EF-hand domain-containing protein 1

Overview
NameEF-hand domain-containing protein 1
Smed IDSMED30010842
Uniprot Best hitEF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EFHC1 PE=1 SV=1 (E=0)
Length (bp)2024
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EF-hand domain-containing protein 1 (SMED30010842) t-SNE clustered cells

Violin plots show distribution of expression levels for EF-hand domain-containing protein 1 (SMED30010842) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EF-hand domain-containing protein 1 (SMED30010842) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EF-hand domain-containing protein 1 (SMED30010842) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010842

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010842SMESG000078434.1 SmedASXL_003343SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010842SMESG000078434.1 dd_Smed_v6_2935_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010842SMESG000078434.1 dd_Smed_v6_2935_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010842SMESG000078434.1 dd_Smed_v4_2935_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 310/627 (49.44%), Postives = 421/627 (67.15%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGS 1899
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E  +  +    +   ++  ++  ++ QLK  +  D  R  E F  Y+K+ +G V  +    IC  +N+P D+ ++  +   Y S
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQ---ELEALIDTIQKQLKDHSCKDNIR--EAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKEVSMNYSS 624          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 309/622 (49.68%), Postives = 420/622 (67.52%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLL 1884
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E  +  +    +   ++  ++  ++ QLK  +  D  R  E F  Y+K+ +G V  +    IC  +N+P D+ ++  L+
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQ---ELEALIDTIQKQLKDHSCKDNIR--EAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELI 619          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 308/618 (49.84%), Postives = 418/618 (67.64%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDIL 1872
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E  +  +    +   ++  ++  ++ QLK  +  D  R  E F  Y+K+ +G V  +    IC  +N+P D+ ++
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQ---ELEALIDTIQKQLKDHSCKDNIR--EAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLV 615          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 308/618 (49.84%), Postives = 418/618 (67.64%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDIL 1872
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E  +  +    +   ++  ++  ++ QLK  +  D  R  E F  Y+K+ +G V  +    IC  +N+P D+ ++
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQ---ELEALIDTIQKQLKDHSCKDNIR--EAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLV 615          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Match: EFHC1 (EF-hand domain containing 1 [Source:HGNC Symbol;Acc:HGNC:16406])

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 295/558 (52.87%), Postives = 390/558 (69.89%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDG 1692
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E     R+++C + G
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAE-----RISLCTQAG 555          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Celegans
Match: efhc-1 (EF-Hand domain-Containing protein 1 homolog [Source:UniProtKB/TrEMBL;Acc:Q9XWW8])

HSP 1 Score: 120.553 bits (301), Expect = 6.155e-29
Identity = 119/438 (27.17%), Postives = 187/438 (42.69%), Query Frame = 1
Query:  277 AFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPK-NEVGDHYT-WKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRN---FIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDN-FTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQ 1572
            A +  VL F  Y +E   +   E +R+   K+ Y+L DD+I + E   +N+G   G I RRQ+VP  N +G  Y  W DLN GT + ++  +YR TSCD FTR +LE  G  VN  E++PEDP+L  R  R A +T   P   D R +F+     +L +   W D    F  CR    F ++ Y S+ T+ + E     +G+    + ++R  +P         FP     + P+ +K  +   D+R G  ++V  R   +++C N  TK++  Q FG TDF                               +S      PP   F     N   +L++ C M           F+L Y +   +++I E   R +   G  FLK    +           +    F  G I++ F  RF +  +      +++  Q
Sbjct:   74 AANSAVLSFDAYAEEDGLDE--EIHRIRIFKINYHLNDDTITVNEPFVDNTGYLHGRIFRRQKVPAHNRIGKPYVHWSDLNVGTDINLFQTIYRITSCDTFTRSFLEEHGTKVNEDEELPEDPWLVRR--RGAPRT--APKLPDQR-EFINR-PPMLVYRCCWLDHMNDFHGCRMKRIFKMYVYCSDHTVALIEETKEFEGQ----LFLKRIALP---------FP-----VQPDMVKRDYRWWDIRPGVWVDVFCRPMFVFECANDETKSFTRQQFGETDFANY----------------------------SSQILEEGPPTTQFF----NSPSILKFRCTMVDAPSVLYGLHFLLYYDVNRRIVNINEE-GRKTWTDGRVFLKDVDAST----------FSENQFAPGRILQFFKWRFNLVQSSGETGKYLRWKQ 442          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Efhc1.1 (gene:FBgn0030691 transcript:FBtr0074192)

HSP 1 Score: 317.39 bits (812), Expect = 2.362e-97
Identity = 214/612 (34.97%), Postives = 316/612 (51.63%), Query Frame = 1
Query:   13 LNMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFR--TPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF--IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDV---SPTFPNVVLEL----------------TPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKI--------DHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTIC---RKDGDIFQMMKELRTQL 1731
            L + G+P+LPG  FRDV+K ++   Q+L    G    + +  P+      P++   +T        +  P    G S   PP +   +P  +A+DKKVL F  Y+K+T+QE     Y V  VK+YYYLED +++I E   +NSGI QG ++ RQRV K    D+   +  DLN   ++ ++ + Y  T CD FTR +L   GI V  P   P DP   +R      ++           QFL+ D++IL+F A WDDR E FG+ R   + YYLS+DT+EIKE H  N GRD   V ++R R+ +  + +       P  +L +                T N+   Y+  KDL+IG  INV GR  ++ + D FT+ +Y Q +G  DFTP+ I        DHR     + ++PPYNG+G+ EDS+ N ++  P+PPK DF K +  +  VLR+  KM S    + +R F++SY L DD + I E   RNSGFLGG F+KRTR+  PG    +   P+YY P +F VG+ + +    F I +AD Y L +M+ +   FP   +  +   + +  Q R  + V  G  V  C    K  D+F   +  +  L
Sbjct:    2 LRIPGMPLLPGTLFRDVSKGHYPKPQSLANVQGLSMLSDRQQPA------PVESGSVTVD-----ISCPPV---GASSIYPPRSGPRMPPWLAYDKKVLCFHAYFKQTLQEVYHAPYLVRKVKIYYYLEDGTLEIYEPRVDNSGIVQGCVVHRQRVQKAPPCDNEFMSLIDLNVDQTVQIFDRQYHITDCDPFTRTFLNKRGITVPDPVKSPCDPTEEQRKRENQPRSGNLIPKNHPFAQFLKYDRQILKFQAYWDDRTE-FGDVRKLELCYYLSDDTIEIKEQHIRNSGRDGPTVFLKRGRLAREFEGLQLPGQMTPMTLLNVLGTNMRNVRYCVDPLNTGNKEIHYYREKDLQIGSVINVYGRAVVITELDPFTQNYYRQRYGIQDFTPLPIPARSDDCADHR----SERQLPPYNGWGSYEDSVGNCISVEPKPPKSDFKKFIKYDRYVLRFGAKMLSTIKANCERIFVISYYLCDDTLQIQEIAVRNSGFLGGEFMKRTRLELPGQERFSCKQPQYYMPWNFFVGSTMSLKDFIFHIVSADEYTLMYMEHHPEIFPHANVGVIMEKVKSALQNRMAEFV--GSCVPDCTDLEKKRDVFVSFESFKGAL 592          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Fly
Match: Efhc1.2 (gene:FBgn0034487 transcript:FBtr0086316)

HSP 1 Score: 313.923 bits (803), Expect = 3.214e-96
Identity = 208/604 (34.44%), Postives = 308/604 (50.99%), Query Frame = 1
Query:   13 LNMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGF------RTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARK----QFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN-------RDDVSPTFPNVV-------------LELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLE-------MPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDI 1698
            + + G+PMLPG  F D  K      QTL    G       R P+     GI  DP        ++L+ L  W P  T            +P  +A+DK+VL F  Y+KE + E     Y+V  VK+++YLED ++Q+TE    NSGIPQG ++ RQR+PK    D    +  DLN  T + ++ +VY  + CD FTR +L   GI V   +  P DP    R      +T  T +S   +K    QFLE D+++L+F   W+DR E FG+ R   + YYL++DT++IKE    N GR+     ++R ++PK            + T  NV+             L     E++ Y + +DL+IG  +NV GR  +L  CD FT+++Y + +G  +F+P  I  R    P  +       +PPYNG+G+ EDS  N +T  P+PP+ DF K    +  +LR+  K+ S   ++ +R F++SY LADD + IYE  +RNSGFLGG FLKR RV  PG    ++  PEYY   DF +G  + +    F I +AD + L +M+ +   FP   I  +   +   E +RP  +      V  C+ DGD+
Sbjct:    2 MRLPGMPMLPGAQFYDRGKRRHPRQQTLMHYQGIQMLSDRREPELVEPNGIVADP--KCPPVPAQLNSL--WAPKATTK----------LPPWLAYDKQVLCFNAYFKENLTEIYHAPYQVRKVKIFFYLEDGTMQVTEPKVENSGIPQGCLVHRQRIPKAPPTDREFISIFDLNVDTDVQIFDRVYHISGCDVFTRQFLNRAGIFVPEAQQEPCDPTTEIRKRSGLKQTGNTATSALPKKHAFAQFLEFDRRVLKFQGYWNDRSE-FGDVRKLEVCYYLADDTIDIKEKFPRNSGREGPTTFLKRGKLPKEFSGLPLPGQQTAMTLLNVLGNSMRDVRYVADPLNTGQKEVQHY-TDQDLQIGAVLNVFGRSVVLTSCDQFTQSYYREKYGIQEFSPQPIPERSDIRPYTQGGMGSRRLPPYNGWGSHEDSEGNCITVEPKPPQADFKKLFKYDGCILRFGAKLISAIRDNGERDFVISYFLADDTLQIYETSRRNSGFLGGEFLKRARVPLPGQDMYSSSRPEYYRANDFYIGRTMTLKDHIFHIVSADEFTLMYMEQHPSEFPVADIQKIMQKI--REAVRPDYKQF----VLRCKPDGDL 583          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: efhc1 (EF-hand domain (C-terminal) containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1300])

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 279/541 (51.57%), Postives = 384/541 (70.98%), Query Frame = 1
Query:   22 EGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDAR-KQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRP 1641
             GLP LPGN+FRD+TK+ FH +QTL +KNG+  P+  P VGIG DPL    ++ SE ++L    P LTYG  R   P  FIP H A+DKKVLRF+GY+++ V  S  EH+R+  V  YY+LEDDSI +TE P  NSGIPQG +++RQR+ KN  GD Y WKDLN G  + ++G+VYR T CD FT+D++ES+GIV+N  E IP DPY A RAH +  +T+ TP   + + ++FL +D+++LRF+A+WDD D ++GE R   +HYYL +D++EI E H+ N GRDPFPVL+RR +IPK+       FP+ VLE++P+++KEYF P+D R+G+ +N++GRRFLLYDCD+FT  +Y  H       P  +D R  +  K  +PPYNGFG+LEDSL+N L+ +PQPPKK+ IK ++N++KVLRY  +++S    D+ RRFILS+ LADDMISI+E   RNSG +GG FL++TR+ KPG TA+ PEYY P D CVGA +EVFG RF++T AD +VLSF+++  H  P   +++L  H    +Q+ P
Sbjct:    7 HGLPFLPGNTFRDLTKSAFHRAQTLDFKNGYAQPRR-PVVGIGQDPLLSVNISHSERNQLITDIPNLTYGTDRSHLPLEFIPAHAAYDKKVLRFYGYFRQEVLHSWDEHFRIRPVVFYYHLEDDSICVTEPPVENSGIPQGKLIKRQRLSKNPRGDLYHWKDLNVGMDINLFGEVYRITHCDPFTQDFMESQGIVLNEFESIPSDPYTARRAHNQ--QTHITPYDHNHQLERFLALDRQVLRFFALWDDSDSLYGEKRPVTLHYYLVDDSVEICEHHEANSGRDPFPVLLRRQKIPKHIKPTCEPFPSCVLEVSPHDVKEYFCPQDFRVGEEVNLMGRRFLLYDCDDFTHKYYQHHHPDIPIKPFTVDTRTQQDIKRVIPPYNGFGSLEDSLQNCLSLIPQPPKKNVIKLLENDHKVLRYAARLDSQNRLDEGRRFILSFHLADDMISIFEKSTRNSGIIGGKFLEKTRIPKPGSTAEKPEYYQPADLCVGATVEVFGHRFVVTDADRFVLSFLESQSHQTPEHTLSSL-RHATDPQQLHP 543          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: efhc2 (EF-hand domain (C-terminal) containing 2 [Source:NCBI gene;Acc:567323])

HSP 1 Score: 372.474 bits (955), Expect = 1.340e-118
Identity = 238/705 (33.76%), Postives = 344/705 (48.79%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF-------IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAH-REALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSP------------------------KDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHK---------------------------------EVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGS 1899
             LPMLPGNS  R++ K  FH SQ   + NG          GIGGD                     L  GQS +A  + F        P  +AFDK+VL F  Y+ E V +   E YRV   K+Y+YLEDD+IQ+ E    NSGIPQGT++RR R+P     D   Y     N    +  Y + +  T CD FTR++L   G+ +N P   P DPY   R    E +K  +     D  KQFLE D+++LRFY  WDD + MFG+ R  I+HY+L++DTME+ EV   N GRD  P  + R ++PK+    +P       E+T   +   F P                         DL IG  INV GRR L+ DCD FTK +Y   +G  DF  I      P  P  ++PPY GFG+ EDSL +    +P+PP+KDF K ++ + +     VLR+  KM +  P DK+R FI+ + L DD I+++E P+RNSG +GG FL+R RV KPG     ++  EY+   D  VGA + +    F +  AD +  S+M+ +   FP+  I  + + +  I+EEQ +  K                                 E++  GRV   R+  + ++  M+   +  LK+      + + + F   ++DR G ++ +  + IC+   LP  +D+L  LLE++  
Sbjct:    2 ALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGD---------------------LLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEDVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVVFYSRNFMITDCDPFTRNFLIKMGVRLNPPASTPADPYTTLRQELEENMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKH----APIPKRQPGEITDRTVLNVFGPVGQGGRYILDSLKTGALEEEFYKDSDLTIGAVINVWGRRVLICDCDYFTKEYYRSKYGIEDFPSISYKASPPPKPAKQVPPYTGFGSEEDSLCSCQGLLPKPPQKDFKKLMEKDRQGLVSNVLRFVGKMLTDSPVDKERVFIICFYLTDDTIAVFEPPQRNSGVIGGKFLERGRVKKPGQELFKSEMSEYFTAQDLYVGAHLLLNSQPFQLVDADDFTFSYMEQHADEFPKANIGTIISKVKSISEEQQKKVKQFFTMSDPSSTGSLPYESFRTLLADLDVELSEHEIMTLGRVYSVRQQPEVNVGLMLAVAQDHLKKKNFEKFSEMIQAFTHEDRDRCGQLSSKEARIICKAFRLPLSDDLLRALLEKFAG 681          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Match: efhc2 (EF-hand domain (C-terminal) containing 2 [Source:NCBI gene;Acc:567323])

HSP 1 Score: 209.149 bits (531), Expect = 3.252e-61
Identity = 130/350 (37.14%), Postives = 176/350 (50.29%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF-------IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLL 1044
             LPMLPGNS  R++ K  FH SQ   + NG          GIGGD                     L  GQS +A  + F        P  +AFDK+VL F  Y+ E V +   E YRV   K+Y+YLEDD+IQ+ E    NSGIPQGT++RR R+P     D   Y     N    +  Y + +  T CD FTR++L   G+ +N P   P DPY   R   + +K  +     D  KQFLE D+++LRFY  WDD + MFG+ R  I+HY+L++DTME+ EV   N GRD  P  + R ++PK+    +P       E+T   +   F P    +GQ     G R++L
Sbjct:    2 ALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGD---------------------LLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEDVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVVFYSRNFMITDCDPFTRNFLIKMGVRLNPPASTPADPYTTLRQEAKNMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKH----APIPKRQPGEITDRTVLNVFGP----VGQ-----GGRYIL 317          

HSP 2 Score: 60.8474 bits (146), Expect = 1.697e-9
Identity = 65/235 (27.66%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  715 FLEMDKKILRFYAVWDD-----RDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIP--KNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQ-VDNENKVLRYECKMESIRPEDKD-RRFILSYRLADDMISIYEAPKRNSG 1392
            +L  DK++L F A +++     R+E +   R   I++YL +DT+++ E    N G  P   L+RR RIP    +DD                   +++     I Q +    R F++ DCD FT+ +            IK+  R+         PY    TL    +N     P   + D +KQ ++++ +VLR+ C  +       D R  IL Y LADD + +YE    NSG
Sbjct:   71 WLAFDKQVLCFDAYFNEDVPQRREEKY-RVRKCKIYFYLEDDTIQVVEPEFKNSG-IPQGTLIRRHRIPLPAPKDDC------------------FYNVHHFNINQEVVFYSRNFMITDCDPFTRNFL-----------IKMGVRLNPPASTPADPYT---TLRQEAKNMKPLRPYE-RLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSG 270          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: agmo (alkylglycerol monooxygenase [Source:Xenbase;Acc:XB-GENE-950748])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 301/542 (55.54%), Postives = 402/542 (74.17%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKID-HRIPEIPKL--EMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQM 1635
            + GLP LPGN++RD TK+ FH SQTL +KNG+  P   P+VGIG +P+  NQL+++ELDELAN +PTLTYG+++ APP+ FIP +VAFDKKVLRF GY++ETV  SP EHYRV  V LYYYLEDD+I + E P  NSGIPQGT ++RQR PKN  GD Y WKDLN G ++ +YG+ +R  SCD FT+++LESEGI +N PE IP DP+   R  R   +T+ TPS FD  KQ+L MD+K+LRF+AVWDD + MFGE    +IHYYLS+DT+EI+EVH+ NDGRDPFPVL++R  +PK  +D   TFP  VLE++  E+KE+FSP D ++G+ I++LGR+F +YDCD +T+ +Y    G  D  P++++  R  E  K+  E+PPYNGFG LEDSL+N L+ +P+PPKKD +K ++N++ VLRY   ++S  PEDK RRF+LSY LA+DM+SI+E   RNSG +GG FL+++RV  PG T DNP YYGP DF +GA IEVF  RFIIT AD YVL++M+A+   FP  ++++L  HL  + ++
Sbjct:    6 VHGLPFLPGNTYRDPTKSAFHRSQTLTYKNGYSRP-ILPTVGIGREPITANQLSQAELDELANKRPTLTYGRAKPAPPSDFIPSYVAFDKKVLRFEGYFQETVPLSPEEHYRVRRVTLYYYLEDDTISVIEPPMENSGIPQGTFIKRQRHPKNANGDPYHWKDLNVGINVTLYGRTFRLISCDSFTQEFLESEGIELNPPEGIPTDPFTELR--RRPNRTFVTPSDFDKLKQYLTMDRKVLRFFAVWDDTESMFGEKHPVLIHYYLSDDTVEIREVHERNDGRDPFPVLMKRQHLPKVVNDTKDTFPMCVLEISDQEVKEWFSPGDFKVGKQISILGRKFFIYDCDAYTRDFYRDKMGIGDLQPVEVNKEREDEEEKVIQEIPPYNGFGLLEDSLQNCLSLVPKPPKKDVLKMLENDHNVLRYVVILDSPNPEDKVRRFVLSYFLANDMLSIFERQVRNSGIIGGKFLEKSRVLVPGSTVDNPIYYGPKDFTIGAAIEVFNHRFIITDADEYVLNYMKAHSKEFPPHVLHSLERHLYPQPEI 544          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 405.601 bits (1041), Expect = 3.435e-131
Identity = 239/697 (34.29%), Postives = 364/697 (52.22%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI--------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL-------------------------------------IAEEQMRPHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNG 1905
             LP LPGNSF R++ K  FH SQ  G+ N           G+GG PL + Q          N +P  +         A   P  VAFDK+VL F  Y++E V +   E YR+   K+Y+YLEDD+IQ+ E    NSGIPQGTI+RR R+P     D   YT   LN    +  Y K+YR  +CD+FTR++L   G+ +N P+ +P D Y + R   E ++  +     D  KQFLE D+ +LRF+  WDD   +FG+ R  +++YYL++DT+EI E+   N GRD  PV + R ++PK+     P    V      N                      +E++   DL IG  +NV GR+ +L DCD FTK +Y   FG  DFTP++     P  PK E PPYNGFG+  D+L + +  +P+PP++DF K ++      E+ VLR+  ++++  P DK+R+FI+SY L+DD ++++E  +RNSG +GG FL+R+RV KPG     ++  EY+ P D  VGA +   G  FI+  AD YV ++M+ N + FP   I+ +T+ L                                     I E Q+  H E++  GR    R   + D+  +    + QLK+ +  + +++ ++F+  ++++ G ++ +    IC+   +P  +D L  LLE++  NG
Sbjct:    2 ALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPL-LGQ----------NLKPKFSVFPKGVGSDA---PSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEEMQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLLVDIYENQLTEH-EIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKNGWLSFQKTLTICKAFKIPLADDFLRVLLEKHTENG 682          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 404.831 bits (1039), Expect = 3.571e-131
Identity = 239/697 (34.29%), Postives = 364/697 (52.22%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI--------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL-------------------------------------IAEEQMRPHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNG 1905
             LP LPGNSF R++ K  FH SQ  G+ N           G+GG PL + Q          N +P  +         A   P  VAFDK+VL F  Y++E V +   E YR+   K+Y+YLEDD+IQ+ E    NSGIPQGTI+RR R+P     D   YT   LN    +  Y K+YR  +CD+FTR++L   G+ +N P+ +P D Y + R   E ++  +     D  KQFLE D+ +LRF+  WDD   +FG+ R  +++YYL++DT+EI E+   N GRD  PV + R ++PK+     P    V      N                      +E++   DL IG  +NV GR+ +L DCD FTK +Y   FG  DFTP++     P  PK E PPYNGFG+  D+L + +  +P+PP++DF K ++      E+ VLR+  ++++  P DK+R+FI+SY L+DD ++++E  +RNSG +GG FL+R+RV KPG     ++  EY+ P D  VGA +   G  FI+  AD YV ++M+ N + FP   I+ +T+ L                                     I E Q+  H E++  GR    R   + D+  +    + QLK+ +  + +++ ++F+  ++++ G ++ +    IC+   +P  +D L  LLE++  NG
Sbjct:    2 ALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPL-LGQ----------NLKPKFSVFPKGVGSDA---PSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEEMQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQHFEANDPTGTSHMPYEIFRNLLVDIYENQLTEH-EIMTTGRYYSIRDKPEIDLGSLTAIAQEQLKKKSFENFSKLSDVFVYNDQEKNGWLSFQKTLTICKAFKIPLADDFLRVLLEKHTENG 682          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 390.578 bits (1002), Expect = 1.272e-126
Identity = 220/569 (38.66%), Postives = 319/569 (56.06%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPN--------------EIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHKE 1650
             LP LPGNSF R++ K  FH SQ  G+ N           G+GG PL + Q          N +P  +         A   P  VAFDK+VL F  Y++E V +   E YR+   K+Y+YLEDD+IQ+ E    NSGIPQGTI+RR R+P     D   YT   LN    +  Y K+YR  +CD+FTR++L   G+ +N P+ +P D Y + R   E ++  +     D  KQFLE D+ +LRF+  WDD   +FG+ R  +++YYL++DT+EI E+   N GRD  PV + R ++PK+     P    V      N               +KE++   DL IG  +NV GR+ +L DCD FTK +Y   FG  DFTP++     P  PK E PPYNGFG+  D+L + +  +P+PP++DF K ++      E+ VLR+  ++++  P DK+R+FI+SY L+DD ++++E  +RNSG +GG FL+R+RV KPG     ++  EY+ P D  VGA +   G  FI+  AD YV ++M+ N + FP   I+ +T+ L  I E + R  K+
Sbjct:    2 ALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPL-LGQ----------NLKPKFSVFPKGVGSDA---PSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEEMQPLRPYERIDTLKQFLEHDRHVLRFFCFWDD-TTLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQ 555          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:100126059])

HSP 1 Score: 385.185 bits (988), Expect = 1.032e-123
Identity = 219/575 (38.09%), Postives = 318/575 (55.30%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI--------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHKE 1650
             LP LPGNSF R++ K  FH SQ  G+ N           G+GG PL + Q          N +P  +         A   P  VAFDK+VL F  Y++E V +   E YR+   K+Y+YLEDD+IQ+ E    NSGIPQGTI+RR R+P     D   YT   LN    +  Y K+YR  +CD+FTR++L   G+ +N P+ +P D Y + R   E ++  +     D  KQFLE D+ +LRF+  WDD   +FG+ R  +++YYL++DT+EI E+   N GRD  PV + R ++PK+     P    V      N                      +E++   DL IG  +NV GR+ +L DCD FTK +Y   FG  DFTP++     P  PK E PPYNGFG+  D+L + +  +P+PP++DF K ++      E+ VLR+  ++++  P DK+R+FI+SY L+DD ++++E  +RNSG +GG FL+R+RV KPG     ++  EY+ P D  VGA +   G  FI+  AD YV ++M+ N + FP   I+ +T+ L  I E + R  K+
Sbjct:    2 ALPFLPGNSFNRNLGKEKFHKSQHFGYSNDISMWLGEEKPGVGGAPL-LGQ----------NLKPKFSVFPKGVGSDA---PSWVAFDKQVLSFDAYFEEEVHQRREETYRIRQCKIYFYLEDDTIQVVEPEIKNSGIPQGTIIRRHRIPLPAPNDDQFYTVDHLNLNKDIVFYSKIYRIVNCDEFTRNFLRKLGVRINPPDSVPSDAYSSTRKKMEEMQPLRPYERIDTLKQFLEHDRHVLRFFCFWDDT-TLFGDSRELVLYYYLADDTVEILEIIPANSGRDTTPVFLHRGKLPKSSPQNVPQPGQVTARTVLNVFGPMGHGGRYILDNLKTGAVHEEFYKDSDLTIGAALNVWGRKVILCDCDEFTKNYYKTKFGIEDFTPVQYKAPQPPRPKKEFPPYNGFGSEADTLCSCMALLPKPPQRDFKKFMEKDRNGLESNVLRFVARLDTDNPIDKERKFIVSYFLSDDTVTVFEPQERNSGMVGGKFLERSRVKKPGQQLFKSELSEYFRPEDLFVGARVNFNGFLFILVDADEYVFNYMERNANEFPMSDISVITSKLRRIGETKSREIKQ 561          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Efhc1 (EF-hand domain (C-terminal) containing 1 [Source:MGI Symbol;Acc:MGI:1919127])

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 308/639 (48.20%), Postives = 422/639 (66.04%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICR-----KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLE--EYGSNGRMN 1914
            + GLP LPG+SF D TKT FH SQTL ++NG+   +  P++GIGGD L  NQL+++ELDELAN  P LTYG  +QAP A F+P HVAFDKKVL+F  Y++E V  S  EHYR+ HV +YYYLEDDS+ + E    NSGIPQG +++RQR  KN++GDHY WKDLN G ++ VYGK +R   CD+FT+D+LES+GI +N  E IP DPY   R  +E ++ Y TPS FD  KQFL  DK++LRFYA+WDD D +FGECR++IIHYYL +DT+EI+EVH+ N+GRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+ + +LGR F +YDCD FT+ +Y   FG  D  P+ +  + P   K E+PPYNG+G +EDS +N    +P+ P+KD +K + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG FL RT+V K     DNP YY P DF +GA+IEVFG RF+I   D YVL +M++N   +  E + ++   +   E   P  E  +     + +     K  D+  ++ ++   LK  +  +  R  E F  Y+KD +G V  E    IC  +N+P D+ ++  L+    +G  GR+N
Sbjct:    6 VHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRR-PTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLR--KEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSCKENLR--ETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGE-GRIN 638          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Mouse
Match: Efhc2 (EF-hand domain (C-terminal) containing 2 [Source:MGI Symbol;Acc:MGI:1921655])

HSP 1 Score: 341.273 bits (874), Expect = 1.261e-106
Identity = 206/563 (36.59%), Postives = 303/563 (53.82%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF-------IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYL-AERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN--------RDDVSPTFPNVVLELTPNEI--------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLE--MPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVD-----NENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFP 1584
             LP LPGNSF R++ K  FH SQ  G+ N  R   S    G+GGD                     L YGQ  +   + F        P  VAFDK+VL F  Y ++ + +   E +R+ + K+Y+YLEDD+IQ+ E    NSG+PQGT +RRQR+P     D   YT  D N   S+  YG+ ++   CD FT+++L+  GI +N P   P DPY+   R   E +  ++   SFD  K+F++ D K+LRF+ +WDD   +FG+ R F++HY+L + T+EI+EV  +N GRD     +RR ++PK                  NV   L+                  +++++ +DL IG TINV GR+ LL DCD FTK +Y   +G  +FTPI    + P +PK+E   PPY GFG+ EDS  + +   P P +K+F K ++     N + +LRY  K+ + +  D DR F++++ L+DD IS++E  + NSG  GG FLKR+RV KPG     ++  EY    +  +GA + + G  FI+  AD Y L++M+ N   FP
Sbjct:    2 ALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGD---------------------LLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISC--KPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFP 541          
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Match: sp|Q5JVL4|EFHC1_HUMAN (EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EFHC1 PE=1 SV=1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 309/622 (49.68%), Postives = 420/622 (67.52%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLL 1884
            + GLP LPG SF+D TKT FH SQTL ++NG+   +  P+VGIGGD L+ NQL+++ELDELA+  P LTYGQ +QAPPA FIP HVAFDKKVL+F  Y++E V  S  E YR+  V +YYYLEDDS+ + E    NSGI QG +++RQR+ KN+ GDHY WKDLN G ++ +YGK +R   CD+FT+ +LES+GI +N PE +  DPY   R  ++ L+ Y TPS FD  KQFL  DK++LRFYA+WDD D M+GECR +IIHYYL +DT+EI+EVH+ NDGRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+++ +LGR F +YDCD FT+ +Y + FG TD   I +  R P   K E+PPYNGFG +EDS +N    +P+ PKKD IK + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG +L RT+V KP  T DNP YYGP DF +GA+IEVFG RFII   D YVL +M++N   +  E + ++  H+   E   P  E  +  +    +   ++  ++  ++ QLK  +  D  R  E F  Y+K+ +G V  +    IC  +N+P D+ ++  L+
Sbjct:    6 VHGLPFLPGTSFKDSTKTAFHRSQTLSYRNGYAIVRR-PTVGIGGDRLQFNQLSQAELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQVNIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKTFRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELR--KQPLRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRTFFIYDCDPFTRRYYKEKFGITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVLRYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVDNPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREAPAPEAESKQTEKDPGVQ---ELEALIDTIQKQLKDHSCKDNIR--EAFQIYDKEASGYVDRDMFFKICESLNVPVDDSLVKELI 619          
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Match: sp|Q9D9T8|EFHC1_MOUSE (EF-hand domain-containing protein 1 OS=Mus musculus OX=10090 GN=Efhc1 PE=1 SV=1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 308/639 (48.20%), Postives = 422/639 (66.04%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICR-----KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLE--EYGSNGRMN 1914
            + GLP LPG+SF D TKT FH SQTL ++NG+   +  P++GIGGD L  NQL+++ELDELAN  P LTYG  +QAP A F+P HVAFDKKVL+F  Y++E V  S  EHYR+ HV +YYYLEDDS+ + E    NSGIPQG +++RQR  KN++GDHY WKDLN G ++ VYGK +R   CD+FT+D+LES+GI +N  E IP DPY   R  +E ++ Y TPS FD  KQFL  DK++LRFYA+WDD D +FGECR++IIHYYL +DT+EI+EVH+ N+GRDPFP+L+ R R+PK   + +  FP  VLE++  E+ E+++ KD  +G+ + +LGR F +YDCD FT+ +Y   FG  D  P+ +  + P   K E+PPYNG+G +EDS +N    +P+ P+KD +K + N+NKVLRY   +ES  PEDKDRRF+ SY LA DMISI+E P RNSG +GG FL RT+V K     DNP YY P DF +GA+IEVFG RF+I   D YVL +M++N   +  E + ++   +   E   P  E  +     + +     K  D+  ++ ++   LK  +  +  R  E F  Y+KD +G V  E    IC  +N+P D+ ++  L+    +G  GR+N
Sbjct:    6 VHGLPFLPGSSFTDSTKTAFHRSQTLNYRNGYAVVRR-PTMGIGGDRLHYNQLSQAELDELANKAPILTYGPLKQAPLAEFVPAHVAFDKKVLKFSAYFQEDVPISMEEHYRIRHVNIYYYLEDDSMSVIEPVVENSGIPQGKLIKRQRFTKNDMGDHYHWKDLNRGINLTVYGKTFRIVDCDRFTQDFLESQGIELNPSEKIPLDPYTQLR--KEPVRKYVTPSDFDQLKQFLTFDKQVLRFYAIWDDTDSLFGECRHYIIHYYLMDDTVEIREVHERNNGRDPFPLLMNRQRMPKVLVENAKNFPKCVLEISDQEVLEWYTAKDFIVGKPLTILGRTFFIYDCDPFTRQFYKDKFGMPDLPPVDVTKKEPPPVKQELPPYNGYGLIEDSAQNCFALIPKAPRKDVVKMLMNDNKVLRYLAALESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKFLGRTKVVKSFSPVDNPIYYSPSDFFIGAVIEVFGHRFVILDTDEYVLKYMESNASQYSPEALASIQNRIQKPELPAPELESKQATGEPMVQGTEESKVQDLDALIDQIHMHLKYNSYKENLR--ETFQMYDKDESGYVDRETFFKICETLNVPVDDSLIKELIRLCTHGE-GRIN 638          
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Match: sp|Q32TF8|EFHC2_DANRE (EF-hand domain-containing family member C2 OS=Danio rerio OX=7955 GN=efhc2 PE=2 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 8.069e-119
Identity = 237/701 (33.81%), Postives = 346/701 (49.36%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF-------IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAH-REALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNR-------------------DDVSPTFPNVVLELTPNEIKE-YFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHK---------------------------------EVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGS 1899
             LPMLPGNS  R++ K  FH SQ   + NG          GIGGD                     L  GQS +A  + F        P  +AFDK+VL F  Y+ E V +   E YRV   K+Y+YLEDD+IQ+ E    NSGIPQGT++RR R+P     D   Y     N    +  Y + +  T CD FTR++L   G+ +N P   P DPY   R    E +K  +     D  KQFLE D+++LRFY  WDD + MFG+ R  I+HY+L++DTME+ EV   N GRD  P  + R ++PK+                      V    P ++  L    ++E ++   DL IG  INV GRR L+ DCD FTK +Y   +G  DF  I      P  P  ++PPY GFG+ EDSL +    +P+PP+KDF K ++ + +     VLR+  KM +  P DK+R FI+ + L DD I+++E P+RNSG +GG FL+R RV KPG     ++  EY+   D  VGA + +    F +  AD +  S+M+ +   FP+  I  + + +  I+EEQ +  K                                 E++  GRV   R+  + ++  M+   +  LK+      + + + F   ++DR G ++ +  + IC+   LP  +D+L  LLE++  
Sbjct:    2 ALPMLPGNSVNRNLGKDKFHKSQHFDYSNGVAMMVGTEKPGIGGD---------------------LLLGQSARAKYSRFPKGEGSGAPAWLAFDKQVLCFDAYFNEAVPQRREEKYRVRKCKIYFYLEDDTIQVVEPEFKNSGIPQGTLIRRHRIPLPAPKDDCFYNVHHFNINQEVLFYSRNFMITDCDPFTRNFLVKMGVRLNPPASTPADPYTTLRQELEENMKPLRPYERLDTLKQFLEHDRQVLRFYCYWDDSESMFGDPRELILHYFLADDTMEMYEVVPPNSGRDTVPKFLHRGKLPKHAPIPKRQPGEITDRTVLNVFGPVGQGGPYILDSLKTGALEEEFYKDSDLTIGAVINVWGRRVLICDCDYFTKEYYRSKYGIEDFPSISYKASPPPKPAKQVPPYTGFGSEEDSLCSCQGLLPKPPQKDFKKLMEKDRRGLVSNVLRFVGKMLTDSPVDKERVFIICFYLTDDTIAVFEPPQRNSGVIGGKFLERGRVKKPGQELFKSEMSEYFTAQDLYVGAHLLLNSQPFQLVDADDFTFSYMEQHADEFPKANIGTIISKVKSISEEQQKTVKQFFTMSDPSSTGSLPYESFRTLLADLDVELSEHEIMTLGRVYSVRQQPEVNVGLMLAVAQDHLKKKNFEKFSEMIQAFTHEDRDRCGQLSSKEARIICKAFRLPLSDDLLRALLEKFAG 681          
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Match: sp|Q32TG3|EFHC2_CHICK (EF-hand domain-containing family member C2 OS=Gallus gallus OX=9031 GN=EFHC2 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 8.020e-107
Identity = 227/692 (32.80%), Postives = 351/692 (50.72%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVP---KNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAH-REALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDD--------VSPTFPNVVLELTPNEIK-------------EYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHKEVIKGGR-----------------------------VTICRKDG-------DIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLL 1884
             LP+LPG S  R+V K  FH SQ  G+ N      +    GIGG+PL   +L    + + + +   L  G           P  +AFDK+VL F  Y++E V +   E YR+ H K+Y+YLEDD+IQ+ E    NSGI QGTI+RR R+P    NE    YT    N    +  Y + Y+   CD+FT+ +L   G  +N P + P+DPY  ER    +++   +     D  KQFLE D  +LRFY VWDD + +F + R  ++HYYLS+DT++IKEV   N GRD  P+ +RRD++PK             S T  NV   L  N  +             E++   DL+IG  INV GR+ +L DCD FTK +Y   +G  DFTP+      P   +  +PPY GFG+ EDSL + ++ +P+PP+KDF K ++      E+  LR+  K+ +  P DKDR+FI+ Y L   + S++E  +RN+G +GG FL++ R+ KPG     ++  EY+   D  +GA +   G  F++  AD Y +++M+ + + F       +   L  IAE + R  ++V                                  +T+ R  G       D   ++ + + QLK+ +  +  ++  + +  ++++ G++  E  + IC+   LP  +D+L  +L
Sbjct:    2 ALPLLPGFSLGRNVGKEKFHKSQHWGYCNNVAMLLAEDKPGIGGEPLPGQKL----IPKSSVFPAELGCGA----------PAWLAFDKQVLSFDAYFEEEVPDKNQEPYRIRHCKIYFYLEDDTIQVLEPQVKNSGIIQGTIVRRHRIPLPSPNE-DQFYTIDHFNINAEVIFYARRYKIIDCDQFTKHFLRKMGFKLNPPGNRPDDPYTKERQKILDSMNPLRPYERIDTLKQFLEHDGHVLRFYCVWDDPESLFHDPRELVLHYYLSDDTIDIKEVIPVNSGRDVVPLFLRRDKLPKYAPTGLYQPGTITSRTVLNVFGNLVGNRGRYILDNRKTGAVHQEFYRDSDLKIGAVINVWGRQIMLCDCDEFTKDYYRTKYGIEDFTPVPYKAPPPPKAEKPIPPYTGFGSEEDSLCSCMSLLPKPPQKDFKKFMEKDRCGLESNTLRFLAKLVTDSPIDKDRKFIICYFLMMPLYSVFEHSQRNTGIIGGKFLEKGRIKKPGQELFKSEPSEYFKAQDLFIGARVCFHGHNFLLVDADEYTINYMEKHANEFAVADTGFIFKKLKDIAEPRSREIRQVFAAADPQHTKVIEYDPFRNLIVSITDGAFSEHEIMTLGRHYGEKEEYEIDHHFLLAKAQEQLKKNSFENFEQLSTILVYNDREKCGALPYETCRTICKSFKLPLSDDLLQTIL 678          
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Match: sp|Q9D485|EFHC2_MOUSE (EF-hand domain-containing family member C2 OS=Mus musculus OX=10090 GN=Efhc2 PE=2 SV=2)

HSP 1 Score: 341.273 bits (874), Expect = 8.821e-106
Identity = 206/563 (36.59%), Postives = 303/563 (53.82%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAF-------IPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYL-AERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN--------RDDVSPTFPNVVLELTPNEI--------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLE--MPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVD-----NENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFP 1584
             LP LPGNSF R++ K  FH SQ  G+ N  R   S    G+GGD                     L YGQ  +   + F        P  VAFDK+VL F  Y ++ + +   E +R+ + K+Y+YLEDD+IQ+ E    NSG+PQGT +RRQR+P     D   YT  D N   S+  YG+ ++   CD FT+++L+  GI +N P   P DPY+   R   E +  ++   SFD  K+F++ D K+LRF+ +WDD   +FG+ R F++HY+L + T+EI+EV  +N GRD     +RR ++PK                  NV   L+                  +++++ +DL IG TINV GR+ LL DCD FTK +Y   +G  +FTPI    + P +PK+E   PPY GFG+ EDS  + +   P P +K+F K ++     N + +LRY  K+ + +  D DR F++++ L+DD IS++E  + NSG  GG FLKR+RV KPG     ++  EY    +  +GA + + G  FI+  AD Y L++M+ N   FP
Sbjct:    2 ALPFLPGNSFNRNIGKERFHKSQHWGFCNNVRMLVSENKPGVGGD---------------------LLYGQKIKPKHSVFPKGDGTDAPSWVAFDKQVLSFDAYLEDEISDKRQEIFRIRYYKIYFYLEDDTIQVNEPEVINSGLPQGTSIRRQRIPYPPPNDDQFYTVYDFNINISVVFYGRTFKIYDCDPFTKNFLKKIGIKLNPPGQCPLDPYMKMRRETLEFVDPFRPYQSFDTLKRFIQYDGKVLRFFCLWDDSTSLFGDRREFVLHYFLCDGTVEIREVLPSNSGRDAMSSFLRRGKLPKYGPPGIYQPGQITDRAVLNVYGGLSEWRADGYLLDKYQLGKVEQDFYTDQDLSIGATINVWGRKVLLCDCDEFTKTYYRTKYGVDNFTPISC--KPPHLPKIERKYPPYTGFGSEEDSFRSCVGLKPTPHRKNFKKFMELDSFGNISNILRYFGKLITHKCADVDRIFVIAFYLSDDTISVFEPIENNSGNAGGMFLKRSRVKKPGQEVFKSEFSEYIKAEELYIGATVNINGYLFILLNADEYTLNYMENNTDKFP 541          
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|21466389 (tr|A0A074ZNU6|A0A074ZNU6_9TREM Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_04467 PE=4 SV=1)

HSP 1 Score: 867.455 bits (2240), Expect = 0.000e+0
Identity = 407/643 (63.30%), Postives = 514/643 (79.94%), Query Frame = 1
Query:    4 EKNLNMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVI-----KGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            E+N ++EGLP LPGN+FRD T+TNFH+S TL +KNGFR PK YP VGIGG PLKVNQLTESELD+LAN+QPTLTYG +RQAPP  F+P HVA DKKVLRF+GY+KETV ESPLEHYRV +V+++Y+LEDDSIQI E  +NNSGIPQG ++RR R+PKN++GD Y W+DLN G ++ +YG+VYR T+CDKFT D+LESEG+ VN PE  P DPYL  RA REAL   KTPSSFD R+Q LE+D+K+LRFYA+WDDR+E FG+CR F I YYL++DT+E+ EVH+ NDGRDPFP+L+RR R+PK+RDDV PTFP+V +ELT NEIKEYFSPKD RIG T+N+LGR+F +YDCD+FTKAWYYQ+FG TDFTP+ ++ + P  P+ E+PPYNGFG+LEDSL ++ +F+P+PPK DF K VD  NK+LRYE +++S RPED  RRFI  YRL DDMISIYE P RNSGF GG+FL+  RVAKPG + D P YYGP DF +G+ IEVFG+RFIIT AD++V+ F++AN+  F  E+I      +  +E+     +V      KGG V I R DGD+  +  E++TQLK++AITD++RIDEMFL YNKDR G + +EN++DIC+K+ LP DED+L  LL+EYG++GRM L
Sbjct:    3 EQNKSLEGLPFLPGNTFRDPTQTNFHLSHTLSYKNGFRVPKPYPEVGIGGKPLKVNQLTESELDDLANFQPTLTYGNTRQAPPTEFLPAHVALDKKVLRFYGYFKETVNESPLEHYRVRYVQIFYFLEDDSIQIMEPHQNNSGIPQGKLVRRHRIPKNDMGDPYNWRDLNLGVNLAIYGRVYRITNCDKFTHDFLESEGVEVNPPEPEPVDPYLDNRARREALGVSKTPSSFDKRRQHLELDRKVLRFYAIWDDREEQFGDCRKFTIQYYLADDTLEVVEVHEVNDGRDPFPLLLRRSRVPKDRDDVPPTFPSVSMELTENEIKEYFSPKDFRIGHTVNILGRKFFIYDCDSFTKAWYYQNFGLTDFTPVDVEIKRPPPPRKEIPPYNGFGSLEDSLSSTKSFVPRPPKTDFAKNVDYANKILRYEARLDSSRPEDACRRFIFKYRLCDDMISIYETPLRNSGFPGGTFLRGARVAKPGSSVDMPVYYGPADFSLGSKIEVFGSRFIITDADSFVIKFLEANRDQFSDELIQCWRARMTEKEEQERAIQVAKQRQRKGGPVEIRRHDGDVLGLANEIKTQLKKLAITDRSRIDEMFLYYNKDRLGFIDIENLKDICKKLQLPPDEDVLDALLDEYGTDGRMTL 645          
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|22914705 (tr|A0A4S2LL15|A0A4S2LL15_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006425 PE=4 SV=1)

HSP 1 Score: 862.448 bits (2227), Expect = 0.000e+0
Identity = 403/643 (62.67%), Postives = 513/643 (79.78%), Query Frame = 1
Query:    4 EKNLNMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVI-----KGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            E+N ++EGLP LPGN+FRD T+TNFH+S TL +KNGFR PK YP VGIGG PLKVNQLTE+ELD+LAN+QPTLTYG +RQAPP  F+P HVA DKKVLRF+GY+KETV ESPLEHYRV +V+++Y+LEDDSIQI E  +NNSGIPQG ++RR R+PKN++GD Y W+DLN G ++ +YG+VYR T+CDKFT D+LESEG+ VN PE  P DPYL  RA REAL   +TPSSFD R+Q LE+D+K+LRF+A+WDDR+E+FG+CR F I YYL++DT+E+ EVH+ NDGRDPFP+L+RR R+PK+RDDV PTFP+V +ELT NEIKEYFSPKD RIG T+N+LGR+F +YDCD+FTKAWYYQ+FG TDFTP+ ++ + P  P+ E+PPYNGFG+LEDSL ++ +F+P+PP+ DF K VD  NKVLRYE +++S RPED  RRFI  YRL DDMISIYE P RNSGF GG+FL   RVAKPG + D P YYGP DF +G+ IEVFG+RFIIT AD +V+ F++AN+  F  E+I      +  +E+     +V      KGG V + R DGD+  +  E++TQLK++AITD+ RIDEMFL YNKDR G + +EN++DIC+K+ LP DED+L  LL+EYG++GRM+L
Sbjct:    3 EQNKSLEGLPFLPGNTFRDPTQTNFHLSHTLSYKNGFRVPKPYPEVGIGGKPLKVNQLTEAELDDLANFQPTLTYGNTRQAPPTEFVPAHVALDKKVLRFYGYFKETVNESPLEHYRVRYVQIFYFLEDDSIQIMEPHQNNSGIPQGKLVRRHRIPKNDMGDPYNWRDLNLGVNLAIYGRVYRITNCDKFTHDFLESEGVEVNPPEPEPVDPYLDNRAKREALGVSRTPSSFDKRRQHLELDRKVLRFHAIWDDREELFGDCRKFTIQYYLADDTLEVVEVHEINDGRDPFPLLLRRSRVPKDRDDVPPTFPSVSMELTENEIKEYFSPKDFRIGHTVNILGRKFFIYDCDSFTKAWYYQNFGLTDFTPVDVEIKRPPPPRKEIPPYNGFGSLEDSLSSTKSFVPRPPRTDFAKHVDYANKVLRYEARLDSSRPEDACRRFIFKYRLCDDMISIYETPLRNSGFPGGTFLSGARVAKPGSSVDMPVYYGPADFSLGSKIEVFGSRFIITDADPFVIKFLEANRDQFSDELIQCWRARMTEKEEHERAIQVAKQRQRKGGPVEVRRHDGDVLGLANEIKTQLKKLAITDRTRIDEMFLYYNKDRLGYIDIENLKDICKKLQLPPDEDVLDALLDEYGTDGRMSL 645          
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|22843733 (tr|A0A3Q0KR57|A0A3Q0KR57_SCHMA Putative ef-hand domain (C-terminal) containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 393/638 (61.60%), Postives = 514/638 (80.56%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEE-----QMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            MEGLP LPGN+F+D T+TNFH+S TL  KNGFR  K+YP VGIGG PLKVNQL E ELDELAN+QPTLTYG+++Q+  + FIP HVA   KVLRF+GY+KETV ES +EHYRV  V++ Y+LEDDS+ + E  +NNSGIPQG ++ R R+PKN++GD Y W+DLN GT++ +YG+VYR T+CDKFT+D+LESEG+VVN PE  P DPYLAERA REA+   KTPSSFD R+Q+LE+D+K+LRFYAV D+R EMFGECR FIIHYYL++DT+EI+E+H  NDGRDPFP+L+RR+RIPK RD +  +FP++ +E+T NE+KEYFSPKD  IGQ++N+LGR++L+YDCDNFTKAWY+ +FG T+FTP+ I+ + PE+PK E+PPYNG+GT+EDSL ++ +F+ +PPK DF KQVD   KVLRYE +++S RPED  RRFI+SY LADDMISI+E P RNSGF GG+FLKR+RV KPG T DNP YYGP+DF + + I++FGTRFIIT  D YV+ F ++N   FP E++NNL  HL  +E     + + H ++ KGG +   R+DGDI  +M E+R QLK+M+ITDK RID+MFL+YNKDR G + +EN++D+C+K+++P DED+L  LL++YGS G+M+L
Sbjct:    1 MEGLPFLPGNAFKDPTQTNFHLSHTLDMKNGFRYAKAYPEVGIGGRPLKVNQLNEEELDELANFQPTLTYGRTKQSLVSEFIPAHVALHNKVLRFYGYFKETVIESQVEHYRVRLVQILYFLEDDSMLVMEPSQNNSGIPQGKLVCRHRIPKNDIGDFYNWRDLNLGTNLAIYGRVYRITNCDKFTKDFLESEGVVVNEPEQEPIDPYLAERAKREAIALGKTPSSFDKRRQYLELDRKVLRFYAVQDERHEMFGECRKFIIHYYLADDTLEIREIHTVNDGRDPFPLLLRRERIPKCRDTIPQSFPSISMEITENEVKEYFSPKDFHIGQSVNILGRKYLIYDCDNFTKAWYHNNFGLTEFTPLDIEIKQPELPKKEIPPYNGYGTIEDSLVSTKSFILKPPKVDFAKQVDYAQKVLRYEARLDSFRPEDASRRFIISYHLADDMISIFETPIRNSGFPGGTFLKRSRVIKPGSTLDNPIYYGPIDFSINSKIDIFGTRFIITDVDEYVIKFFESNHEQFPDELLNNLREHLNDKENQTIVKQQSHYKLNKGGNIDFKREDGDINDVMNEVRVQLKKMSITDKCRIDDMFLKYNKDRRGCIDIENLKDMCKKIHIPPDEDVLKELLDKYGSEGKMSL 638          
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18789535 (tr|A0A0X3P4B5|A0A0X3P4B5_SCHSO EF-hand domain-containing protein 1 OS=Schistocephalus solidus OX=70667 GN=EFHC1 PE=4 SV=1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 406/638 (63.64%), Postives = 504/638 (79.00%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLI-----AEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            MEGLP LPGNSF+D TKTNFH+SQTL +KNG+R P  YP VGIGGDPLKVN L++++LD LAN+ PTLTYG+++QAPPA FIPGHVAFDKKVLRF+GY+KETV ESP EHYRV HV +YYYLEDDS+ I E P NNSG+PQGT+LRRQRVPKN+VGDHY WK+LN G ++ VYG+VYR  +CD+FT+++ ESEG+ +N PE  PEDPYLA+RA REA+    TPSSFD R+Q LE+D+++LRF+AVWDDRDEMFGE R F+IHYYL +DT+E++E H+ NDGRDPF VL+RR++IPK+RD V PTFP+V LELT +EIKEYF+PKDLRIG TI + GR FL+YDCDNFTKAWYYQ+FG T+F P+ +D    EI K+E+P YNG+GTLEDSL +S TFMP+PPK DF KQVD   KVLRYE K++S+RP+D  RRFILSYRLADDMISIYE   RN+GF GG FL+R+RVAKPG TA+ P YYGP DF +GAII+VFGTRF+IT AD YV+ FM  N+  F  ++I  L   ++      EE  +  +   K G   I R  GD+ +M++EL  Q  +MA+TD +RID MFL+YNKDR   V L N++D+C+K+ LP DED+L   L+++G  GRM L
Sbjct:    1 MEGLPFLPGNSFKDPTKTNFHLSQTLHYKNGYRVPLPYPQVGIGGDPLKVNMLSDADLDVLANFHPTLTYGRTKQAPPAEFIPGHVAFDKKVLRFYGYFKETVTESPDEHYRVRHVIIYYYLEDDSMCIYEPPLNNSGLPQGTLLRRQRVPKNDVGDHYIWKELNIGQNLTVYGRVYRIINCDEFTKNFFESEGLELNEPEKAPEDPYLAKRAVREAITLNTTPSSFDKRRQHLELDRQVLRFFAVWDDRDEMFGELRKFVIHYYLMDDTLEVREKHERNDGRDPFSVLIRREKIPKDRDAVPPTFPSVCLELTEHEIKEYFTPKDLRIGNTIVIFGRAFLIYDCDNFTKAWYYQNFGLTEFKPVPVDPPKKEITKMELPFYNGYGTLEDSLASSKTFMPKPPKVDFEKQVDYSAKVLRYEVKLDSVRPDDALRRFILSYRLADDMISIYEVGLRNTGFPGGYFLRRSRVAKPGSTAEQPRYYGPADFELGAIIDVFGTRFVITDADEYVIKFMDVNRDQFEDKLIEGLRAKVVDQLMHNEEVKKTQRSSRKCGPADIQRTAGDLDKMVEELEVQFGKMALTDSSRIDGMFLKYNKDRLTYVDLINLKDMCKKLQLPGDEDVLNAFLDKHGCEGRMTL 638          
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15793202 (tr|A0A1I8HKJ3|A0A1I8HKJ3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016896g1 PE=4 SV=1)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 385/633 (60.82%), Postives = 506/633 (79.94%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            MEGLP LPGN+F+D TKT  HVSQ+LG+KNG++ PK+YP+VGIGG PL VNQLTESELDELAN+QPTLTYG+++QAPP AF+P HVAFDKKVLRF+GY+KETV ESP E+YRV  V  YYYLEDDSI I E P+ NSGIPQG  ++RQRVPKN+VGDHYTWKD+N   ++ VYG+V+R T CD+FTR +LESEG+ VN PE IP DPYL  R+   ALKTYKTP++FD  KQF+E+D+K+LRF+A+WDD   M+GE R FIIHYYL +DT+EI+EVH TNDGRDPFPVL+RR R+PK+R ++  TFP+V LEL+  E+K+YF+P+D  IG+T+ + GRRF+LYDCDNFTKAWYYQHFG T+F  I +  + P +  +E+PPYN FG+LEDS++N ++ +P+PPKKDF+K ++     LRYE  M+SIRPEDK+RRFI+SYRLADDM++IYE P RNSG  GG++LKR RVAKP  T + P+YYGP DF +GA I +FG RF+IT  DA+VL +M+ +   FP  +++++   L +E + R +++ ++GG   + R +GD+F+++ E+++QLKR+ ITDKARIDEMFL+YN DR G + +  +QD+C+KM LP DEDI A ++ E+GS+GRM+L
Sbjct:    1 MEGLPFLPGNTFKDPTKTKHHVSQSLGYKNGYQVPKAYPTVGIGGQPLPVNQLTESELDELANFQPTLTYGKAKQAPPEAFVPAHVAFDKKVLRFYGYFKETVHESPQEYYRVRPVVFYYYLEDDSIAIVEPPKENSGIPQGKFIKRQRVPKNDVGDHYTWKDINLSQNVSVYGRVFRITDCDQFTRSFLESEGVEVNQPESIPADPYLVSRSEATALKTYKTPTAFDKLKQFIELDRKVLRFFALWDDTASMYGEARPFIIHYYLVDDTLEIREVHQTNDGRDPFPVLIRRGRVPKDRFNLPNTFPSVALELSDAEVKDYFTPRDFVIGETVVINGRRFVLYDCDNFTKAWYYQHFGVTEFNCIDVSKKFPGLASMEIPPYNKFGSLEDSMQNVVSIVPEPPKKDFVKMMEQGTTQLRYEAMMDSIRPEDKNRRFIISYRLADDMVNIYETPTRNSGIPGGNYLKRARVAKPNSTPEKPQYYGPADFGIGAKINIFGQRFVITNCDAFVLKYMEQHPAQFPSAVVDSVRAKL-SENESR-NQDAMRGGMSNLRRTEGDLFRLVSEVKSQLKRLGITDKARIDEMFLKYNTDRLGYIDVSKLQDLCKKMILPYDEDICAAIVNEFGSDGRMDL 631          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:103021369])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 263/542 (48.52%), Postives = 375/542 (69.19%), Query Frame = 1
Query:   25 GLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQ--ANQHYFPREMINNLTTHLIAEEQMRPH 1644
            GLP LPGNSFRD TK+ FH  QTL +KNG+  P   P+ GIG DPL    + ++E+ +L++  PTLTYG   ++PP  FIP  VA+DKKVLRF+GYYKE V  SP EH+ V  V +YYYLEDDSI + +    N+   +   ++R R+PKN+ G+HY WKD N    M VY  VYR T+CD FT++++ES+GIV+N PE IP DP+ + +   +      T  ++D  KQFL MD+K+LRF+AVWDD D ++GE    I+HYYL +D++EI+ V ++N GRD  PVL+ R +IPK+  +V   FP+ VLE++P +++E++SPK+ R+G+ + ++G+RFLLYDCD FT+ +Y QH       P+ +  +  E  K  +PPYNGFG+LEDSL+N L+ +P+PPKKD +K ++N++KVLRY  K++S  P D+ R FILSY L++DMISI+E  +RN G LGG FL++TR+ KP  T +NPEYYGP DF +GA +EVF  RF++T AD YVL++++  A Q   P + +++L   L   + + P+
Sbjct:   72 GLPFLPGNSFRDTTKSAFHRPQTLSYKNGYALPLR-PTAGIGQDPLLSENILQNEMKQLSSQIPTLTYGTPTRSPPRDFIPAFVAYDKKVLRFYGYYKEEVLHSPNEHFYVQPVVIYYYLEDDSICVMKPKLKNTNEKEIKQIKRHRLPKNQPGEHYHWKDFNLAMDMIVYNTVYRITNCDPFTQEFMESQGIVLNDPEQIPGDPHSSRQTQPQLPDISST--NYDRFKQFLTMDRKVLRFFAVWDDSDSLYGEKLEVIVHYYLVDDSVEIRIVQESNSGRDTVPVLLHRQKIPKDIKEVCQPFPSCVLEVSPQDVQEFYSPKNFRVGEELRLMGKRFLLYDCDEFTRKYYEQHHPDIPLKPLPVQQKAQEDCKKVIPPYNGFGSLEDSLQNCLSLIPKPPKKDLLKLLENDHKVLRYAAKLDSQNPNDEGRHFILSYYLSNDMISIFERSRRNFGILGGKFLEKTRIPKPSSTVENPEYYGPADFAIGATVEVFRHRFVLTDADQYVLTYLESMAEQEQIPEKTLSSLRQALGQSKALDPN 610          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:103021369])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 263/542 (48.52%), Postives = 375/542 (69.19%), Query Frame = 1
Query:   25 GLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQ--ANQHYFPREMINNLTTHLIAEEQMRPH 1644
            GLP LPGNSFRD TK+ FH  QTL +KNG+  P   P+ GIG DPL    + ++E+ +L++  PTLTYG   ++PP  FIP  VA+DKKVLRF+GYYKE V  SP EH+ V  V +YYYLEDDSI + +    N+   +   ++R R+PKN+ G+HY WKD N    M VY  VYR T+CD FT++++ES+GIV+N PE IP DP+ + +   +      T  ++D  KQFL MD+K+LRF+AVWDD D ++GE    I+HYYL +D++EI+ V ++N GRD  PVL+ R +IPK+  +V   FP+ VLE++P +++E++SPK+ R+G+ + ++G+RFLLYDCD FT+ +Y QH       P+ +  +  E  K  +PPYNGFG+LEDSL+N L+ +P+PPKKD +K ++N++KVLRY  K++S  P D+ R FILSY L++DMISI+E  +RN G LGG FL++TR+ KP  T +NPEYYGP DF +GA +EVF  RF++T AD YVL++++  A Q   P + +++L   L   + + P+
Sbjct:   72 GLPFLPGNSFRDTTKSAFHRPQTLSYKNGYALPLR-PTAGIGQDPLLSENILQNEMKQLSSQIPTLTYGTPTRSPPRDFIPAFVAYDKKVLRFYGYYKEEVLHSPNEHFYVQPVVIYYYLEDDSICVMKPKLKNTNEKEIKQIKRHRLPKNQPGEHYHWKDFNLAMDMIVYNTVYRITNCDPFTQEFMESQGIVLNDPEQIPGDPHSSRQTQPQLPDISST--NYDRFKQFLTMDRKVLRFFAVWDDSDSLYGEKLEVIVHYYLVDDSVEIRIVQESNSGRDTVPVLLHRQKIPKDIKEVCQPFPSCVLEVSPQDVQEFYSPKNFRVGEELRLMGKRFLLYDCDEFTRKYYEQHHPDIPLKPLPVQQKAQEDCKKVIPPYNGFGSLEDSLQNCLSLIPKPPKKDLLKLLENDHKVLRYAAKLDSQNPNDEGRHFILSYYLSNDMISIFERSRRNFGILGGKFLEKTRIPKPSSTVENPEYYGPADFAIGATVEVFRHRFVLTDADQYVLTYLESMAEQEQIPEKTLSSLRQALGQSKALDPN 610          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 348.591 bits (893), Expect = 1.756e-109
Identity = 228/683 (33.38%), Postives = 336/683 (49.19%), Query Frame = 1
Query:   28 LPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHRE-ALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI------------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTT--------------HLIAEE----------------------QMRPHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLP 1854
            LP+LPGNS  R++ K  FH SQ   +  G          GIGG+PL         L + A  Q +L   +    P        +AFDK+VL F  Y++E V +S  E YRV   K+YYYLE+D+IQ+ E    NSG+  GT++ R R+P     D   Y  +  N    +  Y + Y  T CD FTR++L   G+ +N     P DPY   R   E ++K  +     D  KQFLE D  +LRFY  W+D + MFG+ R  I+HY+L++DT+EI+EV   N GRD  P  + R +IPKN    +PT  +   E+T   +                        +E++   DL IG  INV GR  L+ DCDNFTK +Y   +G  DFTP++    +P  P  EMPPY GFG+ EDSL +    +P+ P+KDF K ++      E+ VLR+  K+ +    + +R FI+S+ L DD I+++E  +RN+G LGG FL+R+RV KPG     ++  E Y   D  VGA + +    F +  AD Y  ++M+ +   FPR  I  + +              H +A                        Q+  H E+I  GR    R+  + ++  M+   +  LK+    +   +   F   ++DRTG ++ +  + IC+   LP
Sbjct:    3 LPLLPGNSLNRNLGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPL---------LGQTAKPQYSLFPKEQGSGP------SWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKN----APTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLADTGCQLSEH-EIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLP 665          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 339.732 bits (870), Expect = 4.650e-106
Identity = 227/700 (32.43%), Postives = 335/700 (47.86%), Query Frame = 1
Query:   28 LPMLPGNSFR------------------DVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHRE-ALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI------------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTT--------------HLIAEE----------------------QMRPHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLP 1854
            LP+LPGNS                    ++ K  FH SQ   +  G          GIGG+PL         L + A  Q +L   +    P        +AFDK+VL F  Y++E V +S  E YRV   K+YYYLE+D+IQ+ E    NSG+  GT++ R R+P     D   Y  +  N    +  Y + Y  T CD FTR++L   G+ +N     P DPY   R   E ++K  +     D  KQFLE D  +LRFY  W+D + MFG+ R  I+HY+L++DT+EI+EV   N GRD  P  + R +IPKN    +PT  +   E+T   +                        +E++   DL IG  INV GR  L+ DCDNFTK +Y   +G  DFTP++    +P  P  EMPPY GFG+ EDSL +    +P+ P+KDF K ++      E+ VLR+  K+ +    + +R FI+S+ L DD I+++E  +RN+G LGG FL+R+RV KPG     ++  E Y   D  VGA + +    F +  AD Y  ++M+ +   FPR  I  + +              H +A                        Q+  H E+I  GR    R+  + ++  M+   +  LK+    +   +   F   ++DRTG ++ +  + IC+   LP
Sbjct:    3 LPLLPGNSLNRNPCLLVSLEYCSTSYYCELGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPL---------LGQTAKPQYSLFPKEQGSGP------SWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKN----APTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLADTGCQLSEH-EIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLP 682          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:103033063])

HSP 1 Score: 339.732 bits (870), Expect = 5.073e-106
Identity = 227/700 (32.43%), Postives = 335/700 (47.86%), Query Frame = 1
Query:   28 LPMLPGNSFR------------------DVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHRE-ALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEI------------------------KEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTT--------------HLIAEE----------------------QMRPHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLP 1854
            LP+LPGNS                    ++ K  FH SQ   +  G          GIGG+PL         L + A  Q +L   +    P        +AFDK+VL F  Y++E V +S  E YRV   K+YYYLE+D+IQ+ E    NSG+  GT++ R R+P     D   Y  +  N    +  Y + Y  T CD FTR++L   G+ +N     P DPY   R   E ++K  +     D  KQFLE D  +LRFY  W+D + MFG+ R  I+HY+L++DT+EI+EV   N GRD  P  + R +IPKN    +PT  +   E+T   +                        +E++   DL IG  INV GR  L+ DCDNFTK +Y   +G  DFTP++    +P  P  EMPPY GFG+ EDSL +    +P+ P+KDF K ++      E+ VLR+  K+ +    + +R FI+S+ L DD I+++E  +RN+G LGG FL+R+RV KPG     ++  E Y   D  VGA + +    F +  AD Y  ++M+ +   FPR  I  + +              H +A                        Q+  H E+I  GR    R+  + ++  M+   +  LK+    +   +   F   ++DRTG ++ +  + IC+   LP
Sbjct:    3 LPLLPGNSLNRNPCLLVSLEYCSTSYYCELGKEKFHKSQHFEYSKGIPLMVGAKKPGIGGEPL---------LGQTAKPQYSLFPKEQGSGP------SWLAFDKQVLCFDAYFQEPVTQSREETYRVRKCKIYYYLENDTIQVVEPIIKNSGMQHGTLICRHRIPLPAPNDDQFYNIQHFNINQEIEFYSRTYMITDCDPFTRNFLRKMGVRINSSATAPADPYTTLRQELEDSMKPRRPYERQDTLKQFLEHDHNVLRFYCYWNDTESMFGDPRELILHYFLADDTIEIREVLYPNSGRDTAPKFLNRSKIPKN----APTPTHQPGEVTGRTVLNVIGPVGQGSRYILDRLNTGAVEEEFYKDSDLTIGGVINVWGRSVLICDCDNFTKEYYRSKYGIEDFTPVQYKVPLPPKPAREMPPYTGFGSEEDSLCSCQGLIPKAPQKDFRKLMEKDRQGLESNVLRFVAKILTNNAVNNERTFIISFYLGDDTIAMFEPTQRNTGVLGGKFLERSRVKKPGQELYKSEMSECYMAQDLYVGARLCISNQLFQLVDADEYAFNYMEQHAEEFPRANIGIILSKLKSIHAEKQKEIKHFLANSDPGNTGLVPYESFRSLLADTGCQLSEH-EIITLGRTYSLREQPEPNVGFMLAVAQDHLKKKLFDNFPDLLRAFTHEDRDRTGHLSAKEARTICKAFRLP 682          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: efhc1 (EF-hand domain (C-terminal) containing 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1300])

HSP 1 Score: 509.22 bits (1310), Expect = 2.972e-175
Identity = 261/542 (48.15%), Postives = 359/542 (66.24%), Query Frame = 1
Query:   10 NLNMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGD-----PLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPY--LAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN--RDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIP-KLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNL 1605
            +L+   LP LPGNSFRD  K  FH  QTL ++NG+  P+   S G+G +     P +V Q + +EL+E+A  Q  LTYG  R  PP  F+P HV +DKKVLRF  Y+K+   E   E   +  V +YYYLEDDS+ + E P  NSG+ QG +++RQ++PKN  G  + WKDLN  TS+ +YGK +   +CD+FT D+LESEGI++N PE +P +P   +   A    ++T     + D   QFL MD+K+LRFY VWDD++   GE R  ++ YYL +DT+E++EVH  NDGRDPFPVL+RR RIPK    + V  TFP+ VLEL+  E+  + SPKDL +G+ + V+GRRFLLYD D FTK +Y ++   +D TP++   + P      E+PPYNG G+LEDSL+N LT +PQPPKKD +K ++N  KVLRYE  ++S+R  ++ RRFI+SY L+ D +SIYE P RNSG +GG  L++TR++KPG + ++PEYYGP DF +GA I  FG R+IIT AD YVL F++ N    P+  +   
Sbjct:    2 SLSTPELPFLPGNSFRDPAKPRFHRLQTLDYRNGYAQPR-VASAGVGAEAPQWGPTQV-QPSLAELEEMATQQALLTYGPPRTPPPPPFVPAHVIWDKKVLRFDAYFKQNADEYSDEDGFIRPVIIYYYLEDDSMVVMEPPVENSGLTQGKLMKRQQMPKNNEGHTWHWKDLNVATSITMYGKTFHIINCDRFTADFLESEGILLNEPEAMPSNPRQEMPPPASAAPMQT-----ALDKLGQFLTMDRKVLRFYCVWDDKES--GEVRPVVLQYYLVDDTLEVREVHQPNDGRDPFPVLLRRQRIPKVWLLNTVRATFPSCVLELSDQEVSGWLSPKDLVLGKEVEVMGRRFLLYDADRFTKDFYQKYLKMSDVTPVEPPQQYPTYSITREIPPYNGLGSLEDSLQNCLTLVPQPPKKDVVKMLENNGKVLRYEAVLDSVRAVERGRRFIISYYLSTDTVSIYEPPVRNSGIVGGKVLEKTRISKPGTSTESPEYYGPADFAIGATIHAFGHRYIITDADKYVLKFLEENAAMIPQATLKTF 534          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO33757 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR82])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 304/527 (57.69%), Postives = 403/527 (76.47%), Query Frame = 1
Query:   25 GLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNL 1605
             LP LPGNSF D TKT +H  QTLGW+NG+  P + P +GIGGDP+ VN+LT+ ELDELAN +P+LTYGQ  QAPP  F+P HVAFDKKVL F GY+K+TV ES  E++RV  VK+YYYLEDDSI + E    NSGIPQG +++RQR+PKN++GD++ WKDLN G ++  YGKV+    CD +TR+Y+ SEGI +N PE I +DPY   R  ++ L +Y TPS+FD  KQF+E+D+K+LRFY VWDDRD MFGE R  I+HYYL +DT+EI+EVH  NDGRDPFPVLV R ++ K+R DV  +FP+VVLEL+ +EIKE+F P+D  +G+T++++GRRFLLYDCD +TK +Y  +FG T+F  + +     E+ +   PPYNGFG+LEDSL++ L+ +PQPPKKDFIK ++N++KVLRY   MES+RPEDK+RRFI+SYRLADDM++IYE P RN+G +GG FL+RTR  KPG + DNP +Y P DF + +II++F  RF IT AD YVL  ++++  ++P E IN++
Sbjct:    2 ALPFLPGNSFTDPTKTKYHRPQTLGWRNGYSLP-TQPIIGIGGDPVPVNKLTQEELDELANIKPSLTYGQKVQAPPEDFVPAHVAFDKKVLLFHGYFKQTVHESSNEYFRVRPVKIYYYLEDDSIAVVEPVVENSGIPQGKLIKRQRLPKNDLGDYWHWKDLNLGINVTFYGKVFFICDCDAWTREYMASEGIDLNPPESIAKDPYNESR--QQPLHSYTTPSTFDKLKQFIELDRKVLRFYCVWDDRDSMFGEMRPCILHYYLVDDTVEIREVHTPNDGRDPFPVLVCRQKLAKDRTDVESSFPSVVLELSDHEIKEWFRPRDFMVGRTLHIMGRRFLLYDCDQYTKDFYRTNFGVTEFPAVDVKGAPRELLEKVTPPYNGFGSLEDSLQSCLSLVPQPPKKDFIKMLENDHKVLRYAASMESVRPEDKNRRFIISYRLADDMLTIYEPPVRNAGIIGGKFLERTRAKKPGSSVDNPNFYNPADFKIDSIIQIFKHRFRITDADEYVLKHLESHAGHYPIETINSI 525          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO32661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUE4])

HSP 1 Score: 400.979 bits (1029), Expect = 3.497e-130
Identity = 241/702 (34.33%), Postives = 364/702 (51.85%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGD--HYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHR-EALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSP------------------------KDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDN-----ENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--IAEEQMRPHKEVIK------GGRV----------------------TICR-------KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLL--EEYGSNGRMN 1914
             LP LPG  F R + KT FH +    ++N   +       GIGGDPL   +L           +P  ++        A   P  VAFD++VL F  Y++E V E   E YR+   K+Y++LEDDSIQ+ E   +NSGIPQGT++RR R+P     D   YT +  N G  + +Y ++++ T CD FT ++L   G+ VN P +IP+DPY   R    E+++  +     D  KQFL+ D+++LRFY +WDD D MFG+ R  I+HY+L++DT+EI+EV   N GRD  P+ +RR R+PK      PT      E+T   +   F P                         DL IG  +N+ GR+F + DCD+FTKA+Y   +G   F PIK        P  E+PPYNGFG+ EDSL + L+ +P+PPK+DFIK ++      E+ VLR+  ++ + RP D DRRFI+SY L+DD I ++E P+RNSG LGG FL+R  + KP   +     Y   D  +GA ++ F   F++  AD Y + +M+ + + FP+  IN +   L  IA+E+    K +         G+V                      T+ R        D D+  ++  ++ QL++    D   + E     +   TG +  +++ ++CR+ N+P   ++L  +L   E  + G +N
Sbjct:    2 ALPFLPGQVFDRKLGKTKFHKTHQFDYRNDVSSYVGEAKCGIGGDPLPGQKL-----------KPRHSHYPKGVGAEA---PAWVAFDRQVLCFDAYFQEAVHEKREEQYRIRKCKIYFHLEDDSIQVNEPKVDNSGIPQGTLIRRHRIPLPPPNDDQFYTVEHFNIGKEIALYSRIFKVTGCDDFTHNFLRKLGVRVNRPSEIPKDPYTDHRKQMVESMQPLRPYEKEDTLKQFLQHDRRVLRFYCLWDDTDNMFGDAREMILHYFLADDTVEIREVIPPNSGRDAAPMFLRRQRLPK-----EPTSLRQPGEITGRTVLNVFGPMGHGGRWILDSLKTGAVYTDYYHDSDLTIGSVLNIWGRKFQVCDCDDFTKAYYKSKYGIDSFEPIKYRAPPAMFPPREVPPYNGFGSEEDSLCSCLSLIPKPPKRDFIKFMEKDRHGLESNVLRFVGRLNTTRPIDMDRRFIISYFLSDDTILVFEPPQRNSGILGGKFLERGSIKKPNAMSS----YVAQDLFIGATVQFFKHEFVLIDADEYAVEYMEKHSNEFPQANINYILPKLKNIADEKYEELKAIFAENDADNSGKVSFSAFWTVLHRFGQFLSEHEMLTVSRYFADAKAVDDDLQMVIAAVQEQLRKANFEDFIAMKEACQYEDMHGTGFLEAKDIHNLCRRFNIPAKSELLDEILARAERNAEGLVN 680          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: efhc1 (EF-hand domain containing 1 [Source:NCBI gene;Acc:101173758])

HSP 1 Score: 382.104 bits (980), Expect = 5.141e-125
Identity = 228/560 (40.71%), Postives = 326/560 (58.21%), Query Frame = 1
Query:   16 NMEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQL--TESELDELANWQPTL-TYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRI--PEIPKLEMPPYNGFGTLEDSLENSLTFMPQ--PPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVT 1674
            N  GLP LPG SF D TK+ FH  QTL +KNG+   +   S+GIG +     QL  T   L +L+   P    YG S +     F P +VA DKKVL F  ++KE    S  E YRV  V +YY+LEDD++ I E    NSG   G  L+RQ++PKN+ G++Y WKDLN G  + VYG  Y  T CD FT++++ESEGI++N PE  PEDPY+ +R  + + + +  PS+ D   QFL MD K+L F A+ +D +  +       IHY+L +DT+EI+EV      ++ FPV++RR +IPK     S TFP  V+E++  ++ EY+SPKD ++GQT+ +L R FLL DCD+FTK +Y ++    +  P+++  ++  P+  KL+M                    PQ  PPK +  K ++N NKVLRY+ K+ S  PEDKDR FIL Y L +  ISI+E  K  S F  G  L+   V KPG + +NP+ Y P DF +GA +EVF  RFI+T AD YVL ++++     P + +++L   L  +     + E +K   V+
Sbjct:    6 NNYGLPFLPGYSFPDYTKSAFHRPQTLDYKNGYPLAQRL-SMGIGQELHLSEQLSTTAQHLSDLSFGMPGEDPYGASDRKVYEPFKPVYVALDKKVLCFKAFFKEEFLNSS-EEYRVCPVVIYYHLEDDTMTIVEPKEENSGFEHGKRLKRQKIPKNDHGEYYLWKDLNIGMDLKVYGFTYHITQCDDFTKEFMESEGIILNEPEPTPEDPYIKKR--KGSPQPHTQPSTTDKLHQFLTMDGKVLSFSALGEDVNRQY--TLPVTIHYFLVDDTVEIREVVYKGRRQNHFPVVMRRVKIPKKMK--SETFPTCVMEISHLDVDEYYSPKDFQLGQTVTLLARSFLLCDCDDFTKKYYKENHPDMEMKPLEVPEKVDTPQKEKLKMA------------------APQKNPPKVE--KNLENLNKVLRYKAKLVSPYPEDKDRSFILMYSLFNQTISIFE--KGTSSFDSGFLLRNRHVPKPGSSQENPDLYSPADFAIGATVEVFSHRFILTDADLYVLKYLESISDQVPSQTLDSLRQKLSTQSN---NGEEVKSSHVS 532          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:101168160])

HSP 1 Score: 285.419 bits (729), Expect = 9.697e-86
Identity = 203/691 (29.38%), Postives = 330/691 (47.76%), Query Frame = 1
Query:   19 MEGLPMLPGNSFR-DVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWK--DLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDAR-KQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN--------RDDVSPTFPNVVLE-----------LTPNEIKE-YFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNL-------------------------TTHLIAEEQMR----------PHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEY-GSNG 1905
            M  LP LPGNSF   + +  FH SQ      G          GIGG+PL   ++  +      +  P +           + +P  +AFDK+VL F  Y++E       E Y++   K+Y+Y EDD+I++ E    NSGIPQGT++ R R+P     D   +K    N    +  Y + +  T+CD FTR++L   G+ +N P  +P+DPY  +R   E       P   + + +QFL+ D+++LRFY  W+D++    + R  I+HY+L +DT++I EV     G       ++R ++PK+          D      NV+             L    +K+ ++   DLRIG  +NV GRR ++ DCD FTK  Y   +G  DFTP+K        P   +PPYNGFG+ EDSL +      + P+KD    ++ ++ VL++  KM++    ++ R+F++S+   D  +S+YE   ++SG  GG FL+R+ V KPG +  + E Y   D  VGA + + G  F++  AD Y L +M+ +   F +    N+                          T LI+ E  R             EV+  GR    ++  + D+  M+   +  L+R    D   +   F + +  + G +  +   +IC  ++LP  E++L  LL ++ G++G
Sbjct:    1 MSSLPFLPGNSFDLHLGRERFHKSQHFALVEGLPKLVGLEKPGIGGEPLPGQKIKAAH-----SVYPKVD---------GSHVPSWLAFDKQVLCFEAYFQEK------EPYQIRKCKVYFYPEDDTIKVVEPVCKNSGIPQGTLIYRHRIPLPPPNDDQYYKVFHFNINQQVVFYSRTFTLTNCDTFTRNFLTRLGVQLNDPAPVPDDPYSRQRQQFEKNTNPIPPYEKNNKLRQFLDYDRQVLRFYCFWNDQENPSAKPRELILHYFLFDDTIQIHEVTSAKAGNKSAVKFLQRRKLPKSLPAQVDQLGGDTESILLNVLGSDGLGNRFMADRLKTGAVKQDFYKDCDLRIGGEVNVWGRRVVIADCDEFTKQHYRFKYGIEDFTPVKYKLPPTPKPPKTLPPYNGFGSEEDSLSSCYGIQLRRPRKDLQSFLEKDSIVLKFRAKMKTDDGNERKRKFVISFYPCDGTMSVYELSLKSSGMPGGKFLRRSVVKKPGQSKPS-ERYTAQDLYVGAELHISGQTFMLVNADEYTLKYMEQHAEEFSKANTGNILSKLRSIPEDKKSEIKKFLTLSDPNNTGLISYESFRNMLMDLDCGLVDHEVLVLGRTFSEQQQPEDDVALMLAVAQDTLRRKLYDDFQSLTLAFNKQDPLKNGRIPRKMAWNICESVHLPVSENLLGTLLTKFEGADG 670          
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Medaka
Match: efhc2 (EF-hand domain containing 2 [Source:NCBI gene;Acc:101168160])

HSP 1 Score: 271.552 bits (693), Expect = 1.162e-80
Identity = 194/676 (28.70%), Postives = 321/676 (47.49%), Query Frame = 1
Query:   61 VTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWK--DLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDAR-KQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKN--------RDDVSPTFPNVVLE-----------LTPNEIKE-YFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNL-------------------------TTHLIAEEQMR----------PHKEVIKGGRVTICRK--DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEY-GSNG 1905
            + +  FH SQ      G          GIGG+PL   ++  +      +  P +           + +P  +AFDK+VL F  Y++E       E Y++   K+Y+Y EDD+I++ E    NSGIPQGT++ R R+P     D   +K    N    +  Y + +  T+CD FTR++L   G+ +N P  +P+DPY  +R   E       P   + + +QFL+ D+++LRFY  W+D++    + R  I+HY+L +DT++I EV     G       ++R ++PK+          D      NV+             L    +K+ ++   DLRIG  +NV GRR ++ DCD FTK  Y   +G  DFTP+K        P   +PPYNGFG+ EDSL +      + P+KD    ++ ++ VL++  KM++    ++ R+F++S+   D  +S+YE   ++SG  GG FL+R+ V KPG +  + E Y   D  VGA + + G  F++  AD Y L +M+ +   F +    N+                          T LI+ E  R             EV+  GR    ++  + D+  M+   +  L+R    D   +   F + +  + G +  +   +IC  ++LP  E++L  LL ++ G++G
Sbjct:   13 LGRERFHKSQHFALVEGLPKLVGLEKPGIGGEPLPGQKIKAAH-----SVYPKVD---------GSHVPSWLAFDKQVLCFEAYFQEK------EPYQIRKCKVYFYPEDDTIKVVEPVCKNSGIPQGTLIYRHRIPLPPPNDDQYYKVFHFNINQQVVFYSRTFTLTNCDTFTRNFLTRLGVQLNDPAPVPDDPYSRQRQQFEKNTNPIPPYEKNNKLRQFLDYDRQVLRFYCFWNDQENPSAKPRELILHYFLFDDTIQIHEVTSAKAGNKSAVKFLQRRKLPKSLPAQVDQLGGDTESILLNVLGSDGLGNRFMADRLKTGAVKQDFYKDCDLRIGGEVNVWGRRVVIADCDEFTKQHYRFKYGIEDFTPVKYKLPPTPKPPKTLPPYNGFGSEEDSLSSCYGIQLRRPRKDLQSFLEKDSIVLKFRAKMKTDDGNERKRKFVISFYPCDGTMSVYELSLKSSGMPGGKFLRRSVVKKPGQSKPS-ERYTAQDLYVGAELHISGQTFMLVNADEYTLKYMEQHAEEFSKANTGNILSKLRSIPEDKKSEIKKFLTLSDPNNTGLISYESFRNMLMDLDCGLVDHEVLVLGRTFSEQQQPEDDVALMLAVAQDTLRRKLYDDFQSLTLAFNKQDPLKNGRIPRKMAWNICESVHLPVSENLLGTLLTKFEGADG 667          
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000078434.1 (SMESG000078434.1)

HSP 1 Score: 1321.99 bits (3420), Expect = 0.000e+0
Identity = 633/633 (100.00%), Postives = 633/633 (100.00%), Query Frame = 1
Query:   19 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL
Sbjct:    1 MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 633          
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000078434.1 (SMESG000078434.1)

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 628/628 (100.00%), Postives = 628/628 (100.00%), Query Frame = 1
Query:   34 MLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 1917
            MLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL
Sbjct:    1 MLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGRVTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLEEYGSNGRMNL 628          
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000076759.1 (SMESG000076759.1)

HSP 1 Score: 382.104 bits (980), Expect = 1.397e-122
Identity = 239/695 (34.39%), Postives = 366/695 (52.66%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPY-LAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRD-------DVSPTFPNV-----------VLELTPNEIK-EYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQHYFPREMINNLTTHL--------------------------------------IAEEQMRPHKEVIKGGRVTICR--KDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLE--NMQDICRKMNLPDDEDILACLLEE 1890
             LP+LPGN F R++ K  +H S     KN           GIGG PL   ++            PT  Y     A   + +P  +AFDK+VL F  Y++E+V E   E YR+ + K+ +YLEDD+IQ+ E    NS +PQGTI+RR R+ K    DH  YT  D N G  +  YGK++R  SCD+FT ++L   G+ V  PE IP+D Y L  +A  E+++  +     D  KQFL+ D+ +LRF+  WDD D ++G+ R  +IHY+L++DT+EI+EV   N GRD  P  ++R ++PK  +           T  NV           +  L   + K E+++ +DL+IG  INV GR+F++ D D FTK +Y   +G T+FT I   +   E      PP+NG+G+ EDSL N    MPQPPK+DFIK ++ + K     VLR++ ++ + +  DKDRRFI+S+ LADD   ++E   +NSGFLGG FL+R+++ KPG    + + P+YY   D  +GAIIE+    F I  AD Y   +M+ N   FP+  I+ +   L                                       +E+++  H E+    R    R  KD ++   +  ++ QL+++   + ++I  MF++   D+ G+  LE   M  I + +++P  +D+L  L ++
Sbjct:    2 ALPLLPGNIFNRNLGKEKYHKSHHFDSKNEVNFMFGDDKNGIGGAPLPGQRIGA----------PTSNY----PAGDGSKMPAWIAFDKQVLFFDAYFQESVNERREEQYRIRNCKVMFYLEDDTIQVIEPRTRNSCLPQGTIIRRHRIAKPAPNDHLFYTVHDFNVGIELEFYGKLFRIISCDEFTHNFLRKLGVQVGQPEKIPQDNYNLTRKAMDESMQPLRPYERKDKLKQFLDHDRHVLRFFCFWDDSDNLYGDKREMVIHYFLADDTVEIREVIPANAGRDAAPTFLKRQKLPKYMEPLPSIGTQTERTLLNVLGHPQRGGRYLIDNLKTGDTKVEFYTDEDLQIGACINVFGRKFVITDMDMFTKEYYNYKYGMTNFTAIDTQNYRGEPIIRHEPPFNGWGSEEDSLGNCHGLMPQPPKRDFIKFMEKDRKGLESHVLRFKARLVTDKVLDKDRRFIISFFLADDSAVVFETVLKNSGFLGGKFLERSKIKKPGQERYSTELPKYYQASDIHIGAIIEINNFNFFIEDADEYAYRYMEKNYIEFPQSNIDRIMLKLRQKFASKEREIDSHFKEVDARNAMTVTFHQLQSVLRIWFSEQELTDH-EICTIARHYAARSVKDVNVSAFIGVIQQQLRKVNFEEFSQIQNMFIK--ADKRGNCQLERAEMNKIFKLLHVPISQDLLQILFDQ 679          
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000066984.1 (SMESG000066984.1)

HSP 1 Score: 375.555 bits (963), Expect = 9.234e-120
Identity = 233/693 (33.62%), Postives = 363/693 (52.38%), Query Frame = 1
Query:   25 GLPMLPGNSF-RDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKVNQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAER-AHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRD---DVSPTFPNVVLEL----------------TPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIK--IDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-----VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSGFLGGSFLKRTRVAKPG---CTADNPEYYGPLDFCVGAIIEVFGTRFIITTADAYVLSFMQANQH---------------------------YFPREMINNLTTHLIAE-----EQMRPHKEVIKGGRVTICRK-------DGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLENMQDICRKMNLPDDEDILACLLE 1887
             LP++PG  F R + K  FH S     KN  R       +GIGGDPL   ++            PT  Y  +     +   P  VAFDK+VL F  YY+E V ESP E YR+ + K+++YLEDD+IQ+ E    NSG+PQGTI++R R+ K E  DH  YT  D N G  +  Y KV+R  SCD FT ++L   G+ +  PE IPED +  +R A  E+++  +     D  KQFL+ D+ +LRF+  WDD D ++G+ R  I+HY+LS+DT+E++E+   N GRD  P  +RR ++PK  +   +V      +VL +                T  +  +Y++  DL IG  IN+ GR+ ++   D FTK +Y   +G   F  I+  I+  +P +   + PPYNG+GT EDSL N    +PQP KKD+I+ ++ + +     +LR++ ++ + +P D DRRFI+S+ L DD I I+E P RNSGF GG FL+R ++ KPG    + + P YY   D  +GAI+E+   +F+I  AD Y   +M+ + +                           YF R+   N  T   A+      QM    E+       + R+       + ++ +++   + +L++++  D   + E  LR + D+ G ++ E M+ IC+ +++   E +L  L +
Sbjct:    2 SLPLIPGQCFDRKIGKEKFHKSHYFDNKNDIRFSFGIDKIGIGGDPLPGQRIN----------APTSHYPFNNNTTKS---PAWVAFDKQVLAFDAYYQEAVTESPAEQYRIRNCKIFFYLEDDTIQVIEPRIRNSGLPQGTIIKRHRISKKEPEDHLYYTVHDFNVGIDINFYDKVFRIVSCDIFTENFLRKLGVHIGFPEMIPEDQHFIQRKALEESMQPLRPYERKDTLKQFLDHDRHVLRFFCFWDDTDSLYGDPREMILHYFLSDDTIEVREIIPVNAGRDAAPSFLRRQKLPKKLEPLPEVGTITDRIVLNVLGHPQRGGRFVLDSLKTGEKKIDYYTDADLTIGSYINLYGRKVVICSMDEFTKEFYRTKYGIQTFNDIRYSINKGVPVVH--QDPPYNGWGTEEDSLANCHGLIPQPRKKDYIRFMEKDRRGLDSNILRFKARLITDKPLDVDRRFIISFFLTDDSILIFEPPIRNSGFAGGVFLERNKIKKPGQERFSTELPIYYLCQDLYIGAILEINTFKFLIEDADEYAYHYMETHPYEFAHSSIDRILRKMHPNAVGKRSEMMAYFVRQDPENRGTVNFAQLTCLLRQMYSPAELTDHEITILARQYAHRPINEVNVPEIIGIAQQELRKISFEDLTGLKEACLRSDIDKRGYLSREEMRAICKVLHITFPEGLLQALFD 679          
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000003987.1 (SMESG000003987.1)

HSP 1 Score: 128.257 bits (321), Expect = 7.724e-33
Identity = 80/214 (37.38%), Postives = 117/214 (54.67%), Query Frame = 1
Query:  247 PPAAFIPGHVAFDKKVLRFFGYYKETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRVPKNEVGDH--YTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMPEDIPEDPYLAERAHREALKTYKTPSSF----DARKQFLEMDKKILRFYAVWDDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRD 870
            P  A  P  V +DKKVL F GY+ E V E P + Y     K++YYLEDD++Q+ E    NS + QGT+++R +  K+   D+  Y   D N G+ + + G+  + TSCD FT +YL   G+ +  P   P DP     + +  L   K    F    D   QFL+ +K ILRFY  +D+ D ++ + R+  +HY+L +DTMEI E    N GR+
Sbjct:   56 PRGAKGPSWVVYDKKVLCFDGYWLENVTEEPDKFYNCRSCKVFYYLEDDTVQVLEPRIRNSRLCQGTVVKRMKFLKSPPDDNLFYNIHDFNIGSILQLCGRHIKLTSCDNFTFNYLRRLGVDIKNPIPQPIDPV---ESLKNNLAGQKKGKGFYRKNDTLGQFLDYNKYILRFYCFFDNTD-IYNDPRSMNLHYFLEDDTMEIMENLPNNCGRE 265          

HSP 2 Score: 50.8322 bits (120), Expect = 1.316e-6
Identity = 58/227 (25.55%), Postives = 94/227 (41.41%), Query Frame = 1
Query:  727 DKKILRFYAVW----DDRDEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRDDVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTKAWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMPQPPKKDFIKQVDNENK-VLRYECKMESIRPEDKDRRFILSYRLADDMISIYEAPKRNSG 1392
            DKK+L F   W     +  + F  CR+  + YYL +DT+++ E    N  R     +V+R +  K                +P +   +++  D  IG  + + GR   L  CDNFT   Y +  G      + I + IP+       P +   +L+++L           K D + Q  + NK +LR+ C  ++    +  R   L Y L DD + I E    N G
Sbjct:   68 DKKVLCFDGYWLENVTEEPDKFYNCRSCKVFYYLEDDTVQVLEPRIRN-SRLCQGTVVKRMKFLK----------------SPPDDNLFYNIHDFNIGSILQLCGRHIKLTSCDNFTFN-YLRRLG------VDIKNPIPQ-------PIDPVESLKNNLAGQKKGKGFYRKNDTLGQFLDYNKYILRFYCFFDNTDIYNDPRSMNLHYFLEDDTMEIMENLPNNCG 263          
The following BLAST results are available for this feature:
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EFHC10.000e+049.44EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC10.000e+049.68EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC10.000e+049.84EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC10.000e+049.84EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
EFHC10.000e+052.87EF-hand domain containing 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhc-16.155e-2927.17EF-Hand domain-Containing protein 1 homolog [Sour... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Efhc1.12.362e-9734.97gene:FBgn0030691 transcript:FBtr0074192[more]
Efhc1.23.214e-9634.44gene:FBgn0034487 transcript:FBtr0086316[more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
efhc10.000e+051.57EF-hand domain (C-terminal) containing 1 [Source:Z... [more]
efhc21.340e-11833.76EF-hand domain (C-terminal) containing 2 [Source:N... [more]
efhc23.252e-6137.14EF-hand domain (C-terminal) containing 2 [Source:N... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agmo0.000e+055.54alkylglycerol monooxygenase [Source:Xenbase;Acc:XB... [more]
efhc23.435e-13134.29EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc23.571e-13134.29EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc21.272e-12638.66EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc21.032e-12338.09EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Efhc10.000e+048.20EF-hand domain (C-terminal) containing 1 [Source:M... [more]
Efhc21.261e-10636.59EF-hand domain (C-terminal) containing 2 [Source:M... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5JVL4|EFHC1_HUMAN0.000e+049.68EF-hand domain-containing protein 1 OS=Homo sapien... [more]
sp|Q9D9T8|EFHC1_MOUSE0.000e+048.20EF-hand domain-containing protein 1 OS=Mus musculu... [more]
sp|Q32TF8|EFHC2_DANRE8.069e-11933.81EF-hand domain-containing family member C2 OS=Dani... [more]
sp|Q32TG3|EFHC2_CHICK8.020e-10732.80EF-hand domain-containing family member C2 OS=Gall... [more]
sp|Q9D485|EFHC2_MOUSE8.821e-10636.59EF-hand domain-containing family member C2 OS=Mus ... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|214663890.000e+063.30tr|A0A074ZNU6|A0A074ZNU6_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|229147050.000e+062.67tr|A0A4S2LL15|A0A4S2LL15_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|228437330.000e+061.60tr|A0A3Q0KR57|A0A3Q0KR57_SCHMA Putative ef-hand do... [more]
gnl|BL_ORD_ID|187895350.000e+063.64tr|A0A0X3P4B5|A0A0X3P4B5_SCHSO EF-hand domain-cont... [more]
gnl|BL_ORD_ID|157932020.000e+060.82tr|A0A1I8HKJ3|A0A1I8HKJ3_9PLAT Uncharacterized pro... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efhc10.000e+048.52EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
efhc10.000e+048.52EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
efhc21.756e-10933.38EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc24.650e-10632.43EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc25.073e-10632.43EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
efhc12.972e-17548.15EF-hand domain (C-terminal) containing 1 [Source:Z... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO337570.000e+057.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326613.497e-13034.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
efhc15.141e-12540.71EF-hand domain containing 1 [Source:NCBI gene;Acc:... [more]
efhc29.697e-8629.38EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
efhc21.162e-8028.70EF-hand domain containing 2 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of EF-hand domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078434.10.000e+0100.00SMESG000078434.1[more]
SMESG000078434.10.000e+0100.00SMESG000078434.1[more]
SMESG000076759.11.397e-12234.39SMESG000076759.1[more]
SMESG000066984.19.234e-12033.62SMESG000066984.1[more]
SMESG000003987.17.724e-3337.38SMESG000003987.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010842 ID=SMED30010842|Name=EF-hand domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2024bp
TAAGAGAAAAATTTAAATATGGAAGGCTTACCAATGTTGCCGGGAAATTC
TTTCAGAGATGTAACTAAAACTAACTTTCATGTTAGTCAAACTTTAGGAT
GGAAAAATGGTTTTCGAACACCTAAATCATATCCATCCGTAGGTATTGGT
GGTGATCCTTTAAAAGTAAACCAATTAACGGAATCAGAATTGGATGAACT
AGCAAATTGGCAACCAACTTTAACTTATGGTCAAAGCAGACAAGCTCCAC
CAGCTGCATTTATTCCAGGGCATGTTGCTTTTGATAAAAAGGTCTTAAGA
TTTTTTGGTTATTATAAAGAAACTGTACAAGAGTCCCCATTGGAACACTA
CAGAGTTCATCATGTTAAGCTTTATTATTATTTGGAAGACGATAGCATAC
AAATTACCGAATCTCCGAGAAATAATAGTGGAATTCCACAAGGAACAATT
CTCAGGCGGCAAAGAGTACCCAAAAATGAAGTAGGAGATCATTATACGTG
GAAAGATTTGAATAATGGAACAAGCATGTGTGTTTATGGAAAAGTTTATC
GGTGGACAAGTTGTGATAAATTCACTAGGGATTATCTTGAAAGCGAAGGT
ATTGTAGTGAATATGCCTGAAGATATTCCTGAAGACCCTTACTTGGCAGA
AAGAGCACACAGAGAAGCTCTGAAAACATATAAAACTCCATCTTCATTCG
ATGCCAGGAAACAATTTTTAGAAATGGATAAGAAAATTTTGAGATTTTAT
GCTGTATGGGATGATCGGGATGAAATGTTCGGTGAATGTAGAAATTTCAT
TATTCACTATTATTTATCGAATGACACTATGGAAATCAAGGAAGTTCATG
ACACAAATGATGGTAGAGATCCATTTCCAGTATTGGTTCGTCGTGACAGA
ATTCCGAAAAATAGAGATGATGTTTCTCCGACGTTTCCAAACGTAGTTTT
AGAGTTAACGCCAAACGAAATCAAAGAATATTTCAGTCCCAAAGACTTGA
GAATAGGACAAACAATAAATGTATTAGGACGTCGATTTCTACTATATGAT
TGCGATAATTTTACAAAAGCTTGGTATTATCAGCATTTTGGGACTACAGA
TTTTACTCCAATTAAAATTGATCACAGAATTCCTGAAATACCTAAACTGG
AAATGCCTCCATACAATGGTTTCGGAACTCTCGAGGATTCCCTTGAGAAT
TCATTAACATTCATGCCACAACCACCGAAGAAAGATTTCATTAAACAAGT
TGATAATGAAAATAAAGTACTTAGATATGAATGCAAAATGGAAAGTATCA
GACCTGAAGATAAAGATCGTCGCTTTATTTTATCATACAGATTAGCTGAT
GATATGATAAGCATTTATGAAGCGCCTAAAAGAAACTCGGGATTTTTAGG
TGGAAGTTTCTTAAAACGAACTCGAGTTGCTAAACCGGGCTGTACGGCTG
ACAATCCCGAATACTATGGACCTTTGGATTTCTGTGTTGGTGCAATTATC
GAGGTGTTTGGAACACGTTTCATTATCACAACGGCAGATGCATATGTACT
CAGTTTCATGCAAGCTAATCAACACTACTTCCCAAGGGAGATGATAAATA
ATTTGACTACTCATTTGATAGCCGAGGAACAAATGAGACCACACAAAGAA
GTGATTAAAGGTGGAAGAGTCACAATATGCAGAAAAGATGGAGACATTTT
CCAAATGATGAAAGAATTACGAACTCAATTAAAGAGAATGGCTATTACGG
ATAAAGCCAGAATAGATGAAATGTTCCTTCGATATAACAAAGATAGAACT
GGCAGTGTAACACTAGAAAATATGCAAGATATTTGTAGAAAAATGAATTT
GCCAGATGATGAAGACATTTTAGCATGTCTGTTGGAAGAATATGGCTCAA
ACGGCAGAATGAACTTGGAGGAATTCCGAAGGTTTTTTGAGTGCTAAATT
TAACTGTGTGATATACTGATTTTATCTTAATATTGTAAGATTATCTAAGA
TTTTAATAAAAGTAGGAGCGTGAA
back to top

protein sequence of SMED30010842-orf-1

>SMED30010842-orf-1 ID=SMED30010842-orf-1|Name=SMED30010842-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MEGLPMLPGNSFRDVTKTNFHVSQTLGWKNGFRTPKSYPSVGIGGDPLKV
NQLTESELDELANWQPTLTYGQSRQAPPAAFIPGHVAFDKKVLRFFGYYK
ETVQESPLEHYRVHHVKLYYYLEDDSIQITESPRNNSGIPQGTILRRQRV
PKNEVGDHYTWKDLNNGTSMCVYGKVYRWTSCDKFTRDYLESEGIVVNMP
EDIPEDPYLAERAHREALKTYKTPSSFDARKQFLEMDKKILRFYAVWDDR
DEMFGECRNFIIHYYLSNDTMEIKEVHDTNDGRDPFPVLVRRDRIPKNRD
DVSPTFPNVVLELTPNEIKEYFSPKDLRIGQTINVLGRRFLLYDCDNFTK
AWYYQHFGTTDFTPIKIDHRIPEIPKLEMPPYNGFGTLEDSLENSLTFMP
QPPKKDFIKQVDNENKVLRYECKMESIRPEDKDRRFILSYRLADDMISIY
EAPKRNSGFLGGSFLKRTRVAKPGCTADNPEYYGPLDFCVGAIIEVFGTR
FIITTADAYVLSFMQANQHYFPREMINNLTTHLIAEEQMRPHKEVIKGGR
VTICRKDGDIFQMMKELRTQLKRMAITDKARIDEMFLRYNKDRTGSVTLE
NMQDICRKMNLPDDEDILACLLEEYGSNGRMNLEEFRRFFEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR040193EFHC1/EFHC2/EFHB
IPR006602Uncharacterised_DM10
IPR010554DUF1126
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006602Uncharacterised domain DM10SMARTSM00676dm10coord: 237..357
e-value: 9.7E-46
score: 167.9
coord: 414..518
e-value: 1.6E-34
score: 130.7
coord: 89..194
e-value: 4.1E-41
score: 152.6
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 414..518
score: 33.532
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 89..194
score: 33.102
IPR006602Uncharacterised domain DM10PROSITEPS51336DM10coord: 237..357
score: 36.679
NoneNo IPR availableGENE3DG3DSA:2.30.29.170coord: 79..206
e-value: 2.0E-39
score: 136.1
coord: 227..370
e-value: 1.3E-38
score: 133.5
coord: 406..524
e-value: 1.1E-27
score: 98.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 525..641
e-value: 3.1E-8
score: 35.3
NoneNo IPR availablePANTHERPTHR12086:SF9EF-HAND DOMAIN-CONTAINING PROTEIN 1coord: 2..616
IPR010554Domain of unknown function DUF1126PFAMPF06565DUF1126coord: 409..509
e-value: 3.9E-30
score: 103.8
coord: 231..349
e-value: 4.2E-36
score: 123.0
coord: 84..186
e-value: 1.5E-31
score: 108.3
IPR040193EF-hand domain-containing protein EFHC1/EFHC2/EFHBPANTHERPTHR12086EF-HAND DOMAIN C-TERMINAL CONTAINING PROTEINcoord: 2..616
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 577..612
score: 10.441
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 631..642
score: 5.085
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 574..640