slc25a-21

Overview
Nameslc25a-21 (AKN21589.1)
Smed IDSMED30010853
Length (bp)1110
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-21 (SMED30010853) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-21 (SMED30010853) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-21 (SMED30010853) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-21 (SMED30010853) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010853

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010853SMESG000073400.1 dd_Smed_v4_13134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010853SMESG000073400.1 dd_Smed_v4_13134_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010853SMESG000073400.1 dd_Smed_v6_13134_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30010853SMESG000073400.1 dd_Smed_v6_13134_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30010853SMESG000073400.1 dd_Smed_v4_13134_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-21 vs. Ensembl Human
Match: SLC25A11 (solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981])

HSP 1 Score: 327.791 bits (839), Expect = 8.579e-111
Identity = 157/291 (53.95%), Postives = 205/291 (70.45%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G L LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V +++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   20 PKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. Ensembl Human
Match: SLC25A11 (solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981])

HSP 1 Score: 315.079 bits (806), Expect = 4.153e-106
Identity = 150/272 (55.15%), Postives = 194/272 (71.32%), Query Frame = 3
Query:  216 TLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G L LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V +++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY
Sbjct:   25 TVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAY 296          
BLAST of slc25a-21 vs. Ensembl Human
Match: SLC25A11 (solute carrier family 25 member 11 [Source:HGNC Symbol;Acc:HGNC:10981])

HSP 1 Score: 268.855 bits (686), Expect = 1.714e-88
Identity = 129/229 (56.33%), Postives = 165/229 (72.05%), Query Frame = 3
Query:  354 SGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            +GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G L LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V +++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   31 AGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 259          

HSP 2 Score: 61.6178 bits (148), Expect = 3.561e-10
Identity = 44/170 (25.88%), Postives = 76/170 (44.71%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYE-RYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCR 677
            +K  IG ++G     +  P +V   RM   G+     ++ YK+ F+A+  IT  EG+L ++ G    + R      A+L  Y+   +    S     N+      ++I+GLV +    P +IA  R+    +  I+ K  Y+N    +  ++  +GF  LWK   P   R
Sbjct:   70 LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRI--QNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYAR 237          
BLAST of slc25a-21 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 172.94 bits (437), Expect = 7.207e-51
Identity = 96/290 (33.10%), Postives = 163/290 (56.21%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKS--YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIING-IPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ  D   K   Y+  F A++ I   EG+LA+YSG++ AL RQA+Y T ++GIY +L   +  +     L I +   +++G++ S +  P ++  IRM A G +F      ++ +++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  + D IL HF++S   GL  A+ S PVD+++TR+ N R I G +  Y    +   +++K+EG  +L+KGF P +L++G   +I FI +EQ+  
Sbjct:    5 NWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIY-------QQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 287          

HSP 2 Score: 53.1434 bits (126), Expect = 3.075e-7
Identity = 47/188 (25.00%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFI-AIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILI 737
            I    G  SG++++ I  P DV+K RMQ  G   +Q S   SF  IY     EG   ++ G+     R A      L +Y    +         +  +  F+ +   GL G+    P ++   RM       +     Y+     I  + + +GF  L+K   P   R    N I   +Y Q+K++ I
Sbjct:  108 INMICGVVSGVISSTIANPTDVLKIRMQAQGSL-FQGSMIGSFIDIYQ---QEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAI-VGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 290          
BLAST of slc25a-21 vs. Ensembl Human
Match: SLC25A14 (solute carrier family 25 member 14 [Source:HGNC Symbol;Acc:HGNC:10984])

HSP 1 Score: 172.94 bits (437), Expect = 1.769e-50
Identity = 96/290 (33.10%), Postives = 163/290 (56.21%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKS--YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIING-IPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ  D   K   Y+  F A++ I   EG+LA+YSG++ AL RQA+Y T ++GIY +L   +  +     L I +   +++G++ S +  P ++  IRM A G +F      ++ +++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  + D IL HF++S   GL  A+ S PVD+++TR+ N R I G +  Y    +   +++K+EG  +L+KGF P +L++G   +I FI +EQ+  
Sbjct:   37 NWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIY-------QQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 319          

HSP 2 Score: 52.7582 bits (125), Expect = 3.780e-7
Identity = 47/188 (25.00%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFI-AIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILI 737
            I    G  SG++++ I  P DV+K RMQ  G   +Q S   SF  IY     EG   ++ G+     R A      L +Y    +         +  +  F+ +   GL G+    P ++   RM       +     Y+     I  + + +GF  L+K   P   R    N I   +Y Q+K++ I
Sbjct:  140 INMICGVVSGVISSTIANPTDVLKIRMQAQGSL-FQGSMIGSFIDIYQ---QEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAI-VGHVDLYKGTVDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 322          
BLAST of slc25a-21 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 338.576 bits (867), Expect = 1.377e-115
Identity = 155/288 (53.82%), Postives = 213/288 (73.96%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            +P+ +KFA GG++G+  TL++QPLD+VK RMQ+SG  G +K Y+SS  A+  I  NEG+ A+Y+GLSA L RQATYTT RLG Y  L ER++ K+   +  +K  + + AG +GSFVGTPAEIALIRMT DG  P+EQ+RNY  V +A+  I +++G L LW+   PT+ R +VVN  QLA+YSQ KQ L+ +  + DGI  HFLASMISGL T + SMPVDI KTRIQ+M++I+G PEY + ++V+ ++ KNEG+ +LWKGF PY++++G +TV+ FII EQM+ AY
Sbjct:    7 VPNVVKFAFGGTAGMGATLVVQPLDLVKNRMQLSGTTG-KKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQMNAAY 293          
BLAST of slc25a-21 vs. Ensembl Celegans
Match: misc-1 (Mitochondrial 2-oxoglutarate/malate carrier protein [Source:UniProtKB/Swiss-Prot;Acc:P90992])

HSP 1 Score: 338.576 bits (867), Expect = 1.377e-115
Identity = 155/288 (53.82%), Postives = 213/288 (73.96%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            +P+ +KFA GG++G+  TL++QPLD+VK RMQ+SG  G +K Y+SS  A+  I  NEG+ A+Y+GLSA L RQATYTT RLG Y  L ER++ K+   +  +K  + + AG +GSFVGTPAEIALIRMT DG  P+EQ+RNY  V +A+  I +++G L LW+   PT+ R +VVN  QLA+YSQ KQ L+ +  + DGI  HFLASMISGL T + SMPVDI KTRIQ+M++I+G PEY + ++V+ ++ KNEG+ +LWKGF PY++++G +TV+ FII EQM+ AY
Sbjct:    7 VPNVVKFAFGGTAGMGATLVVQPLDLVKNRMQLSGTTG-KKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQMNAAY 293          
BLAST of slc25a-21 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 152.91 bits (385), Expect = 1.427e-43
Identity = 89/276 (32.25%), Postives = 144/276 (52.17%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            GG +G +      PLD++K ++Q   Q        S       I  N+GILA Y+G+SA++ RQ TY+T R GIY T+ ++       P    K  +A  AG  G  VGTP ++  +RM  D   P+EQ+RNY++    +  I  ++GF+ ++        R +++   QL+ Y QIKQ LI +    D +  HF +S+ +     V++ P+D++KT     R++N  P E+    + F    K  G    +KGF+P + ++  +TV+ FI FEQ+
Sbjct:   15 GGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLS-----LKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQDQPLP-FYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKT-----RMMNAAPGEFKGILDCFMFTAK-LGPMGFFKGFIPAWARLAPHTVLTFIFFEQL 278          
BLAST of slc25a-21 vs. Ensembl Celegans
Match: slc-25A10 (Oxoglutarate/malate carrier protein; SLC (SoLute Carrier) homolog [Source:UniProtKB/TrEMBL;Acc:G5EE96])

HSP 1 Score: 152.91 bits (385), Expect = 1.427e-43
Identity = 89/276 (32.25%), Postives = 144/276 (52.17%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            GG +G +      PLD++K ++Q   Q        S       I  N+GILA Y+G+SA++ RQ TY+T R GIY T+ ++       P    K  +A  AG  G  VGTP ++  +RM  D   P+EQ+RNY++    +  I  ++GF+ ++        R +++   QL+ Y QIKQ LI +    D +  HF +S+ +     V++ P+D++KT     R++N  P E+    + F    K  G    +KGF+P + ++  +TV+ FI FEQ+
Sbjct:   15 GGVAGAMAACCTHPLDLLKVQLQTQQQGKLTIGQLS-----LKIYKNDGILAFYNGVSASVLRQLTYSTTRFGIYETVKKQLPQDQPLP-FYQKALLAGFAGACGGMVGTPGDLVNVRMQNDSKLPLEQRRNYKHALDGLVRITREEGFMKMFNGATMATSRAILMTIGQLSFYDQIKQTLISSGVAEDNLQTHFASSISAASVATVMTQPLDVMKT-----RMMNAAPGEFKGILDCFMFTAK-LGPMGFFKGFIPAWARLAPHTVLTFIFFEQL 278          
BLAST of slc25a-21 vs. Ensembl Celegans
Match: ucp-4 (UnCoupling Protein (Mitochondrial substrate carrier) [Source:UniProtKB/TrEMBL;Acc:O01883])

HSP 1 Score: 120.553 bits (301), Expect = 4.030e-31
Identity = 76/297 (25.59%), Postives = 150/297 (50.51%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAII----AGLVGSFVGTPAEIALIRMTADGIFPIE-QKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNM-----------RIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            K+ +  ++ ++   +  PLD+ KTR+QI+ ++ + K         Y I   EG +A+++G++ A+ R   YT  R+G Y  +  R  + N     +  L+ +++    +GL+  F  +P ++  ++M  +G+  ++ Q   Y         +    GF GLW   +P   R  ++N   +A+Y  +K  LI+   L D  L H +AS  +GL  A++S+P D++KTR+ +            +    +  Y    + + +I KNEG  SL+KGFLP ++++   ++  ++ +E++ +
Sbjct:   26 KYFLSCTAALVAETVTYPLDITKTRLQIA-RNKFTKG--GMVQVTYDIIRREGAMALWTGVAPAITRHYIYTGIRMGAYEQI--RLLTFNKEVEKSFPLWKSMLCGAFSGLIAQFAASPTDLVKVQMQMEGLRRLQKQPLRYTGATDCFRSLYRTQGFFGLWIGWMPNCQRAALLNMADIATYDSVKHGLIDNFELKDNWLTHAVASACAGLAAAIVSLPSDVVKTRMMDQIRHELDAKMMHKKNTHVDLYKGVVDCYIKIIKNEGFFSLYKGFLPSYIRMAPWSLTFWVSYEEIRK 317          
BLAST of slc25a-21 vs. Ensembl Fly
Match: CG1907 (gene:FBgn0039674 transcript:FBtr0085447)

HSP 1 Score: 302.753 bits (774), Expect = 2.761e-101
Identity = 143/288 (49.65%), Postives = 196/288 (68.06%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSK-NHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETK-SLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            + IKF  GG SG+  T+++QPLD+VKTRMQISG    +K Y+SS   I  I + EG LA+Y G+ AAL RQATYTT RLG+YT L + +  K    P +   + +  IAG  G+F+GTPAE+AL+RMT+DG  P+ ++RNY NV +A+  I  ++G   LW+  LPT+ R +VVN  QLASYSQ K         + +GI LHF ASM+SGL T + SMP+DI KTRIQNM++++G PEY    +V  R+ + EGV +LWKGF PY+ ++G +TV+ FII EQ+++ Y
Sbjct:   17 NAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGY 304          
BLAST of slc25a-21 vs. Ensembl Fly
Match: CG18418 (gene:FBgn0035568 transcript:FBtr0073366)

HSP 1 Score: 291.967 bits (746), Expect = 3.810e-97
Identity = 137/289 (47.40%), Postives = 203/289 (70.24%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSK-NHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            +P ++KF +GG+SG+L T I+QPLD++KTRMQISG  G  + YK+SF+ +  +  NEGIL++Y+GLSA L RQATYT+A++G+Y    + Y     ++P++   + + I+AG  G+  G PAE+ALIRM +D     E +RNY+NV  A   I++D+G + LW+  LPT+ R +VVN +QLASYS +K  L     LS+GI LH  A+++SGL T+V SMP+D+ KTRIQ M++I+G PEYS   +V  ++ KNEG  ++WKGF PY +++G +T+  F+  EQM++AY
Sbjct:   12 VPTHMKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLG-TREYKNSFEVLSKVLKNEGILSLYNGLSAGLLRQATYTSAKMGVYQMELDWYRKNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMMSDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQL--HGYLSEGIPLHLTAALVSGLLTSVTSMPLDMAKTRIQQMKVIDGKPEYSGTIDVLKKVLKNEGAFAVWKGFTPYLMRMGPHTIFSFVFLEQMNKAY 297          
BLAST of slc25a-21 vs. Ensembl Fly
Match: CG7514 (gene:FBgn0035567 transcript:FBtr0073367)

HSP 1 Score: 271.937 bits (694), Expect = 2.162e-89
Identity = 138/293 (47.10%), Postives = 190/293 (64.85%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSK-NHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILV 1040
            IP Y+ +  GG +G+L T I+QPLD+VKTRMQIS   G    YKSSFD +  +  NEGILA+Y+GLSA L RQATYTTAR+G Y    + Y  + N  P +   + + I+AG  G+  G PAE+ALIRM +D   P  ++RNY  V +A   I++D+G + LWK  +PT+ R ++VN +QLASYSQ+K    E  S   G+ LH  A+M+SGL T + SMP+D+ KTRIQ  +      EY    +V  ++ KNEG+ SLWKGF PY  ++G +TV  FI  EQ+++AY+ +V
Sbjct:   10 IPGYMMYINGGLAGMLGTCIVQPLDLVKTRMQISATTG---EYKSSFDCLLKVFKNEGILALYNGLSAGLMRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGNPAEVALIRMMSDNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYFS---GLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQK----TAEYKGTMDVLMKVSKNEGIASLWKGFTPYLCRLGPHTVFAFIFLEQLTKAYKHIV 292          
BLAST of slc25a-21 vs. Ensembl Fly
Match: Dic1 (gene:FBgn0027610 transcript:FBtr0082747)

HSP 1 Score: 159.844 bits (403), Expect = 3.017e-46
Identity = 87/275 (31.64%), Postives = 150/275 (54.55%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            GG + +   ++  PLD++K  +Q       Q+ + S    I  +   +G+L  Y+GLSA++ RQ TY+TAR G+Y    ++Y + +   +   K+ +A  +GLVG  VGTPA++  +RM  D   P +Q+RNY N F  +  +   +GF  L+        RG+++   Q+A Y Q K  L+ T    D ++ HF AS+++G     L+ P+D++KTR  N +      E++  W++     K  G    +KG++P F+++G +T+I F+  EQ+
Sbjct:   13 GGLASVGAAMVTHPLDLIKVTLQT------QQGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEA-GKKYVNTD---SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK----PGEFNGLWDIVKHTAK-LGPLGFFKGYVPAFVRLGPHTIITFVFLEQL 272          

HSP 2 Score: 49.6766 bits (117), Expect = 1.840e-6
Identity = 49/204 (24.02%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQ--ISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIY--TTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIR-MTADGIFPIEQKRNYRNVFHAIGCIIEDD---GFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGIL 767
            K A+ G+SG++  ++  P D+V  RMQ  +      +++Y ++FD +  +   EG   ++SG +AA  R    T  ++  Y  T +Y   ++     NL      +++AG + + +  P ++   R M A    P E        F+ +  I++     G LG +K  +P         F++L  ++ I  + +E   L  G L
Sbjct:   96 KVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY-LLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK---PGE--------FNGLWDIVKHTAKLGPLGFFKGYVPA--------FVRLGPHTIITFVFLEQLRLKFGTL 279          
BLAST of slc25a-21 vs. Ensembl Fly
Match: Dic1 (gene:FBgn0027610 transcript:FBtr0346113)

HSP 1 Score: 159.844 bits (403), Expect = 3.017e-46
Identity = 87/275 (31.64%), Postives = 150/275 (54.55%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            GG + +   ++  PLD++K  +Q       Q+ + S    I  +   +G+L  Y+GLSA++ RQ TY+TAR G+Y    ++Y + +   +   K+ +A  +GLVG  VGTPA++  +RM  D   P +Q+RNY N F  +  +   +GF  L+        RG+++   Q+A Y Q K  L+ T    D ++ HF AS+++G     L+ P+D++KTR  N +      E++  W++     K  G    +KG++P F+++G +T+I F+  EQ+
Sbjct:   13 GGLASVGAAMVTHPLDLIKVTLQT------QQGHLSVAQLIPKLAREQGVLVFYNGLSASVLRQLTYSTARFGVYEA-GKKYVNTD---SFGGKVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIYLLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK----PGEFNGLWDIVKHTAK-LGPLGFFKGYVPAFVRLGPHTIITFVFLEQL 272          

HSP 2 Score: 49.6766 bits (117), Expect = 1.840e-6
Identity = 49/204 (24.02%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQ--ISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIY--TTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIR-MTADGIFPIEQKRNYRNVFHAIGCIIEDD---GFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGIL 767
            K A+ G+SG++  ++  P D+V  RMQ  +      +++Y ++FD +  +   EG   ++SG +AA  R    T  ++  Y  T +Y   ++     NL      +++AG + + +  P ++   R M A    P E        F+ +  I++     G LG +K  +P         F++L  ++ I  + +E   L  G L
Sbjct:   96 KVALAGASGLVGGIVGTPADMVNVRMQNDVKLPPQQRRNYNNAFDGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQTKIY-LLATPYFQDNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAK---PGE--------FNGLWDIVKHTAKLGPLGFFKGYVPA--------FVRLGPHTIITFVFLEQLRLKFGTL 279          
BLAST of slc25a-21 vs. Ensembl Zebrafish
Match: slc25a11 (solute carrier family 25 member 11 [Source:ZFIN;Acc:ZDB-GENE-040625-79])

HSP 1 Score: 331.643 bits (849), Expect = 1.238e-112
Identity = 160/290 (55.17%), Postives = 204/290 (70.34%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKN-HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRI 1034
            P  IKF  GG +G+  T+ +QPLD+VK RMQ+SGQ    + YK+SF A+  I  NEG+  IY+GLSA L RQATYTT RLGIYT L+ER S  +   PN  +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++    D IL HF ASMISGL T   SMPVDI+KTRIQNMR+I+G PEY +  +V  ++ +NEG  SLWKGF PY+ ++G +TV+ FI  EQM++ Y+I
Sbjct:   14 PKSIKFLFGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSFHAVGSILRNEGVRGIYTGLSAGLLRQATYTTTRLGIYTILFERMSKADGTPPNFFMKALIGMTAGATGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALVRITREEGVTTLWRGCIPTMARAVVVNAAQLASYSQSKQALLDSGYFRDDILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLVKVIRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKFYKI 303          
BLAST of slc25a-21 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 186.037 bits (471), Expect = 5.039e-56
Identity = 95/286 (33.22%), Postives = 161/286 (56.29%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD-GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ    +  Y+  F A+  I   EG+ A+YSG+S AL RQA+Y T ++G Y TL + + S      + I +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  + D +L HF++S   GL  A+ S PVD+++TR+ N R++ G P Y    +   + ++NEG  +L+KGF P +L++G   +I F+ FEQ+ +
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMSNFMNIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKK 283          

HSP 2 Score: 53.1434 bits (126), Expect = 1.579e-7
Identity = 43/178 (24.16%), Postives = 72/178 (40.45%), Query Frame = 3
Query:  201 SGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIA-IIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQI 731
            SG+L++ +  P DV+K RMQ  G    Q S  S+F  IY     EG   ++ G+     R A      L +Y    +         +  +  FI+    GL G+    P ++   RM    +  +     Y+     +     ++GF  L+K   P   R    N I   ++ Q+K++
Sbjct:  113 SGVLSSSLANPTDVLKIRMQAQGSL-LQGSMMSNFMNIYQ---TEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRV--LAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKL 284          
BLAST of slc25a-21 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 186.037 bits (471), Expect = 5.039e-56
Identity = 95/286 (33.22%), Postives = 161/286 (56.29%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD-GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ    +  Y+  F A+  I   EG+ A+YSG+S AL RQA+Y T ++G Y TL + + S      + I +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  + D +L HF++S   GL  A+ S PVD+++TR+ N R++ G P Y    +   + ++NEG  +L+KGF P +L++G   +I F+ FEQ+ +
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMSNFMNIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKK 283          

HSP 2 Score: 53.1434 bits (126), Expect = 1.579e-7
Identity = 43/178 (24.16%), Postives = 72/178 (40.45%), Query Frame = 3
Query:  201 SGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIA-IIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQI 731
            SG+L++ +  P DV+K RMQ  G    Q S  S+F  IY     EG   ++ G+     R A      L +Y    +         +  +  FI+    GL G+    P ++   RM    +  +     Y+     +     ++GF  L+K   P   R    N I   ++ Q+K++
Sbjct:  113 SGVLSSSLANPTDVLKIRMQAQGSL-LQGSMMSNFMNIYQ---TEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRV--LAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTFEQLKKL 284          
BLAST of slc25a-21 vs. Ensembl Zebrafish
Match: slc25a14 (solute carrier family 25 member 14 [Source:ZFIN;Acc:ZDB-GENE-040426-749])

HSP 1 Score: 175.252 bits (443), Expect = 9.511e-52
Identity = 91/277 (32.85%), Postives = 155/277 (55.96%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD-GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIM 995
            ++  F  GG + I+      P+D+ KTR+Q+ GQ    +  Y+  F A+  I   EG+ A+YSG+S AL RQA+Y T ++G Y TL + + S      + I +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  + D +L HF++S   GL  A+ S PVD+++TR+ N R++ G P Y    +   + ++NEG  +L+KGF P +L++G   +I+
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQTHCMEVRYRGMFHALLRIGREEGVRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSHPEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMSNFMNIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGDTVLTHFISSFTCGLAGALASNPVDVVRTRMMNQRVLAGNPLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIV 274          
BLAST of slc25a-21 vs. Ensembl Zebrafish
Match: ucp1 (uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010503-1])

HSP 1 Score: 172.17 bits (435), Expect = 1.972e-50
Identity = 96/304 (31.58%), Postives = 158/304 (51.97%), Query Frame = 3
Query:  144 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD---GYQKS--YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIR----MTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            ++   +P P  +K    G++  +  L+  PLD  K R+QI G+    G  K   YK  F  I  +   EG  ++Y+GL A L RQ  + + R+G+Y  +   Y+    +PN+A+++      G +   +  P ++  +R    M   G+      R Y     A   I + +G  GLWK  LP + R  +VN  +L SY  IK+ +++ + LSD +  HF+++  +G  T V++ PVD++KT     R +N  P +YSS  N  + +   EG  + +KGF+P FL++GS  V+MF+ FEQ+  A
Sbjct:    4 LKPSDVPPPLTVKVLSAGTAACIADLVTFPLDTAKVRLQIQGEKAVTGAAKGIRYKGVFGTISTMMRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSFYTRGKDNPNVAVRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNLQGV-----GRRYNGTMQAYRQIFQLEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHRLLSDNLPCHFVSAFGAGFITTVIASPVDVVKT-----RYMNSPPGQYSSSTNCAWTMLTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLKRA 297          
BLAST of slc25a-21 vs. Ensembl Xenopus
Match: slc25a11 (solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 [Source:NCBI gene;Acc:595075])

HSP 1 Score: 322.783 bits (826), Expect = 7.442e-108
Identity = 155/289 (53.63%), Postives = 203/289 (70.24%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKN-HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYR 1031
            P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    K YK+SF A+  I  NEG+  IY+GLSA L RQATYTT RLGIYT L+E+++  +   PN  +K  I + AG  G+FVGTPAE+ALIRMTADG  P++Q+R Y NVF+A+  +  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L++T    D IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++ Y+
Sbjct:   95 PKAVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRNEGLRGIYTGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSKQFLLDTGYFGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYK 383          
BLAST of slc25a-21 vs. Ensembl Xenopus
Match: slc25a11 (solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 [Source:NCBI gene;Acc:595075])

HSP 1 Score: 311.227 bits (796), Expect = 2.521e-104
Identity = 149/273 (54.58%), Postives = 194/273 (71.06%), Query Frame = 3
Query:  216 TLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYR 1031
            T+ +QPLD+VK RMQ+SG+    K YK+SF A+  I  NEG+  IY+GLSA L RQATYTT RLGIYT L+E+++  +   PN  +K  I + AG  G+FVGTPAE+ALIRMTADG  P++Q+R Y NVF+A+  +  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L++T    D IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++ Y+
Sbjct:   37 TVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRNEGLRGIYTGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSKQFLLDTGYFGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYK 309          
BLAST of slc25a-21 vs. Ensembl Xenopus
Match: slc25a11 (solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 [Source:NCBI gene;Acc:595075])

HSP 1 Score: 275.404 bits (703), Expect = 1.045e-90
Identity = 139/289 (48.10%), Postives = 184/289 (63.67%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHP-NLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYR 1031
            P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    K YK+SF A+  I  NEG+  IY+GLSA L RQATYTT RLGIYT L+E+++  +  P N  +K  I + AG  G+FVGTPAE+ALIRMTADG  P++Q+R Y NVF+A+  +  ++G   LW+  L     G          Y              D IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++ Y+
Sbjct:   11 PKAVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTKEYKTSFHAVGSILRNEGLRGIYTGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRVTLA----GRAGTACDTQWY------------FGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYK 283          
BLAST of slc25a-21 vs. Ensembl Xenopus
Match: slc25a11 (solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11 [Source:NCBI gene;Acc:595075])

HSP 1 Score: 261.922 bits (668), Expect = 5.051e-86
Identity = 125/227 (55.07%), Postives = 162/227 (71.37%), Query Frame = 3
Query:  354 SGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYR 1031
            +GLSA L RQATYTT RLGIYT L+E+++  +   PN  +K  I + AG  G+FVGTPAE+ALIRMTADG  P++Q+R Y NVF+A+  +  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L++T    D IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++ Y+
Sbjct:   18 AGLSAGLLRQATYTTTRLGIYTILFEKFTKADGTPPNFLMKAAIGMTAGATGAFVGTPAEVALIRMTADGRMPVDQRRGYTNVFNALVRMSREEGITTLWRGCVPTMARAVVVNAAQLASYSQSKQFLLDTGYFGDDILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKYYK 244          
BLAST of slc25a-21 vs. Ensembl Xenopus
Match: ucp2 (uncoupling protein 2 (mitochondrial, proton carrier) [Source:NCBI gene;Acc:394786])

HSP 1 Score: 174.096 bits (440), Expect = 4.280e-51
Identity = 90/293 (30.72%), Postives = 150/293 (51.19%), Query Frame = 3
Query:  159 IPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGY----QKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            IP    +KF   G++  +  L   PLD  K R+QI G++         YK  F  I  +   EG  ++Y+GL A L RQ ++ + R+G+Y ++ + Y+  + H  +  +L      G +   V  P ++  +R  A         R Y+   HA   I  ++G  GLWK   P + R  +VN  +L +Y  IK  L++   ++D +  HF ++  +G  T V++ PVD++KTR  N    +   +Y+S  N    +F+ EG  + +KGF+P FL++GS  V+MF+ +EQ+  A
Sbjct:    9 IPPTAAVKFVGAGTAACIADLFTFPLDTAKVRLQIQGENKVVNVKAAQYKGVFGTISTMVKTEGPKSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHVGIGSRLAAGCTTGAMAVAVAQPTDVVKVRFQAQA--NSSANRRYKGTMHAYRTIAREEGMRGLWKGTAPNITRNAIVNCTELVTYDIIKDSLLKANIMTDNLPCHFTSAFGAGFCTTVIASPVDVVKTRYMN----SAKGQYASAINCAITMFRKEGPKAFYKGFMPSFLRLGSWNVVMFVTYEQLKRA 295          
BLAST of slc25a-21 vs. Ensembl Mouse
Match: Slc25a11 (solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 [Source:MGI Symbol;Acc:MGI:1915113])

HSP 1 Score: 329.717 bits (844), Expect = 8.382e-112
Identity = 158/301 (52.49%), Postives = 208/301 (69.10%), Query Frame = 3
Query:  138 GKMQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            G+M  +    P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI+KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   10 GRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. Ensembl Mouse
Match: Slc25a11 (solute carrier family 25 (mitochondrial carrier oxoglutarate carrier), member 11 [Source:MGI Symbol;Acc:MGI:1915113])

HSP 1 Score: 211.46 bits (537), Expect = 3.793e-67
Identity = 102/190 (53.68%), Postives = 131/190 (68.95%), Query Frame = 3
Query:  216 TLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLA 782
            T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF A
Sbjct:    4 TVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCA 193          

HSP 2 Score: 58.151 bits (139), Expect = 1.472e-9
Identity = 34/133 (25.56%), Postives = 59/133 (44.36%), Query Frame = 3
Query:  576 QKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPE-----YSSCWNVFYRIFKNEGVHSLWKGFLP 959
            + R Y+  FHA+  I++ +G  G++  +   + R       +L  Y+ + + L        G LL  L  M +G   A +  P ++   R   M     +P      Y + +N   RI + EGV +LW+G +P
Sbjct:   25 KTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIR---MTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIP 154          
BLAST of slc25a-21 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 172.94 bits (437), Expect = 5.805e-51
Identity = 96/290 (33.10%), Postives = 162/290 (55.86%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD----GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIING-IPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ       +  Y+  F A++ I   EGILA+YSG++ AL RQA+Y T ++GIY +L   +  +     L I +   +++G++ S +  P ++  IRM A G +F      ++ +++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  L D IL HF++S   GL  A+ S PVD+++TR+ N R I G +  Y    +   +++K+EG  +L+KGF P +L++G   +I FI +EQ+  
Sbjct:    5 NWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIY-------QQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 287          

HSP 2 Score: 53.5286 bits (127), Expect = 1.549e-7
Identity = 47/188 (25.00%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFI-AIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILI 737
            I    G  SG++++ I  P DV+K RMQ  G   +Q S   SF  IY     EG   ++ G+     R A      L +Y    +         +  +  F+ +   GL G+    P ++   RM       +     Y+     I  + + +GF  L+K   P   R    N I   +Y Q+K++ I
Sbjct:  108 INMICGVVSGVISSTIANPTDVLKIRMQAQGSL-FQGSMIGSFIDIYQ---QEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAI-VGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 290          
BLAST of slc25a-21 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 172.94 bits (437), Expect = 1.267e-50
Identity = 96/290 (33.10%), Postives = 162/290 (55.86%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD----GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIING-IPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ       +  Y+  F A++ I   EGILA+YSG++ AL RQA+Y T ++GIY +L   +  +     L I +   +++G++ S +  P ++  IRM A G +F      ++ +++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  L D IL HF++S   GL  A+ S PVD+++TR+ N R I G +  Y    +   +++K+EG  +L+KGF P +L++G   +I FI +EQ+  
Sbjct:   37 NWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIY-------QQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 319          

HSP 2 Score: 53.1434 bits (126), Expect = 1.928e-7
Identity = 47/188 (25.00%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFI-AIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILI 737
            I    G  SG++++ I  P DV+K RMQ  G   +Q S   SF  IY     EG   ++ G+     R A      L +Y    +         +  +  F+ +   GL G+    P ++   RM       +     Y+     I  + + +GF  L+K   P   R    N I   +Y Q+K++ I
Sbjct:  140 INMICGVVSGVISSTIANPTDVLKIRMQAQGSL-FQGSMIGSFIDIYQ---QEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAI-VGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 322          
BLAST of slc25a-21 vs. Ensembl Mouse
Match: Slc25a14 (solute carrier family 25 (mitochondrial carrier, brain), member 14 [Source:MGI Symbol;Acc:MGI:1330823])

HSP 1 Score: 172.94 bits (437), Expect = 1.460e-50
Identity = 96/290 (33.10%), Postives = 162/290 (55.86%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQD----GYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIING-IPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ       +  Y+  F A++ I   EGILA+YSG++ AL RQA+Y T ++GIY +L   +  +     L I +   +++G++ S +  P ++  IRM A G +F      ++ +++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI +  L D IL HF++S   GL  A+ S PVD+++TR+ N R I G +  Y    +   +++K+EG  +L+KGF P +L++G   +I FI +EQ+  
Sbjct:   40 NWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIGSFIDIY-------QQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 322          

HSP 2 Score: 53.1434 bits (126), Expect = 2.214e-7
Identity = 47/188 (25.00%), Postives = 75/188 (39.89%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFI-AIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILI 737
            I    G  SG++++ I  P DV+K RMQ  G   +Q S   SF  IY     EG   ++ G+     R A      L +Y    +         +  +  F+ +   GL G+    P ++   RM       +     Y+     I  + + +GF  L+K   P   R    N I   +Y Q+K++ I
Sbjct:  143 INMICGVVSGVISSTIANPTDVLKIRMQAQGSL-FQGSMIGSFIDIYQ---QEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAI-VGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKRLQI 325          
BLAST of slc25a-21 vs. UniProt/SwissProt
Match: sp|P90992|M2OM_CAEEL (Mitochondrial 2-oxoglutarate/malate carrier protein OS=Caenorhabditis elegans OX=6239 GN=misc-1 PE=1 SV=2)

HSP 1 Score: 338.576 bits (867), Expect = 1.751e-114
Identity = 155/288 (53.82%), Postives = 213/288 (73.96%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            +P+ +KFA GG++G+  TL++QPLD+VK RMQ+SG  G +K Y+SS  A+  I  NEG+ A+Y+GLSA L RQATYTT RLG Y  L ER++ K+   +  +K  + + AG +GSFVGTPAEIALIRMT DG  P+EQ+RNY  V +A+  I +++G L LW+   PT+ R +VVN  QLA+YSQ KQ L+ +  + DGI  HFLASMISGL T + SMPVDI KTRIQ+M++I+G PEY + ++V+ ++ KNEG+ +LWKGF PY++++G +TV+ FII EQM+ AY
Sbjct:    7 VPNVVKFAFGGTAGMGATLVVQPLDLVKNRMQLSGTTG-KKEYRSSMHALTSIMKNEGVFAVYNGLSAGLLRQATYTTTRLGTYAFLLERFTEKDKPLSFGMKAVLGMTAGGIGSFVGTPAEIALIRMTGDGRLPVEQRRNYTGVVNALTRITKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKQALLASGKVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNAFDVWGKVIKNEGIFALWKGFTPYYMRLGPHTVLTFIILEQMNAAY 293          
BLAST of slc25a-21 vs. UniProt/SwissProt
Match: sp|Q9CR62|M2OM_MOUSE (Mitochondrial 2-oxoglutarate/malate carrier protein OS=Mus musculus OX=10090 GN=Slc25a11 PE=1 SV=3)

HSP 1 Score: 329.717 bits (844), Expect = 5.863e-111
Identity = 158/301 (52.49%), Postives = 208/301 (69.10%), Query Frame = 3
Query:  138 GKMQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            G+M  +    P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI+KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   10 GRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKTEGLKGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALVRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. UniProt/SwissProt
Match: sp|P22292|M2OM_BOVIN (Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus OX=9913 GN=SLC25A11 PE=1 SV=3)

HSP 1 Score: 328.946 bits (842), Expect = 1.356e-110
Identity = 156/291 (53.61%), Postives = 207/291 (71.13%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P++Q+R Y+NVF+A+  I++++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI+KTRIQNMR+I+G PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   20 PKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. UniProt/SwissProt
Match: sp|Q02978|M2OM_HUMAN (Mitochondrial 2-oxoglutarate/malate carrier protein OS=Homo sapiens OX=9606 GN=SLC25A11 PE=1 SV=3)

HSP 1 Score: 327.791 bits (839), Expect = 4.120e-110
Identity = 157/291 (53.95%), Postives = 205/291 (70.45%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            P  +KF  GG +G+  T+ +QPLD+VK RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVGTPAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G L LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V +++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   20 PKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. UniProt/SwissProt
Match: sp|P97700|M2OM_RAT (Mitochondrial 2-oxoglutarate/malate carrier protein OS=Rattus norvegicus OX=10116 GN=Slc25a11 PE=1 SV=3)

HSP 1 Score: 318.161 bits (814), Expect = 2.395e-106
Identity = 154/301 (51.16%), Postives = 204/301 (67.77%), Query Frame = 3
Query:  138 GKMQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRIL 1037
            G+M  +    P  +KF  GG +G+  T+ +QPLD+V  RMQ+SG+    + YK+SF A+  I   EG+  IY+GLSA L RQATYTT RLGIYT L+ER +  +   P   +K  I + AG  G+FVG PAE+ALIRMTADG  P +Q+R Y+NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L+++   SD IL HF A MISGL T   SMPVDI+KTRIQNMR+I+  PEY +  +V  ++ + EG  SLWKGF PY+ ++G +TV+ FI  EQM++AY+ L
Sbjct:   10 GRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLLKALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLWRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVDIVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNKAYKRL 310          
BLAST of slc25a-21 vs. TrEMBL
Match: A0A0H3YJC8 (Slc25a-21 OS=Schmidtea mediterranea OX=79327 GN=slc25a-21 PE=2 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 3
Query:  144 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQHY 1052
            MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQHY
Sbjct:    1 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQHY 303          
BLAST of slc25a-21 vs. TrEMBL
Match: A0A0H3YJ72 (Slc25a-18 OS=Schmidtea mediterranea OX=79327 GN=slc25a-18 PE=2 SV=1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.434e-137
Identity = 184/301 (61.13%), Postives = 236/301 (78.41%), Query Frame = 3
Query:  144 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQ 1046
            M  Q+I IP+Y+KFA GGS+G++ TL +QPLD+VK RMQ+SGQDG +K+YKSSFDAI  IT NEG+ AIYSGLSA L RQATYTT RLG+YT L+E++SSK+  P+   K  I + AGL+GSFVGTP E+ALIRMT+DG  P++++RNYRNVFHA+  I+ ++G L LW+  LPTM R  VVN  QLASYSQ KQ+++ET+  +DGI +HF ASMISG  T V SMPVDI+KTRIQNM ++NG+ EYS   N F RI K+EGV SLWKGF PYFL++G +TVI F++ EQM+ AY+ + ++
Sbjct:    1 MSSQNISIPNYVKFAFGGSAGMIATLFVQPLDLVKNRMQMSGQDGSKKAYKSSFDAIKQITKNEGLFAIYSGLSAGLLRQATYTTTRLGVYTALFEKFSSKDKPPSFVTKAGIGMSAGLIGSFVGTPTEVALIRMTSDGRLPMDKRRNYRNVFHALARIVREEGVLALWRGCLPTMGRAAVVNLAQLASYSQAKQMILETELFNDGIFVHFGASMISGFITTVASMPVDIVKTRIQNMTVVNGVAEYSGAINAFIRITKHEGVLSLWKGFTPYFLRLGPHTVITFVVLEQMNTAYKNVAHR 301          
BLAST of slc25a-21 vs. TrEMBL
Match: F1LA07 (2-oxoglutarate/malate carrier protein OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 9.816e-115
Identity = 163/297 (54.88%), Postives = 217/297 (73.06%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY--RILVYQH 1049
            IP+ +KF  GGS+G+  T ++QPLD+VK RMQ+SG  G +K Y+SSF A+  I  NEG+LA+Y+GLSA L RQATYTT RLGIYT L+E++++ +  P  A+K  + + AG  GSFVGTPAE+ALIRM ADG  P +Q+RNY+NVF A+  I+ ++G L LW+   PT+ R +VVN  QLA+YSQ K+ +++T  + DGI  HF ASMISGL T + SMPVDI KTRIQNMR ING PEY   ++V+ +I +NEG+ +LWKGF PY+ +IG +TV+ FI  EQM+  Y  R+L  QH
Sbjct:   13 IPNAVKFLFGGSAGMAATCVVQPLDLVKNRMQLSGLTG-KKEYRSSFHALRSIIANEGLLAVYNGLSAGLLRQATYTTTRLGIYTWLFEKFTTGDRSPTFALKATLGLTAGATGSFVGTPAEVALIRMCADGRLPADQQRNYKNVFDALIRIVREEGVLTLWRGCGPTVLRAMVVNAAQLATYSQAKEAILKTSYVQDGIFCHFCASMISGLATTIASMPVDIAKTRIQNMRTINGKPEYKGTFDVWSKIVRNEGILALWKGFTPYYFRIGPHTVLTFIFLEQMNAFYFRRVLGVQH 308          
BLAST of slc25a-21 vs. TrEMBL
Match: A0A0N4UII4 (Uncharacterized protein OS=Dracunculus medinensis OX=318479 GN=DME_LOCUS10055 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 9.890e-115
Identity = 165/294 (56.12%), Postives = 213/294 (72.45%), Query Frame = 3
Query:  147 QWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            Q  S  IP+ IKF  GGS+G+  TL +QPLD+VK RMQ+SG  G +K Y+SSF A+  I  NEG+ A+Y+GLSA L RQATYTT RLG YT L+ER+SS +  P  A+K  I + AG VGSFVGTPAE+ALIRM ADG  P EQ+R Y+NVF AI  + +++G   LW+   PT+ R +VVN  QLA+YSQ K+ L++T  + DGI  HFLASMISGL T + SMPVDI KTRIQNMR+++G PEY + ++V+ R+ KNEG  +LWKGF PY+ ++G +TV+ FI  EQM+  Y
Sbjct:   13 QISSATIPNGIKFLFGGSAGMAATLFVQPLDLVKNRMQLSGTTG-KKEYRSSFHALRSIIANEGVFAVYNGLSAGLLRQATYTTTRLGTYTWLFERFSSHDKAPAFAMKAGIGMTAGAVGSFVGTPAELALIRMCADGRLPPEQQRRYKNVFDAIIRVTKEEGVFTLWRGCGPTVMRAMVVNAAQLATYSQAKEALLKTSYVKDGIFCHFLASMISGLATTIASMPVDIAKTRIQNMRVVDGKPEYRNAFDVWARVVKNEGFFALWKGFTPYYFRLGPHTVLTFIFLEQMNAFY 305          
BLAST of slc25a-21 vs. TrEMBL
Match: A0A2A2LLF1 (Uncharacterized protein OS=Diploscapter pachys OX=2018661 GN=WR25_24217 PE=3 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 1.224e-114
Identity = 158/288 (54.86%), Postives = 215/288 (74.65%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            IP+ +KFA GG +G   TL++QPLD+VK RMQ+SG  G +K Y+SS  A+  I  NEG++ +Y+GLSA L RQATYTT RLGIYT ++E ++     P+ A+K  + + AG +GSFVGTPAE+ALIRMT+DG  P EQ+RNY+NVF A+   ++++G L LW+   PT+ R +VVN  QLA+YSQ K+ ++ TK + DGI  HFLASMISGL T + SMPVDI KTRIQ+M++I+G PEY +  +V+ ++ KNEGV +LWKGF PYFL++G +TV+ FII EQM+ +Y
Sbjct:    6 IPNGVKFAFGGIAGCGATLVVQPLDLVKNRMQLSGTSG-KKEYRSSMHALTSIIKNEGVMGVYNGLSAGLLRQATYTTTRLGIYTWMFEAFTKDGQAPSFAMKAALGMTAGAIGSFVGTPAELALIRMTSDGRLPPEQRRNYKNVFDALARTVKEEGVLTLWRGCTPTVLRAMVVNAAQLATYSQAKEAILATKYVQDGIFCHFLASMISGLATTIASMPVDIAKTRIQSMKVIDGKPEYKNALDVWMKVVKNEGVFALWKGFSPYFLRLGPHTVLTFIILEQMNASY 292          
BLAST of slc25a-21 vs. Ensembl Cavefish
Match: slc25a11 (solute carrier family 25 member 11 [Source:NCBI gene;Acc:111191416])

HSP 1 Score: 327.791 bits (839), Expect = 9.542e-111
Identity = 159/290 (54.83%), Postives = 203/290 (70.00%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKN-HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRI 1034
            P  IKF  GG +G+  T+ +QPLD+VK RMQ+SGQ    + YK+S  A+  I  NEG+  IY+GLSA L RQATYTT RLGIYT L+E+ +  +   PN  +K  I + AG +G+FVGTPAE+ALIRMTADG  P +Q+R Y NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L++T   SD I LHF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ +NEG  SLWKGF PY+ ++G +TV+ FI  EQM+  Y+I
Sbjct:   44 PKSIKFLFGGLAGMGATVFVQPLDLVKNRMQLSGQGSKAREYKTSLHAVASILRNEGVGGIYTGLSAGLLRQATYTTTRLGIYTVLFEKMTKADGTPPNFFMKAVIGMTAGAIGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALIRITREEGIPTLWRGCVPTMARAVVVNAAQLASYSQSKQALMDTGYFSDNIFLHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLLKVVRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNRFYKI 333          
BLAST of slc25a-21 vs. Ensembl Cavefish
Match: slc25a11 (solute carrier family 25 member 11 [Source:NCBI gene;Acc:111191416])

HSP 1 Score: 266.544 bits (680), Expect = 1.541e-87
Identity = 129/228 (56.58%), Postives = 163/228 (71.49%), Query Frame = 3
Query:  354 SGLSAALFRQATYTTARLGIYTTLYERYSSKN-HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRI 1034
            +GLSA L RQATYTT RLGIYT L+E+ +  +   PN  +K  I + AG +G+FVGTPAE+ALIRMTADG  P +Q+R Y NVF+A+  I  ++G   LW+  +PTM R VVVN  QLASYSQ KQ L++T   SD I LHF ASMISGL T   SMPVDI KTRIQNMR+I+G PEY +  +V  ++ +NEG  SLWKGF PY+ ++G +TV+ FI  EQM+  Y+I
Sbjct:   55 AGLSAGLLRQATYTTTRLGIYTVLFEKMTKADGTPPNFFMKAVIGMTAGAIGAFVGTPAEVALIRMTADGRLPPDQRRGYTNVFNALIRITREEGIPTLWRGCVPTMARAVVVNAAQLASYSQSKQALMDTGYFSDNIFLHFCASMISGLVTTAASMPVDIAKTRIQNMRMIDGKPEYKNGLDVLLKVVRNEGFFSLWKGFTPYYARLGPHTVLTFIFLEQMNRFYKI 282          
BLAST of slc25a-21 vs. Ensembl Cavefish
Match: slc25a14 (brain mitochondrial carrier protein 1 [Source:NCBI gene;Acc:103031802])

HSP 1 Score: 182.57 bits (462), Expect = 6.816e-55
Identity = 94/286 (32.87%), Postives = 163/286 (56.99%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQK-SYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ    +  Y+  F A+  I   EGI A+YSG+S AL RQA+Y T ++G Y TL + + S+     + I +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI + ++ D +L HF++S   GL  A+ S PVD+++TR+ N R+++G   Y    +   + ++NEG  +L+KGF P +L++G   +I F+ +EQ+ +
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQSQCMEVRYRGMFHALLRIGREEGIRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSRPEDETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMANFINIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGTMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGNLLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTYEQLKK 283          

HSP 2 Score: 54.299 bits (129), Expect = 6.282e-8
Identity = 44/178 (24.72%), Postives = 73/178 (41.01%), Query Frame = 3
Query:  201 SGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIA-GLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQI 731
            SG+L++ +  P DV+K RMQ  G    Q S  ++F  IY     EG   ++ G+     R A      L +Y    +         +  +  FI+  A GL G+    P ++   RM    +  +     Y+     +     ++GF  L+K   P   R    N I   +Y Q+K++
Sbjct:  113 SGVLSSSLANPTDVLKIRMQAQGSL-LQGSMMANFINIYQ---TEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGTMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRV--LSGNLLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFMTYEQLKKL 284          
BLAST of slc25a-21 vs. Ensembl Cavefish
Match: slc25a14 (brain mitochondrial carrier protein 1 [Source:NCBI gene;Acc:103031802])

HSP 1 Score: 174.096 bits (440), Expect = 2.612e-51
Identity = 91/277 (32.85%), Postives = 157/277 (56.68%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQK-SYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIM 995
            ++  F  GG + I+      P+D+ KTR+Q+ GQ    +  Y+  F A+  I   EGI A+YSG+S AL RQA+Y T ++G Y TL + + S+     + I +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ LI + ++ D +L HF++S   GL  A+ S PVD+++TR+ N R+++G   Y    +   + ++NEG  +L+KGF P +L++G   +I+
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQSQCMEVRYRGMFHALLRIGREEGIRALYSGISPALLRQASYGTIKIGTYNTLKKLFVSRPEDETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMANFINIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGTMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGNLLYKGTLDGLMQTWRNEGFFALYKGFWPNWLRLGPWNIIV 274          
BLAST of slc25a-21 vs. Ensembl Cavefish
Match: ucp1 (uncoupling protein 1 [Source:NCBI gene;Acc:103037750])

HSP 1 Score: 170.629 bits (431), Expect = 4.863e-50
Identity = 93/297 (31.31%), Postives = 152/297 (51.18%), Query Frame = 3
Query:  162 PIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKS----YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIR----MTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            P P  +K    G++  +  L+  PLD  K R+QI G+   + +    Y+  F  I  +   EG  ++Y+GL A L RQ  + + R+G+Y  +   Y+    +PN+ I++      G +   +  P ++  +R    M   G+      R Y     A   I   +G  GLWK  LP + R  +VN  +L SY  IK+ +++ K LSD +  HF+++  +G  T V++ PVD++KT     R +N  P +Y S  N  + +   EG  + +KGF+P FL++GS  V+MF+ FEQ+  A
Sbjct:   10 PPPLGVKVLSAGTAACIADLVTFPLDTAKVRLQIQGEKAVEAAKGIRYRGVFGTISTMVRTEGPRSLYNGLVAGLQRQMAFASIRIGLYDNVKSFYTRGKDNPNVGIRILAGCTTGAMAVSMAQPTDVVKVRFQAQMNLQGV-----ARRYNGTMQAYRQIFHQEGLRGLWKGTLPNITRNALVNCTELVSYDLIKEAILKHKLLSDNLPCHFVSAFGAGFITTVIASPVDVVKT-----RYMNSPPGQYKSAINCAWTMMTKEGPTAFYKGFVPSFLRLGSWNVVMFVSFEQLKRA 296          
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:555812])

HSP 1 Score: 168.318 bits (425), Expect = 8.323e-50
Identity = 88/298 (29.53%), Postives = 153/298 (51.34%), Query Frame = 3
Query:  156 SIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ----DGYQKS----YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
             +P    +KF   G++  +  LI  PLD  K R+Q+ G+    +G  +S    Y+  F  I  +   EG  ++YSGL A L RQ ++ + R+G+Y ++   Y++   H  +  +L      G +      P ++  +R  A  +  +   + Y    +A   I  ++G  GLWK   P + R  +VN  +L +Y  IK  +++ K L+D +  HF+++  +G  T V++ PVD++KTR  N    +   +Y S +N  Y +   EG  + +KGF+P FL++GS  V+MF+ +EQ+   
Sbjct:    8 DVPPTAAVKFIGAGTAACIADLITFPLDTAKVRLQVQGECQRGEGAARSAGVQYRGVFGTIAAMVRTEGPRSLYSGLVAGLQRQMSFASVRIGLYDSVKNFYTNGAEHAGIGCRLLAGCTTGAMAVTFAQPTDVVKVRFQAQ-VNMLGTSKRYSGTMNAYKTIAREEGVRGLWKGTGPNITRNAIVNCAELVTYDIIKDTILKYKLLTDNLPCHFVSAFGAGFCTTVVASPVDVVKTRYMN----SAPGQYRSAFNCAYLMLTKEGAMAFYKGFVPSFLRLGSWNVVMFVTYEQLKRG 300          
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 6.401e-21
Identity = 76/249 (30.52%), Postives = 111/249 (44.58%), Query Frame = 3
Query:  225 IQPLDVVKTRMQISGQDGY---QKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLV--GSFV--GTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKG 950
            + P+D+VKTRMQ     G    +  YK+SFD    +   EG+  +Y GL   L   A     +L +   + ++++ ++     +I L   IIAG    GS V    P EI  IR+   G      + +  NV       + D GFLGL+K       R +  + I    Y+  K    + K    G L    A  I+G+  A L  P D+IKTR+Q +    G   YS   + F +I   EG  +LWKG
Sbjct:    7 VYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDK----SIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNV-------LRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKG-HVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQ-VAARAGQTTYSGVIDCFRKILSEEGPRALWKG 242          

HSP 2 Score: 51.9878 bits (123), Expect = 7.957e-8
Identity = 40/181 (22.10%), Postives = 75/181 (41.44%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQ 728
            GG +G    +   PL++VK R+Q++G+   G + S         ++  + G L +Y G  A   R   ++     +Y      ++ +  H      L    IAG+  + + TPA++   R+    +     +  Y  V      I+ ++G   LWK     +CR      + L +Y  ++Q
Sbjct:   96 GGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVS-------ALNVLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLLTAGAIAGMPAASLVTPADVIKTRLQ---VAARAGQTTYSGVIDCFRKILSEEGPRALWKGAGARVCRSSPQFGVTLLTYELLQQ 266          
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Match: SLC25A40 (solute carrier family 25 member 40 [Source:HGNC Symbol;Acc:HGNC:29680])

HSP 1 Score: 89.3521 bits (220), Expect = 1.960e-20
Identity = 73/309 (23.62%), Postives = 125/309 (40.45%), Query Frame = 3
Query:  225 IQPLDVVKTRMQISG----------------------QDGYQKSY--------KSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDG-ILLHFLASMISGLNTAVLSMPVDIIKTRIQ----NMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQ 1046
            + PLDVVK R+Q                          +G  K++          + DA   I  +EG+ +++SGL   L      T      Y  L +  +   +  + +I      +A L    V +P E+   +M +       ++  Y+ +   +   +  DG+  LW+   PT+ R V  + +   +Y  IK  L+ +  ++    L+HF +  +SG    + ++P D++KTR Q     M I  G     S W    RI+   G+  L+ GFLP  +K+     IM   +E     +R L  Q
Sbjct:    1 VTPLDVVKIRLQAQQTPFYKGKCFVYCNGLMDHLCVCMNGNSKAWYKPAPGYVNGTLDAFVQIVRHEGVASLWSGLQPTLVMAVPATVIYFTSYDLLRDSLARHFNSQHPSIPFVAGAVARLGAVTVISPLELIRTKMQS-------RQLTYKELSECVRHSLAQDGWRSLWRGWGPTVFRDVPFSGLYWLNYELIKHGLMGSAGVNQATFLIHFTSGAVSGTFAGIATLPFDVVKTRRQIELGEMEITKGAFRDISTWAAMKRIYWESGLRGLFAGFLPRVIKVAPACAIMISTYEFGKSFFRKLNQQ 302          
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Match: slc25a38b (solute carrier family 25 member 38b [Source:NCBI gene;Acc:571961])

HSP 1 Score: 83.9593 bits (206), Expect = 1.105e-18
Identity = 69/280 (24.64%), Postives = 128/280 (45.71%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSF-DAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIY-TTLYERYSS--KNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            G  SG  +TL++QPLD+VKTR+Q+    G  +S +      + H+   E +  ++ GL  +L R        +GIY  TL+    S  ++  P+    L + + A  + +    P  +   R  + G F       YR+V  A+  I + +G   L+  +  T+ R    + I +  Y+Q K +L+            F   +++G+  ++++ P D IKT +Q        P  +S     F  I +++G+  L+ G +P  L+    T + + ++E+M
Sbjct:   12 GALSGSCSTLLLQPLDLVKTRVQLLRAAGTPRSPRVRMVSVLTHVVRTESVRGLWKGLGPSLVR----CVPGVGIYFCTLHSLRESFFRDRAPSALDSLLLGLSARTISAVCMLPVTVVKTRYES-GRF------KYRSVLGALSSIRKTEGIRALFSGLTATLARDAPFSGIYVMIYTQAKHMLLHGVEREGQAPTRFACGVLAGVVASLVTQPADTIKTYMQME------PHRFSHTGQTFVAICRSQGLTGLFHGAVPRCLRRTLVTAMAWTVYERM 274          
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Match: slc25a1b (slc25a1 solute carrier family 25 member 1b [Source:NCBI gene;Acc:795332])

HSP 1 Score: 82.4185 bits (202), Expect = 3.877e-18
Identity = 67/284 (23.59%), Postives = 125/284 (44.01%), Query Frame = 3
Query:  186 AIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGS-FVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCR---GVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            A GG +G +   I  P + VKT++Q+  +      YK   D +     + GI  +Y GLS+ ++     +  R G++  L           N    L   + AG+  +  V  P E   ++   D      Q   YR  FH +  I+   G  G ++ +  T+ +      + F  + S     +     K ++   ++       +G  +   + P+D+IKTR+Q ++      +Y S ++  Y+IFK EG  + +KG +P   ++  +  I+FII+E++ +A
Sbjct:    2 AAGGIAGGIEICITFPTEYVKTQLQLD-EKANPPRYKGIGDCVSQTVRDHGIKGLYRGLSSLVYGSIPKSAVRFGMFEFLSNHMRDDQGKLNSTRGLLCGLGAGVAEAVLVVCPMETIKVKFIHDQCSSNPQ---YRGFFHGVREIVRQQGIKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYKGDNPNKEINP--IVTGAFGATAGAASVFGNTPLDVIKTRMQGLQA----HKYRSTYDCAYQIFKYEGPRAFFKGTVPRLGRVCLDVAIVFIIYEEVVKA 275          
BLAST of slc25a-21 vs. Ensembl Yeast
Match: DIC1 (Mitochondrial dicarboxylate carrier; integral membrane protein, catalyzes a dicarboxylate-phosphate exchange across the inner mitochondrial membrane, transports cytoplasmic dicarboxylates into the mitochondrial matrix [Source:SGD;Acc:S000004340])

HSP 1 Score: 148.673 bits (374), Expect = 1.251e-42
Identity = 86/282 (30.50%), Postives = 141/282 (50.00%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGL----WKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSL-SDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            GG++GI  T++  PLD+ K R+Q +          + F  +  I  NEG++ +YSGLSAA+ RQ TYTT R G Y  L E    +    N+A  L  ++ +G +G   G  A++  IRM  D      ++RNY+N    +  I   +G L      WK   P M RG+++   Q+ +Y   K  L+      +     H  AS+++GL    +  P D++KT     RI+NG  ++     +     + EG   +++G+LP F ++G  T+++F   EQ+ +
Sbjct:   20 GGAAGIFATMVTHPLDLAKVRLQAAPM-----PKPTLFRMLESILANEGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWK---PNMVRGILMTASQVVTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKT-----RIMNGSGDHQPALKILADAVRKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQLKK 288          
BLAST of slc25a-21 vs. Ensembl Yeast
Match: OAC1 (Mitochondrial inner membrane transporter; transports oxaloacetate, sulfate, thiosulfate, and isopropylmalate; member of the mitochondrial carrier family [Source:SGD;Acc:S000001603])

HSP 1 Score: 119.398 bits (298), Expect = 2.159e-31
Identity = 80/293 (27.30%), Postives = 141/293 (48.12%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSS---KNHHP----NLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIF-PIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQ 1013
            I  +  F  GG +  +   +  P++++K RMQ+ G+      K YK+    +  I  NEGI  +  GL+AA   Q     +RLG Y  +    +     +  P    ++ + +F    +G++G+ +G+P  +   R+ +   F  I ++ +Y  V++ +  I + +G  GL++ +   + R    + +QL  Y+  K IL++   + DG  LH  AS ISGL  AV+  P D+I TRI N +       Y    +   +  + EGV +L+KGF     +I  +T++     EQ
Sbjct:   20 ISKFGSFVAGGLAACIAVTVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQK----GDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQ 308          
BLAST of slc25a-21 vs. Ensembl Yeast
Match: ODC2 (Mitochondrial inner membrane transporter; 2-oxodicarboxylate transporter, exports 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol for use in lysine and glutamate biosynthesis and in lysine catabolism; ODC2 has a paralog, ODC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005748])

HSP 1 Score: 108.227 bits (269), Expect = 2.162e-27
Identity = 77/307 (25.08%), Postives = 138/307 (44.95%), Query Frame = 3
Query:  162 PIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQI------SGQDGYQ-KSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGI---YTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIIN-GIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQH 1049
            P+P   +F  G  +GI    ++ PLDVVKTR Q+      +   G Q + Y    D +  I   EG   +Y G+S+ +  +A     +      Y  +++   + N      I +     AG+  + V  P E+  IRM        + K +Y      +   I+++G +GL+K +  TM R  + N        Q++  +   K+         +A  I G    +L+ P D++K+RIQ++  ++  + +Y+ C      I++ EG  +L+KGF+P   ++     +M ++F  M   +R L Y H
Sbjct:    9 PLPFIYQFISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQ-KISIAAGASAGMTEAAVIVPFELIKIRMQ-------DVKSSYLGPMDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVFTGMMNFFRDLKYGH 307          
BLAST of slc25a-21 vs. Ensembl Yeast
Match: CTP1 (Mitochondrial inner membrane citrate transporter; member of the mitochondrial carrier family [Source:SGD;Acc:S000000495])

HSP 1 Score: 100.523 bits (249), Expect = 9.263e-25
Identity = 82/287 (28.57%), Postives = 128/287 (44.60%), Query Frame = 3
Query:  183 FAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAII-AGLVGSFVG-TPAEIALIRMTADGIFPIEQ-KRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIE------TKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            F  G  +G     I  P +  KTR+Q+   D   K+ ++    IY     +GI +IY G  A +         R   + T+ +             +  IA + AGL+ S    TP E     +  D      +   N R V      ++ D GF GL++ VLP   R      ++L  Y++IK ++ +       K LS G  L FL    SG+ T   +MP+D +KTR+Q++       +YSS  N F  IFK EG+ + WKG  P   ++  +  I+F I+E++
Sbjct:   16 FLAGSLAGAAEACITYPFEFAKTRLQL--IDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGFDTIKDMLRDSETGELSGTRGVIAGLGAGLLESVAAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYTDSPKDKPLSSG--LTFLVGAFSGIVTVYSTMPLDTVKTRMQSLDST----KYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKV 294          
BLAST of slc25a-21 vs. Ensembl Yeast
Match: ODC1 (Mitochondrial inner membrane transporter; 2-oxodicarboxylate transporter, exports 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol for lysine and glutamate biosynthesis and lysine catabolism; suppresses, in multicopy, an fmc1 null mutation; ODC1 has a paralog, ODC2, that arose from the whole genome duplication [Source:SGD;Acc:S000006055])

HSP 1 Score: 95.1301 bits (235), Expect = 1.212e-22
Identity = 71/308 (23.05%), Postives = 137/308 (44.48%), Query Frame = 3
Query:  162 PIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQIS-GQDGYQ---------KSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLG---IYTTLYER-YSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVY 1043
            P+P   +F  G  +G+   L++ PLDVVKTRMQ+     G+            Y    D +  I   EG   +Y G+++ +  +A     +      + T Y++ + + N      I ++    AG V +FV  P E+  IR+        +    ++     +   +   G L L+  +  T+ R V+ N        QI+++L   K+ ++      +A  I G    +L+ P D++K+RIQ  R    + +Y+        +++ EG  +L+KGF P  +++     ++ ++F  + + +R + Y
Sbjct:    8 PLPFIYQFTAGAIAGVSELLVMYPLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILMEAPKRAIKFSGNDTFQTFYKKIFPTPNGEMTQKIAIYSGASAGAVEAFVVAPFELVKIRLQ-------DVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIFQIRKLLPAAKTSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQ--RSSGPLRKYNWSLPSVLLVYREEGFKALYKGFAPKVMRLAPGGGLLLVVFTNVMDFFREVKY 306          
BLAST of slc25a-21 vs. Ensembl Nematostella
Match: EDO47873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL59])

HSP 1 Score: 320.472 bits (820), Expect = 9.814e-109
Identity = 155/288 (53.82%), Postives = 201/288 (69.79%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKN-HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            IP+Y +F +GG SG+  T  +QPLD+VK RMQ+SG  G  K Y+SS   +  I  +EG L +Y+GLSA L RQATYTT RLG+YT L + + + +   P    K  + + AG +GSFVGTPAEI+LIRMT+DG  P EQ+R Y NVF+A+  + +++G L LW+  +PT  R +VVN  QLA+YSQ KQ+L+ TK   D I+ HF ASMISGL T V SMPVDI KTRIQNMRII+G PEY    +V  RI +NEGV +LWKGF PY+ +IG +TV+ FI  EQ++ A
Sbjct:    8 IPNYARFVMGGLSGMGATFFVQPLDLVKNRMQMSGIGGATKEYRSSVHVVMSILRSEGFLGVYNGLSAGLLRQATYTTTRLGVYTNLLQHFKNPDGSAPGFFKKCALGMTAGAIGSFVGTPAEISLIRMTSDGRLPPEQRRGYTNVFNALYRMSKEEGVLTLWRGYIPTAVRAMVVNAAQLATYSQAKQLLLSTKYFEDNIVCHFGASMISGLATTVASMPVDIAKTRIQNMRIIDGKPEYKGTMDVLVRIVRNEGVFALWKGFTPYYFRIGPHTVLTFIFLEQLNRA 295          
BLAST of slc25a-21 vs. Ensembl Nematostella
Match: EDO34326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL4])

HSP 1 Score: 161.384 bits (407), Expect = 7.077e-47
Identity = 86/292 (29.45%), Postives = 158/292 (54.11%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYH----------ITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNH-HPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTR-IQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            +F +GG S +  T +  P++VVK RMQ+  + G + + K  F   Y+          +   EG+  +Y G+  AL RQA Y++ RLG Y  +     + +     L  K+   + +G++GS + TP ++  IR  A     I +   Y+N+FHA   I + +GFLGLW  + PT+ R   ++  Q+ +Y   K +L+  + + +G+ LH  +++++G     ++ PVDI++TR +   +   G P  Y    +  Y+  ++EG+ +L+KGF P + + G +T+I+F ++E++
Sbjct:   11 RFVLGGLSCMTATTVTNPIEVVKIRMQLDNELGSKHNSKDIFRERYYKGLIRTGLSRVYREEGVRGLYRGIFPALLRQAIYSSTRLGAYEPIKNLLGATDSTSAALWKKIVAGVSSGVIGSAIATPTDLVKIRFQA---VKIGETIPYKNMFHAFYKIAKKEGFLGLWTGMKPTVKRAACISGTQIPTYDHTKHLLLNAELMREGVALHLASALVAGFVATCVASPVDIVRTRFMTQPKDTKGRPLVYQGTLDCIYKTVRHEGILALYKGFFPNWTRTGLDTIIIFFVYERL 299          
BLAST of slc25a-21 vs. Ensembl Nematostella
Match: EDO39987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H5])

HSP 1 Score: 157.532 bits (397), Expect = 1.963e-45
Identity = 97/290 (33.45%), Postives = 154/290 (53.10%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ--DGYQKS--YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPE-----YSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQ 1013
            DY  F  GG + +   L   P+D  KTR+Q+ GQ  D  QK+  Y+  F A + IT  EGI A+++G+S AL RQATY + +LGIY +L            L +  F  ++AG +GS V  P ++  IRM A+  +      +  ++  A G +   +G  GL++ V PT  R  V+  ++L  Y   K+ +++ K + D    HF+AS I+GL  A+ S P+D+ KTR+ N R +    E     Y S  +     F+ EG  +L++GF+P F ++    ++ F+ +EQ
Sbjct:    2 DYKPFLYGGLASMTAELCTFPIDTTKTRLQLQGQVTDTKQKAIRYRGMFHAFFRITKEEGIRALFNGVSPALLRQATYGSLKLGIYHSLKRILVKDPKDETLFVNGFCGVVAGALGSAVCNPTDVLKIRMQAE--YRAGAGSSKTSMLVAFGDMYRQEGIRGLYRGVGPTSQRAAVIAGVELPVYDSAKRFILDKKLMGDHPGTHFVASAIAGLAGAIASNPIDVAKTRMMNQRNLKVKTEGGPVLYRSASHCLVVTFRTEGFFALYRGFIPNFARLCPWNIVFFMAYEQ 289          

HSP 2 Score: 48.9062 bits (115), Expect = 1.255e-6
Identity = 46/181 (25.41%), Postives = 71/181 (39.23%), Query Frame = 3
Query:  201 SGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKN---HHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRN---YRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIK 725
            +G L + +  P DV+K RMQ   + G   S  S   A   +   EGI  +Y G+     R A      L +Y +       K     HP        + IAGL G+    P ++A  RM       ++ +     YR+  H +      +GF  L++  +P   R    N +   +Y Q K
Sbjct:  113 AGALGSAVCNPTDVLKIRMQAEYRAGAGSSKTSMLVAFGDMYRQEGIRGLYRGVGPTSQRAAVIAGVELPVYDSAKRFILDKKLMGDHP--GTHFVASAIAGLAGAIASNPIDVAKTRMMNQRNLKVKTEGGPVLYRSASHCLVVTFRTEGFFALYRGFIPNFARLCPWNIVFFMAYEQYK 291          
BLAST of slc25a-21 vs. Ensembl Nematostella
Match: EDO36980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH35])

HSP 1 Score: 145.976 bits (367), Expect = 4.691e-41
Identity = 84/281 (29.89%), Postives = 148/281 (52.67%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAI-YHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHP-NLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            ++ +GG +  +      PLD++K  +Q       Q+   S    +  H+   +G+ A+Y+GL+A++ RQ TY+T R G+Y  ++     K   P     K+ +A  +G +G  +G PA++  +RM  D   P++Q+RNY++VF  +    + +G    +K V  T  R +++   Q+A Y Q KQIL+ T    D ++ HF AS I+G     ++ P D++KTRI   R      +Y S ++      K  G    +KGF+P ++++G  T++ +I  EQ+
Sbjct:   22 RWYLGGCASAMAACCTHPLDLLKVHLQT------QQQVTSGLSTMAVHVVRTQGVTALYNGLTASVLRQLTYSTTRYGLYE-IWSGMLRKGTEPLPFYQKISLAAASGFLGGILGNPADMVNVRMQNDVKLPLDQRRNYKHVFDGLYQTAKYEGVPTWFKGVTMTSTRALLITVAQVACYDQAKQILLSTGFFKDNMVTHFTASFIAGTIATGITQPFDVMKTRIMEAR----PGQYKSVFHCVMYTAK-LGPMGFYKGFIPAWVRLGPQTILTWIFLEQL 290          

HSP 2 Score: 56.225 bits (134), Expect = 5.923e-9
Identity = 42/177 (23.73%), Postives = 78/177 (44.07%), Query Frame = 3
Query:  162 PIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQ--ISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYE-RYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCII--EDDGFLGLWKTVLPTMCR 677
            P+P Y K ++  +SG L  ++  P D+V  RMQ  +      +++YK  FD +Y     EG+   + G++    R    T A++  Y    +   S+     N+      + IAG + + +  P ++   R+         +   Y++VFH   C++     G +G +K  +P   R
Sbjct:  108 PLPFYQKISLAAASGFLGGILGNPADMVNVRMQNDVKLPLDQRRNYKHVFDGLYQTAKYEGVPTWFKGVTMTSTRALLITVAQVACYDQAKQILLSTGFFKDNMVTHFTASFIAGTIATGITQPFDVMKTRIME------ARPGQYKSVFH---CVMYTAKLGPMGFYKGFIPAWVR 275          
BLAST of slc25a-21 vs. Ensembl Nematostella
Match: EDO32885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STS5])

HSP 1 Score: 143.28 bits (360), Expect = 4.459e-40
Identity = 84/295 (28.47%), Postives = 149/295 (50.51%), Query Frame = 3
Query:  180 KFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYH--------ITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGL----VGSFVGTPAEIALIRMTADGIFPIEQKR--NYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            KF    ++  +   +  PLD+ KTR+QI G+     +  S+    Y         I   EG+  ++ G++ A+ R   YT +R+ +Y  L  R +     P+    L+ ++I+G+    +G F+ +P ++  ++M  +G   + +KR    R  FHA   I++  GF GLWK  LP + R  +VN   L +Y  +K  L++   L D  ++H ++S+ SGL  A +S P D+IKT     RI+N    Y      F      EG+ SL+KG+LP + ++   ++  ++ +E++ +
Sbjct:   11 KFGFSSAAATVAETVTFPLDITKTRLQIQGERASMVASSSTQPVAYRGMIKTATGIVEEEGLKNLWKGVTPAIMRHVVYTGSRMTVYEFL--RNNVLKRDPDGRFPLWKSVISGMSAGALGQFISSPTDLVKVQMQMEGRRVLIEKRPPRVRGTFHAFRNIVDKYGFRGLWKGWLPNVQRAALVNMGDLTTYDTVKHNLLKHTRLEDNWIVHSMSSVCSGLVAATISTPADVIKT-----RIMNNPSGYQGAVECFMLAVHREGLLSLYKGWLPTWTRMAPWSLTFWLSYEEIRK 298          
BLAST of slc25a-21 vs. Ensembl Medaka
Match: slc25a14 (solute carrier family 25 member 14 [Source:NCBI gene;Acc:101158716])

HSP 1 Score: 189.119 bits (479), Expect = 2.211e-57
Identity = 95/286 (33.22%), Postives = 164/286 (57.34%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQK-SYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADG-IFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            ++  F  GG + I+      P+D+ KTR+Q+ GQ  Y +  Y+  F A++ I   EGI A+YSG+S AL RQA+Y T ++G Y +L   + S+     + + +F  +++G++ S +  P ++  IRM A G +       N+ N++       + +G  GLW+ V+PT  R  +V  ++L  Y   K+ L+ +  + D +L HF++S   GL  A+ S PVD+++TR+ N R+++G P Y    +   + ++NEG  +L+KGF P +L++G   +I FI FEQ+ +
Sbjct:    5 NWKPFVYGGMASIVAEFGTFPIDLTKTRLQVQGQSQYMEVRYRGMFHALFRIGKEEGIRALYSGISPALLRQASYGTIKIGTYNSLKRLFVSRPEDETMVLNVFCGVVSGVLSSSLANPTDVLKIRMQAQGSLLQGSMMSNFINIY-------QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLLGSGVMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRVLSGSPTYKGTLHGVMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFITFEQLKK 283          

HSP 2 Score: 58.9214 bits (141), Expect = 1.725e-9
Identity = 45/178 (25.28%), Postives = 74/178 (41.57%), Query Frame = 3
Query:  201 SGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIA-GLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQI 731
            SG+L++ +  P DV+K RMQ  G    Q S  S+F  IY     EG   ++ G+     R A      L +Y    +         +  +  FI+  A GL G+    P ++   RM    +  +     Y+   H +     ++GF  L+K   P   R    N I   ++ Q+K++
Sbjct:  113 SGVLSSSLANPTDVLKIRMQAQGSL-LQGSMMSNFINIYQ---TEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLLGSGVMGDTVLTHFISSFACGLAGALASNPVDVVRTRMMNQRV--LSGSPTYKGTLHGVMQTWRNEGFFALYKGFWPNWLRLGPWNIIFFITFEQLKKL 284          
BLAST of slc25a-21 vs. Ensembl Medaka
Match: ucp3 (mitochondrial uncoupling protein 2 [Source:NCBI gene;Acc:101160932])

HSP 1 Score: 173.711 bits (439), Expect = 3.481e-51
Identity = 89/288 (30.90%), Postives = 154/288 (53.47%), Query Frame = 3
Query:  177 IKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ----DGYQK-SYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            +KF   G++  +  LI  PLD  K R+QI G+    +G+    Y+  F  I  +   EG  ++Y+GL A L RQ ++ + R+G+Y ++ + Y+       +  +L      G +      P ++  +R  A  +  ++ +R Y +  +A   I  D+G  GLW+  +P + R  +VN  +L +Y  IK+++I+   +SD +  HF A+  +G  T V++ PVD++KTR  N    +G   YSS  N    + KNEG  + +KGF+P FL++GS  ++MF+ +EQ+   
Sbjct:   15 VKFFGAGTAACIADLITFPLDTAKVRLQIQGEAQKAEGFTAVKYRGVFGTITTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSMKQFYTRGTESAGIVTRLMAGCTTGAMAVAFAQPTDVVKVRFQAQ-VRQLDGERRYNSTINAYKTIARDEGIRGLWRGCMPNITRNAIVNCAELVTYDMIKELIIKYDLMSDNLPCHFTAAFGAGFCTTVVASPVDVVKTRFMN----SGSGLYSSAVNCALTMLKNEGPAAFYKGFVPSFLRLGSWNIVMFVTYEQIKRG 297          
BLAST of slc25a-21 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 171.014 bits (432), Expect = 4.629e-50
Identity = 91/297 (30.64%), Postives = 154/297 (51.85%), Query Frame = 3
Query:  159 IPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKS--------YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            +P    +KF   G++  +  L+  PLD  K R+QI G+     S        Y+  F  I  +   EG L++YSGL A L RQ ++ + R+G+Y ++ + Y+  + H ++  +L      G +   +  P ++  IR  A      E  + Y     A   I +++G  GLWK   P + R  +VN  +L +Y  IK +L+++  L+D +  HF+++  +GL T V++ PVD++KTR  N    +   +Y S  N    +   EG  + +KGF+P FL++GS  V+MF+ +EQ+  A
Sbjct:    9 VPPSAAVKFVGAGTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSDHVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQ-TRSNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMN----SAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLKRA 300          
BLAST of slc25a-21 vs. Ensembl Medaka
Match: ucp2 (uncoupling protein 2 [Source:NCBI gene;Acc:101160682])

HSP 1 Score: 170.629 bits (431), Expect = 6.625e-50
Identity = 91/297 (30.64%), Postives = 154/297 (51.85%), Query Frame = 3
Query:  159 IPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKS--------YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEA 1025
            +P    +KF   G++  +  L+  PLD  K R+QI G+     S        Y+  F  I  +   EG L++YSGL A L RQ ++ + R+G+Y ++ + Y+  + H ++  +L      G +   +  P ++  IR  A      E  + Y     A   I +++G  GLWK   P + R  +VN  +L +Y  IK +L+++  L+D +  HF+++  +GL T V++ PVD++KTR  N    +   +Y S  N    +   EG  + +KGF+P FL++GS  V+MF+ +EQ+  A
Sbjct:    9 VPPSAAVKFVGAGTAACIADLLTFPLDTAKVRLQIQGEAAASASIGRVPASMYRGVFGTIITMVRTEGPLSLYSGLVAGLQRQMSFASVRIGLYDSVKQFYTRGSDHVSIGTRLLAGSTTGAMAVALAQPTDVVKIRFQAQ-TRSNEHTKRYCGTIDAYKTIAKEEGVRGLWKGTGPNIARSAIVNCTELVTYDFIKDMLLKSTPLTDNLPCHFVSAFGAGLCTTVIASPVDVVKTRYMN----SAPGQYGSVLNCAAVMMTKEGPFAFYKGFMPSFLRLGSWNVVMFVTYEQLKRA 300          
BLAST of slc25a-21 vs. Ensembl Medaka
Match: ENSORLT00000028230.1 (mitochondrial uncoupling protein 2 [Source:NCBI gene;Acc:101162464])

HSP 1 Score: 168.318 bits (425), Expect = 3.770e-49
Identity = 88/294 (29.93%), Postives = 150/294 (51.02%), Query Frame = 3
Query:  168 PDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ-----DGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTAD-GIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP-EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            P  ++    GS+G +  L+  PLD  K R+QI G+     +G    Y+  F  I  I   EG  ++Y+GL A L RQ T+ + R+G+Y ++ + Y+    +  L  +L      G +      P ++  +R  A   +      + Y +   A   I+ D+G  GLWK  LP + R   VN  +L +Y  IK++L++   ++D +  HF+A+  +GL T V++ PVD++KT     R +N +P +Y    N    +   EG  + +KGF+P FL++ S  ++MF+ +EQ    +
Sbjct:    7 PAAVRVFAAGSAGCVADLVTFPLDTAKVRLQIQGEGRTSLEGQTVKYRGVFGTIVTIVRTEGPRSLYNGLVAGLQRQMTFASVRIGLYDSMKQLYAGSADNAGLGTRLLAGCTTGAMAVAFAQPTDVVKVRFQAQVRLLESATGKRYSSTTQAYRTIVRDEGLRGLWKGALPNIIRNATVNCSELVTYDVIKELLLKNHLMTDNMPCHFIAAFSAGLCTTVVASPVDVVKT-----RYMNSVPGQYGGALNCAATMLIKEGPTAFYKGFMPSFLRLLSWNIVMFVSYEQFKRGF 295          
BLAST of slc25a-21 vs. Planmine SMEST
Match: SMESG000073400.1 (SMESG000073400.1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 300/303 (99.01%), Postives = 302/303 (99.67%), Query Frame = 3
Query:  144 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQHY 1052
            MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIY ITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHA+GCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYR+LVYQHY
Sbjct:    1 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYRITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHALGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRVLVYQHY 303          
BLAST of slc25a-21 vs. Planmine SMEST
Match: SMESG000019229.1 (SMESG000019229.1)

HSP 1 Score: 404.445 bits (1038), Expect = 1.664e-141
Identity = 185/301 (61.46%), Postives = 236/301 (78.41%), Query Frame = 3
Query:  144 MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVYQ 1046
            M  Q+I IP+Y+KFA GGS+G++ TL +QPLD+VK RMQ+SGQDG +K+YKSSFDAI  IT NEG+ AIYSGLSA L RQATYTT RLG+YT L+E++SSK+  P+   K  I + AGL+GSFVGTP E+ALIRMT+DG  P++Q+RNYRNVFHA+  I+ ++G L LW+  LPTM R  VVN  QLASYSQ KQ+++ET+  +DGI +HF ASMISG  T V SMPVDI+KTRIQNM ++NG+ EYS   N F RI K+EGV SLWKGF PYFL++G +TVI F++ EQM+ AY+ + ++
Sbjct:    1 MSSQNISIPNYVKFAFGGSAGMIATLFVQPLDLVKNRMQMSGQDGSKKAYKSSFDAIKQITRNEGLFAIYSGLSAGLLRQATYTTTRLGVYTALFEKFSSKDKPPSFVTKAGIGMSAGLIGSFVGTPTEVALIRMTSDGRLPMDQRRNYRNVFHALARIVREEGVLALWRGCLPTMGRAAVVNLAQLASYSQAKQMILETELFNDGIFVHFGASMISGFITTVASMPVDIVKTRIQNMTVVNGVAEYSGAINAFIRITKHEGVLSLWKGFTPYFLRLGPHTVITFVVLEQMNTAYKNVAHR 301          
BLAST of slc25a-21 vs. Planmine SMEST
Match: SMESG000046675.1 (SMESG000046675.1)

HSP 1 Score: 152.14 bits (383), Expect = 3.351e-43
Identity = 94/277 (33.94%), Postives = 139/277 (50.18%), Query Frame = 3
Query:  192 GGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAI--KLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQM 1016
            GG +  +      PLD++K  +Q       QK           +  N+GILA+Y+GLSA+L RQ TY+  R GIY T       K    NL    K  ++++AG +G  VG PA++  +RM  D     E +RNY N F  +  +++++G L L+  V  T  R   + F QLA Y   KQ L++T   SD IL HF AS  +     +++ P D++KTR+ N +       YS        I K  G    +KG +P F+++G  TV+ FI  EQ+
Sbjct:   18 GGVASAMAAACTHPLDLLKVHLQTQ-----QKKEFGMGGMFLKVVKNDGILALYNGLSASLLRQLTYSMTRFGIYETY-----KKKKGANLPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRLMNAK----PGAYSGLAACGADIMKT-GPLGFFKGLVPAFIRLGPQTVLTFIFLEQL 279          

HSP 2 Score: 51.6026 bits (122), Expect = 3.322e-7
Identity = 39/174 (22.41%), Postives = 74/174 (42.53%), Query Frame = 3
Query:  165 IPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQ--ISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAII-AGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCR 677
            +P Y K A+   +G +  ++  P D+V  RMQ  +      +++Y ++FD ++ +   EG+L ++SG+S    R    T  +L  Y    +         +  +  F A   A  + + +  P ++   R+       +  K    +   A G  I   G LG +K ++P   R
Sbjct:   98 LPFYEKAAVSMVAGFIGGIVGNPADMVNVRMQNDMKIAKELRRNYNNAFDGMFRVVKEEGVLVLFSGVSMTATRACFMTFGQLAFYDLFKQTLMQTGFFSDNILTHFTASTGAAGIATLMTQPFDVMKTRL-------MNAKPGAYSGLAACGADIMKTGPLGFFKGLVPAFIR 264          
BLAST of slc25a-21 vs. Planmine SMEST
Match: SMESG000016412.1 (SMESG000016412.1)

HSP 1 Score: 147.132 bits (370), Expect = 2.703e-41
Identity = 91/296 (30.74%), Postives = 156/296 (52.70%), Query Frame = 3
Query:  171 DYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQ-------DGYQKS-YKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHH-PNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP---EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSE 1022
            D   F  GG++ I+  +   P+D  KTR+QI G+         +Q   Y     A + I   EGI A+Y GLSAA+ RQA+Y T ++G+Y  L +R SS+N    +++  +  A++AG+  S +  P ++  IR+ +   +   Q  ++   F      I  +GF GL+K V+PT  R  ++  + L +Y   K  LI  + L D +  HF +S+++      +S PV++I+TR+ N   I+      +Y S  +   +  +NE + +LWKGF+P + +IG   +I F+  E++ +
Sbjct:    3 DLYPFFHGGAASIIAEICTFPIDTTKTRLQIQGELLKNNTMKHFQGGRYNGMIHAFFVIIKQEGISALYRGLSAAVIRQASYGTMKMGLYDKL-KRISSQNMRGESISNNIACAVVAGVTSSTIANPTDVIKIRLQSKSNY--TQNSSFLKEFTQ---TISKEGFKGLYKAVIPTAARSALLVGVLLPTYDFTKGKLITEQILLDNVYCHFASSLVAATFGTCVSCPVEVIRTRLMNQSNIDSNSVNYKYKSALDCLKKTIRNERIFALWKGFIPTWYRIGPWNIIFFLTHEKIKK 292          
BLAST of slc25a-21 vs. Planmine SMEST
Match: SMESG000062675.1 (SMESG000062675.1)

HSP 1 Score: 142.895 bits (359), Expect = 8.523e-40
Identity = 92/293 (31.40%), Postives = 153/293 (52.22%), Query Frame = 3
Query:  156 SIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSYKSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSSKNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYRNVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIETKSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIP--EYSSCWNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAY 1028
            +IP     ++  GG S  L      PLD++K  +Q       QK          ++  ++G LA+YSG+SA+  RQ  Y+  R GIY  +Y+    K+    L  ++ ++  AGLVG  +G P ++  +RM  D   P++Q+RNY +VF     +I+ +GF GL   V  T  R V++   Q   Y + K +L++T    D  + HF A++ + L+T  L+ P+D++KTR+ N      +P  +Y    + F  I K  G  + +KG LP F++I  + VI+ +I EQ++  +
Sbjct:    2 AIPKKRESRWYFGGLSSALAISATHPLDLIKVHLQTQ-----QKKEFGFLRMGMNVIKHDGFLALYSGISASFIRQIFYSFPRFGIYE-IYKNNLDKSKKIKLYEQIAVSGFAGLVGGVIGNPFDVLNVRMQNDVKLPLDQRRNYNHVFDGFFKVIKSEGFPGLMNGVSMTASRAVLMTIGQTTVYDRCKFMLLKTVFFVDDPITHFTAAIGAALSTIFLANPLDVMKTRLMN------VPPGKYDGIVSCFKDIVKT-GPLAFYKGLLPAFIRICPHFVILHLIREQLTTNF 281          
The following BLAST results are available for this feature:
BLAST of slc25a-21 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A118.579e-11153.95solute carrier family 25 member 11 [Source:HGNC Sy... [more]
SLC25A114.153e-10655.15solute carrier family 25 member 11 [Source:HGNC Sy... [more]
SLC25A111.714e-8856.33solute carrier family 25 member 11 [Source:HGNC Sy... [more]
SLC25A147.207e-5133.10solute carrier family 25 member 14 [Source:HGNC Sy... [more]
SLC25A141.769e-5033.10solute carrier family 25 member 14 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
misc-11.377e-11553.82Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
misc-11.377e-11553.82Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
slc-25A101.427e-4332.25Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
slc-25A101.427e-4332.25Oxoglutarate/malate carrier protein; SLC (SoLute C... [more]
ucp-44.030e-3125.59UnCoupling Protein (Mitochondrial substrate carrie... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG19072.761e-10149.65gene:FBgn0039674 transcript:FBtr0085447[more]
CG184183.810e-9747.40gene:FBgn0035568 transcript:FBtr0073366[more]
CG75142.162e-8947.10gene:FBgn0035567 transcript:FBtr0073367[more]
Dic13.017e-4631.64gene:FBgn0027610 transcript:FBtr0082747[more]
Dic13.017e-4631.64gene:FBgn0027610 transcript:FBtr0346113[more]
back to top
BLAST of slc25a-21 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a111.238e-11255.17solute carrier family 25 member 11 [Source:ZFIN;Ac... [more]
slc25a145.039e-5633.22solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
slc25a145.039e-5633.22solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
slc25a149.511e-5232.85solute carrier family 25 member 14 [Source:ZFIN;Ac... [more]
ucp11.972e-5031.58uncoupling protein 1 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a117.442e-10853.63solute carrier family 25 (mitochondrial carrier; o... [more]
slc25a112.521e-10454.58solute carrier family 25 (mitochondrial carrier; o... [more]
slc25a111.045e-9048.10solute carrier family 25 (mitochondrial carrier; o... [more]
slc25a115.051e-8655.07solute carrier family 25 (mitochondrial carrier; o... [more]
ucp24.280e-5130.72uncoupling protein 2 (mitochondrial, proton carrie... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a118.382e-11252.49solute carrier family 25 (mitochondrial carrier ox... [more]
Slc25a113.793e-6753.68solute carrier family 25 (mitochondrial carrier ox... [more]
Slc25a145.805e-5133.10solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a141.267e-5033.10solute carrier family 25 (mitochondrial carrier, b... [more]
Slc25a141.460e-5033.10solute carrier family 25 (mitochondrial carrier, b... [more]
back to top
BLAST of slc25a-21 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90992|M2OM_CAEEL1.751e-11453.82Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
sp|Q9CR62|M2OM_MOUSE5.863e-11152.49Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
sp|P22292|M2OM_BOVIN1.356e-11053.61Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
sp|Q02978|M2OM_HUMAN4.120e-11053.95Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
sp|P97700|M2OM_RAT2.395e-10651.16Mitochondrial 2-oxoglutarate/malate carrier protei... [more]
back to top
BLAST of slc25a-21 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJC80.000e+0100.00Slc25a-21 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0H3YJ721.434e-13761.13Slc25a-18 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
F1LA079.816e-11554.882-oxoglutarate/malate carrier protein OS=Ascaris s... [more]
A0A0N4UII49.890e-11556.12Uncharacterized protein OS=Dracunculus medinensis ... [more]
A0A2A2LLF11.224e-11454.86Uncharacterized protein OS=Diploscapter pachys OX=... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a119.542e-11154.83solute carrier family 25 member 11 [Source:NCBI ge... [more]
slc25a111.541e-8756.58solute carrier family 25 member 11 [Source:NCBI ge... [more]
slc25a146.816e-5532.87brain mitochondrial carrier protein 1 [Source:NCBI... [more]
slc25a142.612e-5132.85brain mitochondrial carrier protein 1 [Source:NCBI... [more]
ucp14.863e-5031.31uncoupling protein 1 [Source:NCBI gene;Acc:1030377... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ucp28.323e-5029.53uncoupling protein 2 [Source:NCBI gene;Acc:555812][more]
ENSPMAT00000008980.16.401e-2130.52pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
SLC25A401.960e-2023.62solute carrier family 25 member 40 [Source:HGNC Sy... [more]
slc25a38b1.105e-1824.64solute carrier family 25 member 38b [Source:NCBI g... [more]
slc25a1b3.877e-1823.59slc25a1 solute carrier family 25 member 1b [Source... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DIC11.251e-4230.50Mitochondrial dicarboxylate carrier; integral memb... [more]
OAC12.159e-3127.30Mitochondrial inner membrane transporter; transpor... [more]
ODC22.162e-2725.08Mitochondrial inner membrane transporter; 2-oxodic... [more]
CTP19.263e-2528.57Mitochondrial inner membrane citrate transporter; ... [more]
ODC11.212e-2223.05Mitochondrial inner membrane transporter; 2-oxodic... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478739.814e-10953.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343267.077e-4729.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399871.963e-4533.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369804.691e-4129.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328854.459e-4028.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-21 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a142.211e-5733.22solute carrier family 25 member 14 [Source:NCBI ge... [more]
ucp33.481e-5130.90mitochondrial uncoupling protein 2 [Source:NCBI ge... [more]
ucp24.629e-5030.64uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ucp26.625e-5030.64uncoupling protein 2 [Source:NCBI gene;Acc:1011606... [more]
ENSORLT00000028230.13.770e-4929.93mitochondrial uncoupling protein 2 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-21 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073400.10.000e+099.01SMESG000073400.1[more]
SMESG000019229.11.664e-14161.46SMESG000019229.1[more]
SMESG000046675.13.351e-4333.94SMESG000046675.1[more]
SMESG000016412.12.703e-4130.74SMESG000016412.1[more]
SMESG000062675.18.523e-4031.40SMESG000062675.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010853
GenBankAKN21589.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010853 ID=SMED30010853|Name=slc25a-21|organism=Schmidtea mediterranea sexual|type=transcript|length=1110bp
AACAATGCATAGTTTATATTGGATAGCTAAATGTATTGTTAAATGTTAAT
TTACTAGATTGCTGTCTATTATAGCTTTCAGTGGATAAAAATATTAATTC
ATAACAATTGATAGAGAAATATTTTTGTGAATTTTAGGGTAAAATGCAAT
GGCAAAGCATTCCAATTCCGGATTATATAAAATTTGCTATCGGTGGCTCG
TCAGGCATACTGACGACGTTGATTATACAACCTCTTGATGTCGTTAAGAC
TCGAATGCAAATCTCTGGCCAAGATGGTTATCAGAAATCCTACAAAAGCA
GTTTTGATGCTATATATCATATCACAACAAATGAAGGGATTTTAGCAATA
TATTCTGGTTTAAGTGCAGCATTATTTCGACAAGCTACTTATACTACTGC
AAGATTGGGAATTTATACAACTTTGTATGAAAGGTATTCGTCAAAAAATC
ATCACCCAAATTTGGCGATTAAACTTTTTATTGCGATTATTGCTGGCTTG
GTTGGATCATTTGTTGGGACACCAGCTGAAATTGCTTTGATCAGAATGAC
AGCCGATGGAATATTTCCAATTGAACAAAAAAGAAATTACCGAAACGTTT
TTCACGCCATAGGTTGCATTATTGAGGATGATGGATTTTTAGGATTATGG
AAAACAGTGTTGCCAACGATGTGTCGAGGAGTAGTTGTGAATTTTATACA
GTTAGCCTCATATTCCCAAATAAAGCAAATATTAATTGAAACAAAATCGT
TAAGTGACGGCATTTTATTACATTTCCTTGCTAGTATGATCAGTGGGTTA
AATACGGCTGTTTTATCGATGCCCGTCGACATCATTAAAACAAGAATACA
AAATATGAGAATAATTAATGGTATTCCTGAGTATTCAAGCTGTTGGAATG
TATTTTACAGAATATTTAAAAATGAAGGTGTTCACAGTTTGTGGAAAGGC
TTTTTACCATACTTTTTAAAAATCGGCTCTAATACAGTTATAATGTTTAT
AATATTTGAACAAATGAGTGAAGCATACAGAATTTTGGTATATCAGCACT
ATCTTAACTGAAATTCTTTCAATAATCACTAGATATTCTTTTTATTATTT
AAATATGGAC
back to top

protein sequence of SMED30010853-orf-1

>SMED30010853-orf-1 ID=SMED30010853-orf-1|Name=SMED30010853-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=306bp
MQWQSIPIPDYIKFAIGGSSGILTTLIIQPLDVVKTRMQISGQDGYQKSY
KSSFDAIYHITTNEGILAIYSGLSAALFRQATYTTARLGIYTTLYERYSS
KNHHPNLAIKLFIAIIAGLVGSFVGTPAEIALIRMTADGIFPIEQKRNYR
NVFHAIGCIIEDDGFLGLWKTVLPTMCRGVVVNFIQLASYSQIKQILIET
KSLSDGILLHFLASMISGLNTAVLSMPVDIIKTRIQNMRIINGIPEYSSC
WNVFYRIFKNEGVHSLWKGFLPYFLKIGSNTVIMFIIFEQMSEAYRILVY
QHYLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006839mitochondrial transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031966mitochondrial membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 11..302
e-value: 7.0E-79
score: 266.6
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 9..291
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 107..199
e-value: 3.6E-14
score: 52.5
coord: 207..295
e-value: 1.4E-18
score: 66.6
coord: 12..100
e-value: 1.2E-20
score: 73.2
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 205..294
score: 26.353
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 8..97
score: 24.68
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 105..196
score: 22.427
NoneNo IPR availablePANTHERPTHR45618:SF9MITOCHONDRIAL 2-OXOGLUTARATE/MALATE CARRIER PROTEINcoord: 9..292
NoneNo IPR availablePANTHERPTHR45618FAMILY NOT NAMEDcoord: 9..292
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 56..78
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 111..133