNKEYESIEPGQQ--FTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQ------------------------------YWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRV-HSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQC 6142
            L R+ + QT    +  H   ++          V+ L + +  L+  D         KE+++++ G     T++ ++M  N+ KNR+  V+ YD +RV L P            P V GSDYINA+FI  Y   +A++ATQ PL  TI DFWRM+WE  S  +VM+ +  E  + +  Q                              Y P   KG    +  + V +        Y  R+  I     + VR +F FQ+  WP+ GVP     ++  L+ +  ++     GPI VHCS G GRTG F  I   LER++ + T+D++  V N+R+QR  MVQT +QY F YE +   V+ 
Sbjct:  272 LQRNMMVQTEAQYIFIHDALMEAAKCGNTEFKVQDLHDRIKALQSRDPDSGETYIAKEFKNLDIGDSDVETFDSASMPENKSKNRFL-VLPYDRTRVKLWPY-----------PGVLGSDYINASFIDSYQQREAFLATQAPLETTINDFWRMLWEYESYTVVMLNKDSENIKVRLKQTPGKTEIIIVQQRFFFLLISPKHVLYQGQSYLP--DKGEFVVYGLLMVEVESEERQEGYIKRQLKISNTKSSEVRNVFHFQYEDWPEDGVPQDGKLVIDMLKHIARAQQQTGNGPITVHCSDGSGRTGTFCAISIALERVKLDATIDMFQTVRNLRTQRPIMVQTPEQYKFCYEVVRHFVEA 617          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: ptprfb (receptor-type tyrosine-protein phosphatase F [Source:NCBI gene;Acc:101168742])

HSP 1 Score: 766.148 bits (1977), Expect = 0.000e+0
Identity = 369/627 (58.85%), Postives = 453/627 (72.25%), Query Frame = 2
Query: 5252 EYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            E+ PI V AL++H+  LK NDS  F++EYESI+PGQQFTW  SNME+N+PKNRYANVIAYDHSRV+L  + D R         V GSDYINAN+I GY    AYIATQGPL ET+ DFWRM+WEQ SS ++MMTRLEE+ R KCDQYWP  G     T+  I VT++D +ELA Y++R F + K   +  RE+ QFQF AWPDHGVP +P P+L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER+++E TVDIY +VT +R+QRNYMVQTEDQYIFI+E LLEA  CGNTEVP   L  HI+KL Q         G  +T +++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS IDGY+ +KAY+A Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR IRQFQFTDW E + +P + + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+DLFQTVK LR QRPA++QTEDQYQ CY AALEYL  F+
Sbjct:  906 EHPPISVAALADHIERLKANDSLRFSQEYESIDPGQQFTWEHSNMEVNKPKNRYANVIAYDHSRVVLTSI-DGRT--------VPGSDYINANYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRSSTVIMMTRLEEKSRVKCDQYWPSRG---TETYGMIQVTMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRAQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARNLYAHIQKLTQ------PPPGETVTAMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPFESTRVCLQPIRGVEGSDYINASCIDGYRQQKAYLATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPE-QGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDLFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1483          

HSP 2 Score: 225.328 bits (573), Expect = 1.523e-58
Identity = 181/625 (28.96%), Postives = 277/625 (44.32%), Query Frame = 2
Query:  578 AIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWRE--IPEKNSKI 2416
            A F+C   G P P+I W         +RF V        S+LRI P++   ++    C A N+ G     A L+V    Q IP GFP I     + V E+     + C   G P   IFW KD +P+D  N   RI   ++G L+I  ++E D+G YECVA N+ GT  S+   L +RV+   P F     +  V PG SV L C A+G+P+P V W  G+  L  +     G+    NV+ ++++ ES    CVA +   +I  +  VT++     PT++ VT     S  ++W   N +P+    ++Y+    K+ D    +      +  V  + Y      S+  L P++ Y   + + +       S+ V   T E  P +PP +V+   +S+  +L+ W+PP+ PNG I  Y +YY+     PLS+W K+    S         T +S +  + TY + +    S G  P S+ L +  + GV   P SF A A+  T I L W       Q  I  Y L Y          E   D     +  + G L    TY F+LS       G   + E +T   TP   P  ++   L+ S      + W    +PE+N +I
Sbjct:   41 ASFVCQASGEPRPRITWMKKGKKVSSQRFEVIDFDDGSGSVLRIQPLRTHRDEAIYECTATNTAGEITVNAKLTVLEENQ-IPHGFPNIDMAPQLKVVERTRTATMLCAASGNPDPEIFWFKDMLPVDVSNSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYSAPANLYVRVRRVPPRFSIPPSNLEVMPGGSVNLTCVAVGSPMPYVKWMKGEVELTKEEDMPLGR----NVLEVTNIRESANYTCVAISSLGTIEATAQVTVKALPKPPTSLTVTETTATSVTLTWLSGNPEPVSYYMIQYR---GKSSDNGFQE------VEGVATTRY------SIGGLSPYSEYEFRVMAVNNIGRGPPSDPVETRTGEQAPSSPPLHVQARMLSSSTMLVQWEPPEEPNGQIRGYRVYYSPDMSPPLSAWTKHNTDDSS-------LTTISGLTPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVPAQPSSFEAEAELDTRIRLSW---LWPVQDPITQYELQYW---------EDGTDNKTDDHYTVTG-LHKGATYVFRLSARNRAGIGEAYVKEISTPEDTPSGYPTNLQVTGLTQSS---TRLTWEPPLLPERNGRI 622          

HSP 3 Score: 70.4774 bits (171), Expect = 2.814e-11
Identity = 142/629 (22.58%), Postives = 246/629 (39.11%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDD----NKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI---------LSDLSESLKCICVAKNIKE---SISRSISVTIQEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLR-YKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITW-----DPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAG---------SSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDS--LPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTP 2314
            P I +  +   V R   A  +CA  GNP P+I W  +    LP    V+  + +   LR   +++++    ++ +  C+A NS G+  S A  ++Y   + +P  F    S   V+       V L C   G P   + W+K  + +  E + +   +N  LE+   +E     Y CVA ++LGT+ ++  ++ ++     P  + V+     T  +SVTL   + GNP P  Y+     ++Q + K+      E   +         LS  SE    +    NI     S         Q PS+ P  ++   +  ++  + W         +R Y+V+        ++  L++ T  N   S        ++  L P   Y++ +  F+   D   S+++   T +  P   P + E  +  +  + ++W     DP       IT Y + Y          W+  T     K+D     T L       TY   +SA+N AG         S+P   P            P + +    + +   L W+   LP ++   I+ Y ++Y  +S+      KR          LI  LQP+T Y F L++  N A G+   V   T P
Sbjct:  126 PNIDMAPQLKVVERTRTATMLCAASGNPDPEIFWFKDM---LP--VDVSNSNGRIKQLRSGALQIENSEESDQGKYECVAMNSAGTRYS-APANLYVRVRRVPPRFSIPPSNLEVM---PGGSVNLTCVAVGSPMPYVKWMKGEVELTKE-EDMPLGRN-VLEVTNIRES--ANYTCVAISSLGTIEATA-QVTVKALPKPPTSLTVT----ETTATSVTLTWLS-GNPEPVSYY-----MIQYRGKSSDNGFQEVEGVATTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSDPVETRTGEQAPSSPPLHVQARMLSSSTMLVQWEPPEEPNGQIRGYRVYYSPD----MSPPLSAWTKHNTDDSSL-----TTISGLTPDITYSLRVLGFTSVGDGPPSDVLQVKTQQGVP-AQPSSFEAEAELDTRIRLSWLWPVQDP-------ITQYELQY----------WEDGT---DNKTDDHYTVTGLH---KGATYVFRLSARNRAGIGEAYVKEISTPEDTPSGY---------PTNLQVTGLTQSSTRLTWEPPLLPERNG-RIVSYVILYNQQSVEVQGNLKR---------KLISQLQPDTDYSFVLTSRGNIAGGLQQQVSIRTAP 678          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 368/647 (56.88%), Postives = 461/647 (71.25%), Query Frame = 2
Query: 5195 QTLGSLVQFHGQHIQ-NRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            QT GS    H +++  +    + PIP+  L++H+  LK ND+  F++EYESI+P QQFTW  SN+E+N+PKNRYANVIAYDHSR++L           S    + GSDYINAN+I GY    AYIATQGPL ET G+FWRM+WEQ S+V+VMMT+LEER R KCDQYWP  G     T+  I V+++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER ++E TVDIY +VT +R+QRNYMVQTEDQY+FI++ LLEAV CG TEVP   L  +I+KL QIE       G  +TG+++EF+ L              AN  +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1336 QTPGSGASSHPRNLHLSSMANHPPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL-----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRG---TETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE------GGENVTGMELEFKRL--------------ANTKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1931          

HSP 2 Score: 293.893 bits (751), Expect = 2.473e-79
Identity = 272/1034 (26.31%), Postives = 447/1034 (43.23%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVN-IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG-----MPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPE--KNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIEN-PCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEV-WCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTR 3559
            Q PPK +    +   ++   A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G   +   L+V    Q +P GFPTI     + V E+     + C   G P   I W KD +P++  N   RI   ++G L+I +++E D+G YECVATNN GT  S+   L +RV+   P F     D  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N +P+    +++K    K  D L  +      I  V  + Y      S+  L P+++Y   + + +       S  +   T+E  P T P++V    +S    +I WD P+  NG I  Y +YYT    + ++ W+K  V+ S           +  +  N TY I + A  S G  P+S  L I+ + GV   P  F+  AKS T + L W++     Q N +  Y L+Y  R     K+EK+  + P   T L+  L+P TTY F+L+  +    G     + +    T  P   P  VK    S +K   I + WR  P   +N  I    + +    G  +    +  I  +     L+ +++   Y+V +         P      I T+  V    P +V   AVNS++I+V W++     +  +    Q+H     N E   +P +KDI I       E  +     I   L  ++ Y + + + T +  G   K + I T      KP     RL  S  N     ++W         ++GYRLR+      D     V+E    ++ + TS     +G  Y F+++A N+   G+E   +I   E  PS +P N K +  +    +++  +W  V     NGK   Y + +  + S  + +    T     + ++ L+ D+ Y  ++  +  K    +S ++ F+T+
Sbjct:   37 QTPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLREDQ-LPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGR----NVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPEPVTYYIIQHK---SKYSDDLYKE------INGVATTRY------SVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSN-------FVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDD---KEEKQISFEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTK---ILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWEFED-STEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKP-----RLMVSTTNMGTALLQWHPPAVTHGPLQGYRLRF---GRKDVDPLTVIEFQERDNHYTTSEIH--KGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATT---STIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQ 1022          

HSP 3 Score: 53.1434 bits (126), Expect = 4.623e-6
Identity = 64/259 (24.71%), Postives = 103/259 (39.77%), Query Frame = 2
Query: 1685 FTTSELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKD--KPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFW---DSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
             TT+E  P   P+N++    +   + ++W P  +   NG I  Y +   Q+KD   P S  + +         +P+ T +L  +  +TTY I + A  S GS P S  +    +P V Q    K+F   A   + + L W   D+        I+Y              K +  +   +    LI  LQP T Y F L+   N+A G+   V   T P     +++     I K     +   E+P   +   IR Y+
Sbjct:  919 ITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYAL---QYKDINSPRSPSELFIT-------APESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQP-VDQAVFAKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTILY-------------DKGQSVEVDGRLTQKLITGLQPETQYSFLLTNRGNSAGGLQHRVSTMTAPD----VLRTKPYLIGKTNSDGMVTVELPTVQTSERIRGYY 1149          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 363/626 (57.99%), Postives = 452/626 (72.20%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+P QQFTW  SN+E+N+PKNRYANVIAYDHSR++L           S    + GSDYINAN+I GY    AYIATQGPL ET G+FWRM+WEQ S+V+VMMT+LEER R KCDQYWP  G     T+  I V+++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER ++E TVDIY +VT +R+QRNYMVQTEDQY+FI++ LLEAV CG TEVP   L  +I+KL QIE       G  +TG+++EF+ L              AN  +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1343 HPPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL-----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRG---TETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE------GGENVTGMELEFKRL--------------ANTKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1917          

HSP 2 Score: 293.508 bits (750), Expect = 2.904e-79
Identity = 272/1034 (26.31%), Postives = 447/1034 (43.23%), Query Frame = 2
Query:  518 QKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKIS-PKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVN-IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANG-----MPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPE--KNSKI-NIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKP-LKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIEN-PCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEV-WCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTR 3559
            Q PPK +    +   ++   A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G   +   L+V    Q +P GFPTI     + V E+     + C   G P   I W KD +P++  N   RI   ++G L+I +++E D+G YECVATNN GT  S+   L +RV+   P F     D  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N +P+    +++K    K  D L  +      I  V  + Y      S+  L P+++Y   + + +       S  +   T+E  P T P++V    +S    +I WD P+  NG I  Y +YYT    + ++ W+K  V+ S           +  +  N TY I + A  S G  P+S  L I+ + GV   P  F+  AKS T + L W++     Q N +  Y L+Y  R     K+EK+  + P   T L+  L+P TTY F+L+  +    G     + +    T  P   P  VK    S +K   I + WR  P   +N  I    + +    G  +    +  I  +     L+ +++   Y+V +         P      I T+  V    P +V   AVNS++I+V W++     +  +    Q+H     N E   +P +KDI I       E  +     I   L  ++ Y + + + T +  G   K + I T      KP     RL  S  N     ++W         ++GYRLR+      D     V+E    ++ + TS     +G  Y F+++A N+   G+E   +I   E  PS +P N K +  +    +++  +W  V     NGK   Y + +  + S  + +    T     + ++ L+ D+ Y  ++  +  K    +S ++ F+T+
Sbjct:   37 QTPPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLREDQ-LPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGR----NVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPEPVTYYIIQHK---SKYSDDLYKE------INGVATTRY------SVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSN-------FVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDD---KEEKQISFEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTK---ILVSWRAPPVELRNGIITQYTVSYAPTEGEDTAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPSGPPRKVEVEAVNSSSIKVIWRSPVPTKQHGQIRGYQVHYVRMVNGEPTGQPVIKDILIDDAQWEFED-STEHEMIITGLMAETTYSVTVAAYTTKGDGARSKPKLITTTGAVPEKP-----RLMVSTTNMGTALLQWHPPAVTHGPLQGYRLRF---GRKDVDPLTVIEFQERDNHYTTSEIH--KGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATT---STIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQ 1022          

HSP 3 Score: 53.1434 bits (126), Expect = 4.658e-6
Identity = 64/259 (24.71%), Postives = 103/259 (39.77%), Query Frame = 2
Query: 1685 FTTSELPPYTPPKNVELGSISNGAVLITWDPPDIP--NGIITTYNIYYTQFKD--KPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQG--PKSFRAIAKSSTEIELFW---DSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYF 2434
             TT+E  P   P+N++    +   + ++W P  +   NG I  Y +   Q+KD   P S  + +         +P+ T +L  +  +TTY I + A  S GS P S  +    +P V Q    K+F   A   + + L W   D+        I+Y              K +  +   +    LI  LQP T Y F L+   N+A G+   V   T P     +++     I K     +   E+P   +   IR Y+
Sbjct:  919 ITTNEDVPSGYPQNIKAEGATTSTIQVSWQPVLLAERNGKIVKYAL---QYKDINSPRSPSELFIT-------APESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQP-VDQAVFAKNFHVRAAMKSSVLLTWEIPDTYNPAQPFTILY-------------DKGQSVEVDGRLTQKLITGLQPETQYSFLLTNRGNSAGGLQHRVSTMTAPD----VLRTKPYLIGKTNSDGMVTVELPTVQTSERIRGYY 1149          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 762.681 bits (1968), Expect = 0.000e+0
Identity = 363/626 (57.99%), Postives = 452/626 (72.20%), Query Frame = 2
Query: 5255 YAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            + PIP+  L++H+  LK ND+  F++EYESI+P QQFTW  SN+E+N+PKNRYANVIAYDHSR++L           S    + GSDYINAN+I GY    AYIATQGPL ET G+FWRM+WEQ S+V+VMMT+LEER R KCDQYWP  G     T+  I V+++D +ELA Y +R F + K   +  RE+ QFQFTAWPDHGVP HP P L FLRRV +    + GP+VVHCSAGVGRTG FIVID MLER ++E TVDIY +VT +R+QRNYMVQTEDQY+FI++ LLEAV CG TEVP   L  +I+KL QIE       G  +TG+++EF+ L              AN  +H S                 + +A   CN+ KNR++ I+P + +RV + PIRGVEGSDYINAS+IDGY+ +KAYIA Q PL+ET EDFWR LWEHNS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTEDQYQFCY A LEYL  F+
Sbjct: 1204 HPPIPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL-----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWPTRG---TETYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE------GGENVTGMELEFKRL--------------ANTKAHTSR----------------FISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1778          

HSP 2 Score: 237.269 bits (604), Expect = 4.829e-62
Identity = 188/637 (29.51%), Postives = 288/637 (45.21%), Query Frame = 2
Query:  524 PPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQ--RINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAKNIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVN-IIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM----PSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIP 2398
            PPK +    +   ++   A FIC   G+P PKI W         +RF V +      S+LRI P++   ++    C+A N++G   +   L+V    Q +P GFPTI     + V E+     + C   G P   I W KD +P++  N   RI   ++G L+I +++E D+G YECVATNN GT  S+   L +RV+   P F     D  + PG SV + C A+G+P+P V W  G   L  +     G+    NV+ L+D+ +S    CVA +    I     +T++     P    VT     S  ++W   N +P+    +++K    K  D L  +      I  V  + Y      S+  L P+++Y   + + +       S  +   T+E  P T P++V    +S    +I WD P+  NG I  Y +YYT    + ++ W+K  V+ S           +  +  N TY I + A  S G  P+S  L I+ + GV   P  F+  AKS T + L W++     Q N +  Y L+Y  R     K+EK+  + P   T L+  L+P TTY F+L+  +    G      S     T P   P  VK    S +K   I + WR  P
Sbjct:   15 PPKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLREDQ-LPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGR----NVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPEPVTYYIIQHK---SKYSDDLYKE------INGVATTRY------SVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSN-------FVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDD---KEEKQISFEP-TTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTK---ILVSWRAPP 617          

HSP 3 Score: 83.9593 bits (206), Expect = 2.142e-15
Identity = 193/920 (20.98%), Postives = 351/920 (38.15%), Query Frame = 2
Query:  896 CKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQE----DDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVS-GDQ--IVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQ----RAEA-NVILSDLSESLKCICVAKN---IKESISRSISVTIQEP----STVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKY----TVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPL-AILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKK-EKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWR---EIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEA--EHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIEN-PCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEV-WCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTR 3559
            C+  G P   I W K    +  +   +    +G+  ++R Q      DE  YECVA+N +G + +S    ++R     P F  +  G Q  +V    + T+ C A GNP P++ W   +  L   + N  G+    R+ A  +  S+ S+  K  CVA N    + S   ++ V ++      S  PT   +   G  S NI+         Y+++          L  ++LT    + + ++  E      L ++    NYT      +M T  +   +   T   LP    P    +   +  ++ +TWD     +G       Y  Q K K   S D Y     V +++ S        +  ++  + Y   + A N+ G  P SE + A          P+  R    S+T   + WD  P ++   I+ Y + Y      H+   EK+       N + I  L PN TY  ++   T+  +G  S           P    ++         + + W    +  ++N      + ++ +      Q S +   + +    LK++K    Y   +  + ++            T  +     P EV   + +ST I V W+    + +      Y +    Y P  E  +   + I      SN   +  + +Y+  NL   +EY++ + + T    G       I+T      KP     RL  S  N     ++W         ++GYRLR+      D     V+E    ++ + TS     +G  Y F+++A N+   G+E   +I   E  PS +P N K +  +    +++  +W  V     NGK   Y + +  + S  + +    T     + ++ L+ D+ Y  ++  +  K    +S ++ F+T+
Sbjct:   37 CQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLREDQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISW--FKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGG--SVNITCVAVGSPMPYVKW---------MLGAEDLTPEDDMPIGRNVLE------LTDVQQSANYTC----VAMSTLGVIEAVAQITVKALP--KAPGIPVVTERTATSITLTWD-----SGNPEPVTYYIIQHKSK--YSDDLYKEINGVATTRYS--------VGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDE-PEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRG--SNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKTGVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIYRKRDDKEEKQISFEPTTTYL----LKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVS---YAPT-EGEDTAARQI------SNIPPE--SSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPEKP-----RLMVSTTNMGTALLQWHPPAVTHGPLQGYRLRF---GRKDVDPLTVIEFQERDNHYTTSEIH--KGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATT---STIQVSWQPVLLAERNGKIVKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQ 884          

HSP 4 Score: 74.7146 bits (182), Expect = 1.260e-12
Identity = 117/521 (22.46%), Postives = 208/521 (39.92%), Query Frame = 2
Query: 1559 KKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPP--DIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTT--ILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTT---TPKACPMIVKNWDLSISKRGGIEICWREI--PEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTK--SSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKL-PKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPL 3085
            K+  +E   T  L++L PFT YT  L + S       ++ ++  T +  P  PP+ V+  S S+  +L++W  P  ++ NGIIT Y + Y      P    D     + + S+ P +++  +L  +   T Y ++++A    G+ P S P  I     V + P+   +     T + L W   P+ +   +  Y L +  + +  L      ++  + N      +    +Y F+LS       G  ++ E TT    P   P  +K    + S    I++ W+ +   E+N KI ++   Q K  N    PS   I +      L  ++ +  Y + +         P   S Q  T+    VF ++    H RA   +++ + W+                    P+  N  +P   +Y  K  S      +T + I   L P+++Y   L +      G+  +   + T P  L  KP  I    S  +    VTVE    ++  + I+GY +   PL
Sbjct:  543 KQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYA-----PTEGED---TAARQISNIPPESSQYLLENLEKWTEYRVTVTAHTDVGAGPESLPHLIRTEEDVPEKPRLMVSTTNMGTAL-LQWHP-PAVTHGPLQGYRLRFGRKDVDPLTV---IEFQERDNHYTTSEIHKGASYTFRLSARNKVGFGEETVKEITTNEDVPSGYPQNIKAEGATTST---IQVSWQPVLLAERNGKI-VKYALQYKDINSPRSPSELFITAPESTVVLDGLRPDTTYDIKMCAFTSKGSGPYSPSVQFRTQPVDQVFAKN---FHVRAAMKSSVLLTWE-------------------IPDTYNPAQPFTILY-DKGQSVEVDGRLTQKLI-TGLQPETQYSFLLTNRGNSAGGLQHRVSTM-TAPDVLRTKPYLIGKTNSDGM----VTVELP-TVQTSERIRGYYVVVVPL 1016          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: ptprsa (receptor-type tyrosine-protein phosphatase S [Source:NCBI gene;Acc:101174175])

HSP 1 Score: 759.985 bits (1961), Expect = 0.000e+0
Identity = 360/628 (57.32%), Postives = 454/628 (72.29%), Query Frame = 2
Query: 5249 LEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFE 7132
            L + PIP+  L+EH  LLK ND+   ++EYESI+PGQQFTW  SN+E+N+PKNRYANVIAYDHSRVIL P+             ++GSDYINAN+I GY    AYIATQGPL ET GDFWRM+WEQ ++ +VMMT+LEE+ R KCDQYWP  G     T+    VT++D IELA + +R F + K   +  RE+ QFQFTAWPDHGVP +P P L FLRRV +    + GPI+ HCSAGVGRTG FIVID MLER+++E TVDIY +VT +RSQRNYMVQTEDQY FI++ LLEAV CGNTEV    L  +I+KL Q+E       G  +TG+++EF+ L              AN+ +H S                 + +A   CN+ KNR++ I+P + +RV + PIRG+EGSDYINAS+IDGY+ ++AYI+ Q PL+ET EDFWR LWE+NS+IVVMLT+L+E  RE+  QYWP +RS+RYQ+F+VDP+AEYNM  YI+REFK+TD RD QSR +RQFQFTDW E + +P S + F+D I QVHKTK Q GQDGPI VHCSAG GRTG+F+ LS ++ERM+ E V+D+FQTVK+LR QRPA++QTED+YQFCY AALEYL  F+
Sbjct: 1325 LNHPPIPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEG-----------ITGSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTKLEEKSRIKCDQYWPSRG---TETYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLYSYIQKLAQVE------SGEHVTGMELEFKRL--------------ANSKAHTSR----------------FISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINASFIDGYRQQRAYISTQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPE-QGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYHAALEYLGSFD 1901          

HSP 2 Score: 266.929 bits (681), Expect = 4.362e-71
Identity = 279/1099 (25.39%), Postives = 470/1099 (42.77%), Query Frame = 2
Query:  584 FICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKK-SLLRINPVKLDDNKTRITCLAQNSLGSTDSYASLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPID--FENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIR----VKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTILQSQSKNLTGQRAEANVI-LSDLSESLKCICVAK---NIKESISRSISVTIQEPSTVPTAIRVTYIGPNSCNISW---NQKPIREEYLRYKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGM--PSLVECT--TTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINI---RIYFQ----SKLGNFSVQPSLQTIGSKMCYQ-QLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGY-FPNRENHNKPL-KDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWK-EDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYE-VWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPA--PDAIRFIRLSQSTAQITWKWNP----DFLIHYSH------------FIIYYTNEKTFLNKIWLMKSTNT 3736
            F+C   G+P PK+ W         +R    +      ++LRI P++   ++    C+A+NS G     A L++   +  +P GFP I     + V E+     + C   G P   I W KD +PID    N RI   ++G L+I  ++E D+G YECVA+N  G   SS   L +R    V+   P F      Q + PG SV + C A+G+P+P V W      L  + +   G+    NV+ LS + ES    CVA     I ES+++    ++ +P   P    VT     S  I+W   N  P+    ++YK    K+ D          T+ ++  + Y      S+  L P T Y + + + +       S  V   T E  P +PP+NV    +    +++TW+ P+ PNG I  Y +YYT    +P+S+W  + V+ S         T +  +    TY I + A  S G  P S P+ + +  GV   P  F+  A S T IEL W+  P+  +  I  Y L Y  R   H  + K+  + P K+ + + SL+PNT Y F L+ I++   G     +++ T    P A P  +   + S +    + + WR  P K+   ++   ++ +Q    S+      QP+ + +      Q  L+ + +   Y + +         P        T   V    P  V    +NSTAI+V W++ +   +  +    Q+H     N E+   PL KD+ +      +++Q +    +   L PD+ Y I + + T +  G   K + + T    +P P ++ +  +         V W   D+ N   ++GYRL++      D      LE    E ++   +    +G  Y FK+AA +    G+E   ++ + E +P  +P   ++K  SN++  SV+ +W+       NG    Y  V+    + E               +N+LK +S Y  ++R         +S  I ++T   H PA  P        +++T  + WK++       +I Y+H            FI    +  T+  K+   +STN+
Sbjct:   54 FVCHATGDPKPKVSWSKKGKKVNSQRIETIEFDEGAGAVLRIQPLRAPRDENIYECVAENSEGEISVNARLAII-REDLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWYKDFLPIDPSASNGRIKQLRSGALQIENSEETDQGKYECVASNVEGVRYSSPANLYVRELREVRRVPPRFSIPPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDEMPVGR----NVLELSSVRESANYTCVAMSSLGIIESVAQITVKSLPKPPGTPV---VTETTATSVTITWDSGNPDPVSYYIIQYKA---KSPDSKYE------TVDDITTTRY------SIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYYTMDASQPMSNWHIHNVQDSV-------ITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSKFQVGAVSDTSIELIWE--PAHDKEAIRRYELRY--RESNHGNQMKK-TFDPTKSYV-VESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEI---ECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMIPPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRVEVDVLNSTAIKVMWRSLTPGKQNGQIRGYQVHYVRVENGESRGLPLIKDVML------ADAQEM----VIGGLKPDTTYSITVAAYTTKGDGARSKPKLVVT-KGAVPGPPYLSVAQNSKT---SAVVHWDPPDLTNGMDLQGYRLQFG---RKDITPLATLEFAPQERRYSVDNIH--RGATYLFKMAAKSRGGFGEEAVAELSVPENTPGGYP---QIKEGSNVTCCSVLLSWSPPVLAERNGVITEYTLVYKEAGTGEIPRELRLHPSLSSYVLNSLKPNSAYEVKMRAHTSVGPGPYSPPIQYRTVAIH-PADVPKNFTVKWATKTTVVLGWKFSERSPYKCVIEYAHQKKDVDARELKAFIKGLRHNTTYEFKVTCQESTNS 1090          

HSP 3 Score: 56.6102 bits (135), Expect = 4.534e-7
Identity = 147/670 (21.94%), Postives = 278/670 (41.49%), Query Frame = 2
Query:  527 PKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRINQSFTLPKRFSVTKISPKKSLLRINPVKLDD----NKTRITCLAQNSLG-STDSYASLSVYANKQ--EIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWLKDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVIRLMIRVKYFSPNFIKVSGDQIVTP--GSSVTLKCRALGNPIPEVYWQCGQTILQSQSK----------NLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTI--QEPSTVPTAIRVTYIGPNSCNISWNQKPIREEYLR-YKVFVMKTKDFLVNKNLTSGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTFTTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKDKPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAG-SSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQ-VNIIYYYLVYMPRSM-------PHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS-LVECTT---TPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIY 2431
            P I +  +   V R   A  +CA  GNP P+I W   + F LP   S +    K+  LR   +++++    ++ +  C+A N  G    S A+L V   ++   +P  F +I   S  I+      V + C   G P   + W+ +S  +  E++ +   +N  LE+   +E     Y CVA ++LG ++ SV ++ ++      +  K  G  +VT    +SVT+   + GNP P  Y+     I+Q ++K          ++T  R     +  +    ++   +    +   S  +      Q P++ P  +    +  N+  ++W +       ++ Y+V+   T D   ++ +++  I NV+ S        ++++L P   YT+ + +F+   D   S  +     +  P  P K  ++G++S+ ++ + W+P       I  Y + Y +                 KK+  P ++ ++  +  NT YY S++A +  G  +  +E L   ++      P+     + SST + + W   P KSQ  ++  Y ++Y   S        P   +E      P +  +L+  L   T Y   +S  T    G  S  + C T    P A P  V   ++ +     I++ WR +        IR Y
Sbjct:  137 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWY--KDF-LPIDPSASNGRIKQ--LRSGALQIENSEETDQGKYECVASNVEGVRYSSPANLYVRELREVRRVPPRF-SIPPTSQEIM--PGGSVNITCVAVGSPMPYVKWMLNSEDLTPEDE-MPVGRN-VLELSSVRES--ANYTCVAMSSLG-IIESVAQITVK------SLPKPPGTPVVTETTATSVTITWDS-GNPDPVSYY-----IIQYKAKSPDSKYETVDDITTTRYSIGGLYPNTEYEIRVSAINTIGQGPPSEPVETRTGEQAPASPPRNVNGQILPQNTMMVTWEEPEEPNGQIKGYRVYY--TMD--ASQPMSNWHIHNVQDS-----VITTIRSLTPLETYTIKVLAFTSVGDGPFSPPIKVKVVQGVPGQPSK-FQVGAVSDTSIELIWEPAHDKEA-IRRYELRYRESNHG----------NQMKKTFDPTKSYVVESLRPNTEYYFSLAAISDKGIGAFTNEILQKTLQAKPSAPPQEIECSSTSSTSLLVSWRPPPLKSQNGDLTGYKVLYQVVSPSEGAGGDPQPTEEPMI--PPTEEQVLLQRLGKWTQYHITVSAATVVGLGPESEPIICRTDEDVPGAPPRRV---EVDVLNSTAIKVMWRSLTPGKQNGQIRGY 755          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000038449.1 (SMESG000038449.1)

HSP 1 Score: 3346.21 bits (8675), Expect = 0.000e+0
Identity = 1660/1696 (97.88%), Postives = 1660/1696 (97.88%), Query Frame = 2
Query: 1922 MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTSPIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 7009
            MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS VECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHT LSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR                       ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIV           ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE
Sbjct:    1 MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSFVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTTLSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR-----------------------ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIV-----------ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 1662          

HSP 2 Score: 188.348 bits (477), Expect = 2.896e-47
Identity = 103/265 (38.87%), Postives = 154/265 (58.11%), Query Frame = 2
Query: 6374 QPLTYETATQICNQMKNRILQILPPDFSRVNICPIRG-----------VEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRS---SRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQD-GPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLK 7123
            Q  T+  +    N+ KNR   ++  D SRV + P+             V GSDYINA++I GY + KAYIA Q PL+ET  DFWR +WE NSS++VM+T+L+E +R +  QYWP+      S + +  V  V    +  Y IR+F +    D+  R I QFQFT W +   +P+     L  + +VH    ++ ++ GPI+VHCSAG GRTG F+ +  ++ER++ E+ +D++  V  +R QR  ++QTEDQY F Y   LE ++
Sbjct: 1123 QQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPD-HGVPNHPAPLLMFLRRVHS---EISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQ 1383          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000038449.1 (SMESG000038449.1)

HSP 1 Score: 3341.98 bits (8664), Expect = 0.000e+0
Identity = 1659/1696 (97.82%), Postives = 1659/1696 (97.82%), Query Frame = 2
Query: 1922 MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTSPIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 7009
            MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS VECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHT LSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR                       ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSI            ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE
Sbjct:    1 MANNTTYYISISAQNSAGSSPVSEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLVYMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSFVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQSKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEHSDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTTLSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR-----------------------ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSI------------ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 1661          

HSP 2 Score: 188.348 bits (477), Expect = 2.919e-47
Identity = 103/265 (38.87%), Postives = 154/265 (58.11%), Query Frame = 2
Query: 6374 QPLTYETATQICNQMKNRILQILPPDFSRVNICPIRG-----------VEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRS---SRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQD-GPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLK 7123
            Q  T+  +    N+ KNR   ++  D SRV + P+             V GSDYINA++I GY + KAYIA Q PL+ET  DFWR +WE NSS++VM+T+L+E +R +  QYWP+      S + +  V  V    +  Y IR+F +    D+  R I QFQFT W +   +P+     L  + +VH    ++ ++ GPI+VHCSAG GRTG F+ +  ++ER++ E+ +D++  V  +R QR  ++QTEDQY F Y   LE ++
Sbjct: 1123 QQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPD-HGVPNHPAPLLMFLRRVHS---EISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQ 1383          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000035516.1 (SMESG000035516.1)

HSP 1 Score: 3002.62 bits (7783), Expect = 0.000e+0
Identity = 1487/1516 (98.09%), Postives = 1489/1516 (98.22%), Query Frame = 2
Query: 2603 TKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTSPIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL 7150
            T +   IEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSE+QNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR                       ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL
Sbjct:   55 TTTPKVIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSENQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR-----------------------ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL 1547          

HSP 2 Score: 127.102 bits (318), Expect = 1.289e-28
Identity = 59/60 (98.33%), Postives = 59/60 (98.33%), Query Frame = 2
Query: 2141 MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKA 2320
            MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPK 
Sbjct:    1 MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKV 60          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000035516.1 (SMESG000035516.1)

HSP 1 Score: 3001.08 bits (7779), Expect = 0.000e+0
Identity = 1487/1516 (98.09%), Postives = 1489/1516 (98.22%), Query Frame = 2
Query: 2603 TKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTSPIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL 7150
            T +   IEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSE+QNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR                       ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL
Sbjct:   51 TTTPKVIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSENQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR-----------------------ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFFEQIRFDL 1543          

HSP 2 Score: 118.242 bits (295), Expect = 6.445e-26
Identity = 55/56 (98.21%), Postives = 55/56 (98.21%), Query Frame = 2
Query: 2153 MPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKA 2320
            MPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPK 
Sbjct:    1 MPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKV 56          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000038449.1 (SMESG000038449.1)

HSP 1 Score: 2869.34 bits (7437), Expect = 0.000e+0
Identity = 1427/1463 (97.54%), Postives = 1427/1463 (97.54%), Query Frame = 2
Query: 2621 IEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKXXXXXXXXXXXXXINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFXXXXXXXXXXXXXXXXXXMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTSPIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 7009
            IEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHT LSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR                       ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSI            ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE
Sbjct:   61 IEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLHGYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCISSPWTTSINIMHTTLSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNR-----------------------ILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSI------------ERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNE 1488          

HSP 2 Score: 187.963 bits (476), Expect = 2.805e-47
Identity = 103/265 (38.87%), Postives = 154/265 (58.11%), Query Frame = 2
Query: 6374 QPLTYETATQICNQMKNRILQILPPDFSRVNICPIRG-----------VEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRS---SRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQD-GPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLK 7123
            Q  T+  +    N+ KNR   ++  D SRV + P+             V GSDYINA++I GY + KAYIA Q PL+ET  DFWR +WE NSS++VM+T+L+E +R +  QYWP+      S + +  V  V    +  Y IR+F +    D+  R I QFQFT W +   +P+     L  + +VH    ++ ++ GPI+VHCSAG GRTG F+ +  ++ER++ E+ +D++  V  +R QR  ++QTEDQY F Y   LE ++
Sbjct:  950 QQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPD-HGVPNHPAPLLMFLRRVHS---EISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQ 1210          

HSP 3 Score: 125.176 bits (313), Expect = 4.083e-28
Identity = 58/60 (96.67%), Postives = 58/60 (96.67%), Query Frame = 2
Query: 2141 MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSLVECTTTPKA 2320
            MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPS VECTTTPK 
Sbjct:    1 MPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMPSFVECTTTPKV 60          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRS1.810e-7656.17protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS2.813e-8058.76protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.599e-6458.76protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS4.638e-6458.76protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRS2.991e-6258.76protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-31.141e-5947.77Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.730e-6147.77Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-39.020e-6047.77Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-31.986e-6147.77Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-32.540e-6147.77Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar1.296e-6554.99gene:FBgn0000464 transcript:FBtr0331241[more]
Lar1.925e-9354.99gene:FBgn0000464 transcript:FBtr0081260[more]
Lar2.545e-6554.99gene:FBgn0000464 transcript:FBtr0331240[more]
Lar3.079e-6554.99gene:FBgn0000464 transcript:FBtr0331242[more]
Lar1.030e-9254.99gene:FBgn0000464 transcript:FBtr0112800[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfb3.402e-6358.53protein tyrosine phosphatase receptor type Fb [Sou... [more]
ptprfa6.001e-7857.84protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfb1.447e-8258.53protein tyrosine phosphatase receptor type Fb [Sou... [more]
ptprfb4.534e-8258.53protein tyrosine phosphatase receptor type Fb [Sou... [more]
ptprfb4.115e-8458.53protein tyrosine phosphatase receptor type Fb [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sema6d8.640e-7857.65semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d1.363e-7957.65semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d2.278e-7957.65semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d1.610e-7957.65semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d1.423e-7858.79semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprs3.790e-7458.60protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprf4.660e-8154.87protein tyrosine phosphatase, receptor type, F [So... [more]
Ptprd4.114e-7758.15protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprd1.001e-7258.15protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprs1.809e-6258.60protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q13332|PTPRS_HUMAN8.691e-7656.17Receptor-type tyrosine-protein phosphatase S OS=Ho... [more]
sp|F1NWE3|PTPRS_CHICK6.343e-6059.24Receptor-type tyrosine-protein phosphatase S OS=Ga... [more]
sp|Q64605|PTPRS_RAT2.128e-7658.60Receptor-type tyrosine-protein phosphatase S OS=Ra... [more]
sp|B0V2N1|PTPRS_MOUSE2.651e-7358.60Receptor-type tyrosine-protein phosphatase S OS=Mu... [more]
sp|A4IFW2|PTPRF_DANRE2.103e-8358.53Receptor-type tyrosine-protein phosphatase F OS=Da... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NQE62.173e-11357.85Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3HRJ83.236e-7959.55tyrosine-protein phosphatase Lar isoform X2 OS=Lin... [more]
A0A1S3HQ462.639e-7959.55receptor-type tyrosine-protein phosphatase delta i... [more]
A0A1S3HSZ81.462e-5959.55receptor-type tyrosine-protein phosphatase delta i... [more]
A0A1S3HQ572.979e-7959.55tyrosine-protein phosphatase Lar isoform X1 OS=Lin... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfb1.391e-6058.85protein tyrosine phosphatase receptor type Fb [Sou... [more]
ptprsa6.161e-5757.39protein tyrosine phosphatase receptor type S [Sour... [more]
ptprsa9.691e-5857.39protein tyrosine phosphatase receptor type S [Sour... [more]
PTPRD4.187e-7958.47protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD3.186e-7958.47protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra1.300e-14941.19protein tyrosine phosphatase receptor type A [Sour... [more]
ptprsa2.460e-13849.26protein tyrosine phosphatase receptor type Sa [Sou... [more]
ca16b5.250e-11535.29carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ptprk3.563e-10936.48protein tyrosine phosphatase receptor type K [Sour... [more]
ENSPMAT00000002738.14.949e-10334.15pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP16.512e-3634.62Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP21.529e-2428.65Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP32.831e-932.62Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469616.822e-5551.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438541.291e-17044.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453829.204e-16142.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481872.837e-15843.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450814.725e-14639.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprfb1.523e-5858.85receptor-type tyrosine-protein phosphatase F [Sour... [more]
PTPRD2.473e-7956.88receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD2.904e-7957.99receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD4.829e-6257.99receptor-type tyrosine-protein phosphatase delta [... [more]
ptprsa4.362e-7157.32receptor-type tyrosine-protein phosphatase S [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038449.12.896e-4797.88SMESG000038449.1[more]
SMESG000038449.12.919e-4797.82SMESG000038449.1[more]
SMESG000035516.11.289e-2898.09SMESG000035516.1[more]
SMESG000035516.16.445e-2698.09SMESG000035516.1[more]
SMESG000038449.12.805e-4797.54SMESG000038449.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010855 ID=SMED30010855|Name=Receptor-type tyrosine-protein phosphatase F|organism=Schmidtea mediterranea sexual|type=transcript|length=7186bp
CTTCCGATCTTGTAAATAAAAGATAAAGCGATCCAAAAGCCTTAAAGAGA
GAACCGTTGGAAATTTATTTTTGTCGTAAATCAGTACAGGCTTAATTTAC
ACATTAAACTTGCTGTGCACTGCACATCATAAAAAAAGAAGAAATCGATT
GGTTTAACAGAAATTTCCCATCAAATACACAAATCCCGGTGAAAAATAGT
GAAAATCGAAACTATTTCACCCAATCTGATTTGATGTTCTAGTGCATTGA
ATTGGCTATCCATTTCATCCACAGCCCAAAACCGGGACAACATTTTATAT
CAGAAAGATTATTTGGAATAATCTAACGATAGGAAACATGAGAAAATTGT
CTTTGAAATTAGGAATTGTATTTCTCAATATATTTATTGTTTTACTAATA
AAAAATCCGAAAGTTCTGAACGCTGAAAAATCAAATAATCAGCAAAGGAT
TATTCTTCCGTTATGGAAAAGATCCGTTGATCATAATAGACAATTGGATT
ACACAATTATTTATAAGCAGAAACCTCCGAAAATTGTTTTGAAGTTGAAA
AATATGAAAGTTCTTCGTGATGACCAAGCGATATTTATTTGTGCAATTGA
CGGAAATCCGTCGCCAAAAATTCGATGGCGAATAAATCAAAGTTTCACTT
TACCAAAGAGATTTTCTGTTACAAAAATTTCCCCGAAAAAGTCATTATTG
CGAATAAATCCGGTAAAATTGGATGACAATAAAACAAGAATAACTTGCTT
AGCTCAAAACTCTTTGGGTTCTACAGATTCATATGCATCACTGAGTGTGT
ACGCAAACAAACAAGAAATACCTTCCGGTTTTCCAACGATTATTTCAAAA
TCATCAGTTATCGTAAATGAAAAAAATACGAAGGTAATCTTAGAGTGTAA
AGTTCAAGGAGTTCCGACGCTGACAATTTTTTGGCTAAAGGATTCTATTC
CAATAGACTTTGAAAATCAGAGAATTAACACATCAAAAAATGGTAATTTG
GAAATTATCAGAACTCAAGAAGACGACGAAGGAGGTTATGAATGTGTCGC
AACAAATAATCTTGGAACCGTCGTTTCCAGTGTGATCCGTTTAATGATTC
GAGTCAAATATTTTTCTCCAAATTTCATCAAAGTGTCCGGTGATCAAATT
GTCACTCCTGGATCTTCAGTAACGTTGAAATGTCGTGCTTTGGGTAATCC
GATTCCTGAAGTATATTGGCAATGTGGTCAAACGATTCTTCAATCTCAAT
CCAAAAATTTAACCGGCCAAAGAGCTGAAGCAAATGTTATTTTGTCAGAT
TTGTCAGAATCGCTAAAATGTATTTGTGTTGCCAAAAACATAAAAGAATC
CATTTCTAGATCTATATCCGTCACAATTCAAGAACCATCAACAGTACCAA
CAGCAATTAGAGTCACTTACATTGGACCAAATTCATGTAATATATCATGG
AATCAGAAGCCCATTCGAGAAGAATACTTAAGATATAAAGTATTTGTTAT
GAAAACAAAAGATTTTTTAGTCAACAAAAATTTAACTTCTGGGACGATTA
TCAATGTGAAAAAATCTGATTATGAATTTGTAAAGACAAAATCACTGCAA
AATCTTTTACCATTTACAAATTATACTGTCTGGTTAGAATCTTTTTCAAT
GCAAACGGACTCAATCAAATCAAATTTAGTGACATTTACAACTTCAGAAT
TACCGCCATATACTCCTCCAAAAAATGTTGAGCTTGGATCTATTTCAAAT
GGTGCTGTTTTAATAACATGGGATCCTCCAGATATACCAAATGGGATAAT
TACAACTTACAATATTTACTATACACAATTTAAAGATAAACCCTTATCTT
CATGGGATAAATATACAGTGAAATCATCAAAAAAGTCAGATTCACCCCAA
CAGACAACTATTCTATCATATATGGCTAACAATACTACTTATTATATTTC
GATCAGTGCCCAAAATTCAGCTGGATCTAGCCCTGTATCTGAACCTCTTG
CAATTCTTATTAGACCCGGAGTTGTCCAAGGACCTAAGAGTTTCCGAGCC
ATTGCTAAATCCTCAACTGAAATTGAATTATTTTGGGATTCTCTACCTTC
AAAATCTCAAGTTAATATCATATATTATTATTTGGTATATATGCCAAGGT
CAATGCCTCATCTGAAAAAAGAGAAAAGATTTGATTATAGTCCACAAAAA
AATACAATTCTCATTGGAAGTTTGCAGCCAAATACCACTTACGAATTCCA
ATTATCTACAATAACTAACACTGCTAATGGGATGCCATCCCTTGTCGAAT
GTACAACAACACCAAAAGCATGTCCGATGATAGTTAAAAACTGGGATTTA
TCTATTTCTAAAAGAGGAGGAATTGAAATATGTTGGCGGGAAATTCCAGA
AAAAAATTCAAAAATAAATATTAGAATTTATTTTCAATCAAAACTTGGAA
ATTTCTCGGTTCAGCCTTCTTTGCAAACTATTGGTAGTAAAATGTGCTAC
CAACAATTAAAAGAAATAAAACAAAATATGAACTACAAAGTTTTAATTGT
ACATAAAAAAAGAAATTGTAAAACTCCTATTGAACATAGCGATCAAATTT
TTACAAAATCCTCCGTTTTCATTGAGGATCCCATCGAAGTTCATACTCGA
GCGGTTAATTCAACTGCCATAGAGGTATTCTGGCAAACGAATTCAAACAA
AAGCAAAGAAGCAGAACATTACCGCATTCAGTTACATGGGTATTTTCCTA
ACCGTGAAAATCATAACAAGCCTTTGAAAGATATCTATATAAAGAAGACA
ATGTCTAATTCTGAAAGCCAAAATATAACCATGCGATATATTTTTGCGAA
TTTAGCTCCTGACAGTGAATATCAAATTTATTTGAATTCCATAACCAGAG
AGAGGCAAGGAATGACTTTTAAATCAGAACCCATCAAAACGTGGCCGAAA
AAGTTGCCAAAACCGAAATTTATTCATTTGAGATTATCGTGCTCAATAGA
AAACCCATGCGTGACGGTGGAATGGAAAGAAGACATAAAGAATAAGAAAT
GGATCAAAGGATATCGGTTGAGATATTATCCTTTGGTAGAAAATGACGAG
ATAAAATATAAAGTTCTTGAAAGAAATGTATCTGAATCAAAATTTGAAAC
TTCGTCCTTTGACCATTGGCAAGGATTTCGGTATAATTTTAAAGTTGCTG
CATTTAATGAATTTGAAATGGGTGACGAAATCACTGATCAAATTGATATT
TTAGAAGGAAGCCCATCTGTATTTCCTTCAAATTTTAAATTAAAAACTAC
CTCAAATCTTAGTCCGACCTCTGTGATGTTTACATGGAACAAAGTTTCAC
AACATTCATTAAATGGAAAATTCAATTATTATGAAGTTTGGTGTTTTGTT
TTAAGTCATGAAAATAAAACATCGACGACATATACAACGAAGACTGAATT
TATTACAATAAATAATCTTAAAGAAGATTCAAATTATGCTTGCCGAGTAC
GGGTTTGGATTCAAAAGACTTTTAGTTCATGGAGTGATGCAATTTATTTT
AAAACAAGAGATGCTCATTTTCCAGCACCAGATGCTATCAGATTTATTCG
TTTGTCACAATCAACTGCACAAATCACATGGAAATGGAATCCAGATTTTC
TTATACATTATTCGCATTTTATTATTTATTACACCAATGAAAAAACATTT
TTAAACAAAATATGGCTTATGAAATCGACCAATACAACATTCACCAAAGT
CATATTGGATTCTCTCAATGCTACAATATCATACGTCATTCGAGTATCGT
CTGTATCGAATAGAGGAATTGAAGGTCCTATGTCTGACAACATTAAAGAA
ACTTCTTTAACTTCTTCGAATTGGCCAGCAAAATTTATCAGTGAGCTCTC
TTGTGCTCCGGTATCAAGTACAATAATACAATTACGCTGGTTTATTAGCT
TTCAAATACAATATTTGACTCATTTTCGGGTTAACTTTTCTGGAATAACA
AAATTTCAATCAGAAAATGGCGCCGTCTCTTTAATGAGAGATGAGCAAGA
ACAATCTGCATTGGTATCAAACATTGGAGACAATAAAACGCTATTGTCAT
TATTTTCTAACCATAAAACATACTATAGTCACCAGATTTGGAAGTTAAAG
CCAAATACAAGATATACCATTGGCATCGAACCCATTTTTAGTCCCAACAG
TAACATGATTGGAGTGTCAAATCATACAATTTGTTCAACCTTCAAAGAGC
TTCCTAGTTCTTTGGAAACTGTAATGTTGTCAGATATTAATAAATCTTCA
AACCAAATTGATATTTTACTTCAAAGACCAAATACAGAAAACGGCACTAT
CGACGACTATTATGTAGTGGTTAAGGTTTTGAAAGAAAAAACAAGAAAGC
TTCGGTCAGTGAATTTGGTTGACGAAAGAACAATCGGAAATCTTATTCAA
AACAGTTCATTCAATAGAAACGAAATTTCAAATCCCTATATTGCAGTTTC
GTTGAAAGATGAGTTGATATTTCCCATTAGTACGCCACTGAAGCAAGTCC
ATAAAATTAAAATTGGTGAAAATAATATAAATGGACAATTTAAAAACTGG
AAACTCGATCCAAAATTTTATTATCAATTTCAAATAATTGCTTGTATACG
ACTTAAAGAATCTCAAAATACTATTTTGAAATGCATTTCGAGCCCTTGGA
CAACTTCGATAAATATCATGCATACAATTCTATCCAAAGGAAATAAACCA
AATTTTAATGTTGACAACAACGTATCTCAGAATTTACTGAGGAAAGGACC
AAGCACCTTTACCACAACGACAGTCGTCGTAATTTTAGGAATCGTGATTC
TCGCTGTATTAACGATGTCCATATTTTTGATTGTTAAAAGACGAAGAGTA
TTAAAATCAAAACTAGGAAGTGTATATGGATCTCACTGTAATAGATCATT
AAAAGTTTATGTCTGCCGCATGGATACATTTACCAGTCCAATAGGCTCAT
TAAGAGCCCCGAAAATTCTAGACGAAAAGTCCATCTGCATGGAACACTTG
TTAAAGGAACCACTTGTGGACTCATCAGTGAGAATTTCTACAAGTGGGTC
TTTAAGATTCAAAAATCACGGAGCAAACTATTTGGATGTTAATAAAATTC
AATTATCTTCAACCCCGGATTTATTAGTGAGGTCTTCGGTTCCCCAAACG
TTAGGTTCTCTAGTTCAGTTTCACGGGCAACACATTCAAAATAGATATCT
AGAATATGCGCCAATTCCAGTTGAAGCGTTATCCGAACATGTTTCCTTGC
TTAAAGAAAATGATAGCAAATTATTTAACAAGGAATATGAGTCTATTGAA
CCTGGACAACAATTTACATGGAATTGTTCAAATATGGAAATAAACCGACC
TAAAAACCGCTATGCAAATGTTATTGCATATGACCATAGCAGAGTTATTC
TGCAACCTCTTTTTGACCAAAGAAATTCTAACTTCAGTGAAACTCCCATT
GTCTCAGGCTCGGATTATATAAATGCTAATTTTATAAGTGGTTATCTTAA
TCCAAAAGCTTATATTGCTACCCAAGGCCCGTTAGCCGAAACTATTGGAG
ACTTTTGGAGAATGATGTGGGAACAGAACTCTTCTGTTATTGTTATGATG
ACTCGTTTAGAGGAAAGAGACAGAACCAAGTGTGATCAATATTGGCCACT
AGGAGGTAAAGGCTCAATCTCAACATTCAGTTACATAAATGTGACTATTG
TTGATATAATTGAACTAGCATATTATACAATAAGAAAATTTCACATACAA
AAATTAAATGATAATAATGTTCGAGAAATCTTTCAATTTCAATTCACAGC
CTGGCCTGATCATGGAGTTCCAAATCATCCGGCTCCTTTGCTAATGTTTC
TCAGGAGAGTTCATTCAGAAATCTCAAGAAATTGCGGACCAATAGTAGTC
CATTGTTCAGCAGGAGTCGGTCGAACCGGAGCATTTATTGTAATTGACTA
TATGCTTGAGAGGCTACGATATGAAAATACAGTTGACATTTATAACTATG
TGACAAACATTCGATCGCAAAGAAATTACATGGTTCAAACTGAGGATCAG
TATATATTTATTTATGAGACTTTACTGGAAGCTGTCCAATGTGGAAACAC
AGAAGTGCCTGTTTGTGAATTAGCTCACCATATTGAAAAATTAAACCAAA
TAGAAATTAATCACAAAACAGCCGATGGTATTCAAATGACAGGCTTACAA
ATGGAATTTGAAAACTTGGTTTTAAGCTCTGAAGGATTTCTTCAAGGAAT
AAAACCCAACGCCAATAATCACTCACATTGCTCAACTCCATCAACTGCCC
ATGCAAATATTTGTACGAATTATCAACCTCTTACTTACGAAACTGCAACT
CAAATTTGTAACCAAATGAAAAACAGAATCCTTCAAATTCTTCCGCCAGA
TTTTAGTAGAGTAAATATATGTCCCATTAGAGGCGTTGAAGGCTCCGATT
ATATCAATGCAAGTTGGATAGACGGCTATAAGTCTCGTAAAGCATACATA
GCTGCCCAATCTCCACTATCAGAAACTTGTGAAGATTTCTGGCGAACTCT
ATGGGAGCATAATTCCTCTATCGTAGTCATGTTAACGCAGCTCAAAGAAA
ACAATCGAGAACGCTCTTTTCAATATTGGCCAGTAAAACGTTCGTCGAGA
TATCAGTTTTTCATCGTCGACCCAGTGGCTGAATACAACATGACAACGTA
TATTATTCGAGAATTCAAGTTAACTGACACTAGAGATTCACAAAGTCGAG
TAATTCGTCAGTTTCAATTCACAGATTGGCAAGAAAGTGAAAGTATACCT
CATTCCACACAAGTCTTTTTAGATCTTATCAATCAAGTTCATAAAACAAA
GATTCAACTGGGACAAGATGGTCCGATAATGGTGCATTGCAGTGCTGGGT
CTGGAAGAACGGGCATATTTTTGGCTCTATCTAACATTATTGAAAGAATG
AAAAATGAAAGCGTTATAGATCTATTTCAAACTGTTAAACTTCTAAGATG
GCAGAGACCTGCACTTTTACAAACAGAAGACCAATATCAATTCTGCTATG
TCGCTGCGTTAGAGTACCTAAAGTTTTTCGAACAGATTCGTTTTGATTTA
TAATTTTAATACTCGGTGATTTCTTGACAGTTTTTC
back to top

protein sequence of SMED30010855-orf-1

>SMED30010855-orf-1 ID=SMED30010855-orf-1|Name=SMED30010855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2272bp
MRKLSLKLGIVFLNIFIVLLIKNPKVLNAEKSNNQQRIILPLWKRSVDHN
RQLDYTIIYKQKPPKIVLKLKNMKVLRDDQAIFICAIDGNPSPKIRWRIN
QSFTLPKRFSVTKISPKKSLLRINPVKLDDNKTRITCLAQNSLGSTDSYA
SLSVYANKQEIPSGFPTIISKSSVIVNEKNTKVILECKVQGVPTLTIFWL
KDSIPIDFENQRINTSKNGNLEIIRTQEDDEGGYECVATNNLGTVVSSVI
RLMIRVKYFSPNFIKVSGDQIVTPGSSVTLKCRALGNPIPEVYWQCGQTI
LQSQSKNLTGQRAEANVILSDLSESLKCICVAKNIKESISRSISVTIQEP
STVPTAIRVTYIGPNSCNISWNQKPIREEYLRYKVFVMKTKDFLVNKNLT
SGTIINVKKSDYEFVKTKSLQNLLPFTNYTVWLESFSMQTDSIKSNLVTF
TTSELPPYTPPKNVELGSISNGAVLITWDPPDIPNGIITTYNIYYTQFKD
KPLSSWDKYTVKSSKKSDSPQQTTILSYMANNTTYYISISAQNSAGSSPV
SEPLAILIRPGVVQGPKSFRAIAKSSTEIELFWDSLPSKSQVNIIYYYLV
YMPRSMPHLKKEKRFDYSPQKNTILIGSLQPNTTYEFQLSTITNTANGMP
SLVECTTTPKACPMIVKNWDLSISKRGGIEICWREIPEKNSKINIRIYFQ
SKLGNFSVQPSLQTIGSKMCYQQLKEIKQNMNYKVLIVHKKRNCKTPIEH
SDQIFTKSSVFIEDPIEVHTRAVNSTAIEVFWQTNSNKSKEAEHYRIQLH
GYFPNRENHNKPLKDIYIKKTMSNSESQNITMRYIFANLAPDSEYQIYLN
SITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDI
KNKKWIKGYRLRYYPLVENDEIKYKVLERNVSESKFETSSFDHWQGFRYN
FKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTW
NKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNY
ACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKW
NPDFLIHYSHFIIYYTNEKTFLNKIWLMKSTNTTFTKVILDSLNATISYV
IRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLR
WFISFQIQYLTHFRVNFSGITKFQSENGAVSLMRDEQEQSALVSNIGDNK
TLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICS
TFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKE
KTRKLRSVNLVDERTIGNLIQNSSFNRNEISNPYIAVSLKDELIFPISTP
LKQVHKIKIGENNINGQFKNWKLDPKFYYQFQIIACIRLKESQNTILKCI
SSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVIL
GIVILAVLTMSIFLIVKRRRVLKSKLGSVYGSHCNRSLKVYVCRMDTFTS
PIGSLRAPKILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLD
VNKIQLSSTPDLLVRSSVPQTLGSLVQFHGQHIQNRYLEYAPIPVEALSE
HVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDH
SRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLA
ETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYI
NVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAP
LLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVD
IYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIE
KLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCST
PSTAHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGV
EGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLT
QLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRD
SQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVH
CSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQY
QFCYVAALEYLKFFEQIRFDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000242PTPase_domain
IPR003599Ig_sub
IPR003961FN3_dom
IPR003598Ig_sub2
IPR003595Tyr_Pase_cat
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0021510spinal cord development
GO:0021549cerebellum development
GO:0021766hippocampus development
GO:0021987cerebral cortex development
GO:0022038corpus callosum development
GO:0030517negative regulation of axon extension
GO:0032687negative regulation of interferon-alpha production
GO:0032688negative regulation of interferon-beta production
GO:0034164negative regulation of toll-like receptor 9 signaling pathway
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
GO:0048681negative regulation of axon regeneration
GO:0061000negative regulation of dendritic spine development
GO:0090557establishment of endothelial intestinal barrier
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
GO:0070062extracellular exosome
GO:0099061integral component of postsynaptic density membrane