26S proteasome regulatory subunit 10B

Overview
Name26S proteasome regulatory subunit 10B
Smed IDSMED30010841
Length (bp)720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome regulatory subunit 10B (SMED30010841) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome regulatory subunit 10B (SMED30010841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010841SMESG000047180.1 SmedASXL_007417SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010841SMESG000047180.1 SmedASXL_007417SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testis primordiumSMED30010841SMESG000047180.1 Contig1880_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30010841SMESG000047180.1 SMED_06852_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010841SMESG000047180.1 SMED_35179_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30010841SMESG000047180.1 SMED_35179_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 343.199 bits (879), Expect = 9.522e-120
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 343.969 bits (881), Expect = 2.748e-118
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 343.969 bits (881), Expect = 5.151e-118
Identity = 158/238 (66.39%), Postives = 203/238 (85.29%), Query Frame = 1
Query:    7 IAMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            + ++ D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   12 LLIMADPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 249          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC6 (proteasome 26S subunit, ATPase 6 [Source:HGNC Symbol;Acc:HGNC:9553])

HSP 1 Score: 281.567 bits (719), Expect = 1.687e-96
Identity = 139/232 (59.91%), Postives = 166/232 (71.55%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDE 717
            D   KAL +Y+K LLE+ +I+  L+                                         FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDE
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKE----------------------------------------FIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDE 194          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Match: PSMC5 (proteasome 26S subunit, ATPase 5 [Source:HGNC Symbol;Acc:HGNC:9552])

HSP 1 Score: 187.963 bits (476), Expect = 1.058e-58
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   62 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 243          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 330.487 bits (846), Expect = 3.125e-113
Identity = 154/237 (64.98%), Postives = 196/237 (82.70%), Query Frame = 1
Query:   10 AMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            A+V D   KAL+ Y++ L E   IE +L+  R K  ++ K+F  SE+ IK+LQS GQ++GE++KQL++E FIVK + GPRY+VGC++SI++ +LK G+RV+LD  TLTI+R LPRE+DP+VY MS EDPGNI Y+ +GGL EQIRELREV+ELPL NPE+F RVGI  PKG LL+GPPGTGKTLLARAVASQLD NFLKVVSS+IVDK+IGESAR+IREMF YA++H+PC++FMDEI
Sbjct:    8 AIVEDERTKALNSYRRKLAECRDIEQKLKDLRKKESEMTKQFDKSENDIKSLQSVGQIVGEVLKQLSEEKFIVKATNGPRYVVGCRRSINKEELKQGTRVSLDMTTLTIMRQLPREVDPLVYKMSHEDPGNISYSDVGGLAEQIRELREVVELPLINPELFKRVGITPPKGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEI 244          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-4 (Probable 26S proteasome regulatory subunit 10B [Source:UniProtKB/Swiss-Prot;Acc:O17071])

HSP 1 Score: 330.872 bits (847), Expect = 3.278e-113
Identity = 154/237 (64.98%), Postives = 196/237 (82.70%), Query Frame = 1
Query:   10 AMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            A+V D   KAL+ Y++ L E   IE +L+  R K  ++ K+F  SE+ IK+LQS GQ++GE++KQL++E FIVK + GPRY+VGC++SI++ +LK G+RV+LD  TLTI+R LPRE+DP+VY MS EDPGNI Y+ +GGL EQIRELREV+ELPL NPE+F RVGI  PKG LL+GPPGTGKTLLARAVASQLD NFLKVVSS+IVDK+IGESAR+IREMF YA++H+PC++FMDEI
Sbjct:   16 AIVEDERTKALNSYRRKLAECRDIEQKLKDLRKKESEMTKQFDKSENDIKSLQSVGQIVGEVLKQLSEEKFIVKATNGPRYVVGCRRSINKEELKQGTRVSLDMTTLTIMRQLPREVDPLVYKMSHEDPGNISYSDVGGLAEQIRELREVVELPLINPELFKRVGITPPKGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEI 252          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: rpt-6 (Proteasome Regulatory Particle, ATPase-like [Source:UniProtKB/TrEMBL;Acc:Q9XTT9])

HSP 1 Score: 200.675 bits (509), Expect = 2.916e-62
Identity = 105/240 (43.75%), Postives = 155/240 (64.58%), Query Frame = 1
Query:    1 FFIAMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +F   V DA+QK +++  +++       +EL T   K+R +++E Q        L   G  +GE+ K +  +  +VKV    +Y+V   KSID N L +G+RVAL   +  + ++LP ++DP+V  M  E   +  Y  +GGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLL+GPPGTGKTLLARAVA   +  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   33 YFSTKVDDAQQK-VADKSQNVRRLQAQRNELNT---KVRMLKEELQ-------QLHEQGSYVGEVSKAMDKKKVLVKVHPEGKYVVDVDKSIDINSLNTGARVALRADSYALHKLLPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLFGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 261          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: F56F11.4 (pep chromosome:WBcel235:III:2858558:2865497:1 gene:WBGene00018991.1 transcript:F56F11.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56F11.4)

HSP 1 Score: 189.119 bits (479), Expect = 7.553e-58
Identity = 98/238 (41.18%), Postives = 150/238 (63.03%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSK---IESELRTTRF--KIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +++++ L  Y K+ +E ++    E  +   R   + +++  + ++ ++ I  L   G  +GE+ K +  +  +VK     +Y+V    S+D + L +G+RVAL      I  VLP ++DP+V  M  E   +  Y  +GGL+ QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   19 NSDEQTLRPYFKTKVEQAEQTVAEKSINVRRLMAQQKELNGKVRLLKEEISHLHEQGSHVGEVCKAMDKKKVLVKNHPDGKYIVDVAASVDISTLAAGTRVALRADNYAIHEVLPSKVDPLVSLMMVEKVPDSTYEMVGGLDTQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 256          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Match: F56F11.4 (pep chromosome:WBcel235:III:2858709:2865386:1 gene:WBGene00018991.1 transcript:F56F11.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F56F11.4)

HSP 1 Score: 189.119 bits (479), Expect = 7.553e-58
Identity = 98/238 (41.18%), Postives = 150/238 (63.03%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSK---IESELRTTRF--KIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +++++ L  Y K+ +E ++    E  +   R   + +++  + ++ ++ I  L   G  +GE+ K +  +  +VK     +Y+V    S+D + L +G+RVAL      I  VLP ++DP+V  M  E   +  Y  +GGL+ QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   19 NSDEQTLRPYFKTKVEQAEQTVAEKSINVRRLMAQQKELNGKVRLLKEEISHLHEQGSHVGEVCKAMDKKKVLVKNHPDGKYIVDVAASVDISTLAAGTRVALRADNYAIHEVLPSKVDPLVSLMMVEKVPDSTYEMVGGLDTQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 256          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4 (gene:FBgn0028685 transcript:FBtr0305495)

HSP 1 Score: 345.895 bits (886), Expect = 3.472e-119
Identity = 160/229 (69.87%), Postives = 200/229 (87.34%), Query Frame = 1
Query:   34 KALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            KALSEY+K LLE+ +IE  L+  R +I+D+ K +  SE+ +KALQS GQ++GE++KQLT++ FIVK + GPRY+VGC++ +D+ KLKSG+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y++IGGL +QIRELREVIELPL NPE+F+RVGI  PKG LLYGPPGTGKTLLARAVASQLDANFLKVVSS+IVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   15 KALSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYSAIGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 243          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0346545)

HSP 1 Score: 340.502 bits (872), Expect = 4.754e-117
Identity = 157/233 (67.38%), Postives = 198/233 (84.98%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   +AL+ Y+  LLE+ +IES+L+  R K + +  E++ SED +KALQS GQ++GE++KQLT + FIVK S GPRY+VGC++ I++ KLK G+RVALD  TLTI+R LPRE+DP+VYNM+ EDPGN++Y  IGGL +QIRELREVIELPL NP+IF+RVGI  PKG LLYGPPGTGKTLLARA+ASQ+DANFLKVVSS+IVDK+IGESAR+IREMFAYA++H+PC+IFMDEI
Sbjct:   12 DERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTPDNFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEI 244          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt4R (gene:FBgn0036224 transcript:FBtr0076040)

HSP 1 Score: 340.502 bits (872), Expect = 4.754e-117
Identity = 157/233 (67.38%), Postives = 198/233 (84.98%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   +AL+ Y+  LLE+ +IES+L+  R K + +  E++ SED +KALQS GQ++GE++KQLT + FIVK S GPRY+VGC++ I++ KLK G+RVALD  TLTI+R LPRE+DP+VYNM+ EDPGN++Y  IGGL +QIRELREVIELPL NP+IF+RVGI  PKG LLYGPPGTGKTLLARA+ASQ+DANFLKVVSS+IVDK+IGESAR+IREMFAYA++H+PC+IFMDEI
Sbjct:   12 DERVRALTNYRTKLLEHREIESKLKALRDKYKVVNAEYEKSEDDLKALQSVGQMVGEILKQLTPDNFIVKASNGPRYVVGCRRQINKEKLKPGTRVALDVTTLTIMRYLPREVDPLVYNMTHEDPGNVNYAEIGGLGQQIRELREVIELPLLNPDIFLRVGISPPKGCLLYGPPGTGKTLLARAIASQMDANFLKVVSSAIVDKYIGESARLIREMFAYARDHQPCIIFMDEI 244          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt6 (gene:FBgn0020369 transcript:FBtr0077189)

HSP 1 Score: 191.815 bits (486), Expect = 6.780e-59
Identity = 92/210 (43.81%), Postives = 141/210 (67.14%), Query Frame = 1
Query:   91 LRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            LR  + +  ++  + ++  + ++ LQ  G  +GE++K +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  +GGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE +R++RE+F  A+EH P +IFMDEI
Sbjct:   41 LRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEI 250          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Match: Rpt6R (gene:FBgn0039788 transcript:FBtr0085680)

HSP 1 Score: 182.956 bits (463), Expect = 1.938e-55
Identity = 88/182 (48.35%), Postives = 125/182 (68.68%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  I E++K +     +VKV    +Y+V   K+I+   +   SRVAL   + T+ ++LP ++DP+V  M  E   +  Y  +GGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE +R++RE+F  A+EH P +IFMDEI
Sbjct:   64 GSYIAEVVKPMDKNKVLVKVHPEGKYVVDVDKTINIKDVTPSSRVALRNESYTLHKILPNKVDPLVSLMLVEKVPDSTYEMVGGLDKQIQEIKEVIELPVKHPELFDALGITQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEI 245          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 339.347 bits (869), Expect = 1.273e-116
Identity = 155/230 (67.39%), Postives = 199/230 (86.52%), Query Frame = 1
Query:   31 QKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +K L +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    6 EKGLQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 339.347 bits (869), Expect = 1.273e-116
Identity = 155/230 (67.39%), Postives = 199/230 (86.52%), Query Frame = 1
Query:   31 QKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +K L +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    6 EKGLQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 339.347 bits (869), Expect = 1.273e-116
Identity = 155/230 (67.39%), Postives = 199/230 (86.52%), Query Frame = 1
Query:   31 QKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +K L +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    6 EKGLQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:ZDB-GENE-030131-304])

HSP 1 Score: 184.111 bits (466), Expect = 2.170e-58
Identity = 81/142 (57.04%), Postives = 118/142 (83.10%), Query Frame = 1
Query:   31 QKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELRE 456
            +K L +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELRE
Sbjct:    6 EKGLQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELRE 147          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 188.734 bits (478), Expect = 1.608e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 251          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 344.354 bits (882), Expect = 5.158e-118
Identity = 158/238 (66.39%), Postives = 203/238 (85.29%), Query Frame = 1
Query:    7 IAMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            + ++ D  +KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   28 LLIMADPREKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 265          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 266.929 bits (681), Expect = 1.010e-88
Identity = 125/163 (76.69%), Postives = 144/163 (88.34%), Query Frame = 1
Query:  232 VSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            VS G  Y+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   18 VSAG--YVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 178          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:394968])

HSP 1 Score: 262.692 bits (670), Expect = 1.135e-86
Identity = 127/238 (53.36%), Postives = 171/238 (71.85%), Query Frame = 1
Query:    7 IAMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            + ++ D  +KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELRE                                     RAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   12 LLIMADPREKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELRE-------------------------------------RAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 212          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 188.348 bits (477), Expect = 2.736e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   62 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 243          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Match: map7 (microtubule associated protein 7 [Source:Xenbase;Acc:XB-GENE-961210])

HSP 1 Score: 188.348 bits (477), Expect = 3.289e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   69 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 250          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc6 (proteasome (prosome, macropain) 26S subunit, ATPase, 6 [Source:MGI Symbol;Acc:MGI:1914339])

HSP 1 Score: 343.969 bits (881), Expect = 1.887e-118
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 187.578 bits (475), Expect = 1.337e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 251          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc5 (protease (prosome, macropain) 26S subunit, ATPase 5 [Source:MGI Symbol;Acc:MGI:105047])

HSP 1 Score: 188.348 bits (477), Expect = 2.196e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 251          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc4 (proteasome (prosome, macropain) 26S subunit, ATPase, 4 [Source:MGI Symbol;Acc:MGI:1346093])

HSP 1 Score: 169.859 bits (429), Expect = 4.417e-50
Identity = 87/226 (38.50%), Postives = 142/226 (62.83%), Query Frame = 1
Query:   43 SEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            S YKK   E   +E +    + + ++++KEF  +++ +K +QS   VIG+ ++ +   T IV  + G  Y V    +IDR  LK  + VAL   +  ++ VLP E D  +  ++++   ++ Y  IGG++ Q +E+RE +ELPL + E++ ++GI  P+GVL+YGPPG GKT+LA+AVA    A F++VV S  V K++GE  R++R++F  AKE+ P +IF+DEI
Sbjct:   42 SRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI 267          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Match: Psmc1 (protease (prosome, macropain) 26S subunit, ATPase 1 [Source:MGI Symbol;Acc:MGI:106054])

HSP 1 Score: 166.392 bits (420), Expect = 1.362e-48
Identity = 84/218 (38.53%), Postives = 133/218 (61.01%), Query Frame = 1
Query:   67 EYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +Y  +E E    + +++ +E++ +     +  L+     +G L + + D   IV  S G  + V     +D++ L+ G  V L+     +I VL  + DP+V  M  E      Y  IGGL+ QI+E++E +ELPL +PE +  +GIK PKGV+LYGPPGTGKTLLA+AVA+Q  A FL+VV S ++ K++G+  +++RE+F  A+EH P ++F+DEI
Sbjct:   70 DYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEI 287          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62334|PRS10_MOUSE (26S proteasome regulatory subunit 10B OS=Mus musculus OX=10090 GN=Psmc6 PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.320e-117
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62335|PRS10_ICTTR (26S proteasome regulatory subunit 10B OS=Ictidomys tridecemlineatus OX=43179 GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.320e-117
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|P62333|PRS10_HUMAN (26S proteasome regulatory subunit 10B OS=Homo sapiens OX=9606 GN=PSMC6 PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.320e-117
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|Q2KIW6|PRS10_BOVIN (26S proteasome regulatory subunit 10B OS=Bos taurus OX=9913 GN=PSMC6 PE=2 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.409e-117
Identity = 158/233 (67.81%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D   KAL +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D++KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGN+ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DPRDKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Match: sp|O74445|PRS10_SCHPO (Probable 26S proteasome subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpt4 PE=3 SV=2)

HSP 1 Score: 337.806 bits (865), Expect = 3.970e-115
Identity = 158/228 (69.30%), Postives = 193/228 (84.65%), Query Frame = 1
Query:   37 ALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            AL +YK  LL++ + +S+L+  RF  RD+ K++  +ED IK+LQS GQ+IGE++KQL  E FIVK S GPRY+VGC+ ++D++ L  G RV+LD  TLTI+R+LPRE+DP+VYNMS EDPG+I +  +GGLNEQIRELREVIELPLKNPE+F+RVGIK PKGVLLYGPPGTGKTLLARAVA+ L  NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPCVIFMDEI
Sbjct:    7 ALEKYKSYLLQHREWDSKLKDLRFGNRDLVKKYDKTEDDIKSLQSVGQIIGEVLKQLDSERFIVKASSGPRYVVGCRNNVDQSHLVQGVRVSLDMTTLTIMRILPREVDPLVYNMSIEDPGDISFAGVGGLNEQIRELREVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVAASLGVNFLKVVSSAIVDKYIGESARIIREMFGYAKEHEPCVIFMDEI 234          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A1L9W070 (AAA domain-containing protein OS=Aspergillus glaucus CBS 516.65 OX=1160497 GN=ASPGLDRAFT_115318 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.590e-122
Identity = 170/236 (72.03%), Postives = 203/236 (86.02%), Query Frame = 1
Query:   13 MVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            M      +AL +YKKSLLE  + E++LRT R  I+D++KEF +SE++IKALQS GQ+IGE++KQL +E FIVK S GPRY+VGC+  +D+ KL+ G+RVALD  TLTI+R+LPRE+DPMVYNMS EDPG I++  IGGLNEQIRELREVIELPLKNPE+F RVGIK+PKGVLLYGPPGTGKTLLARAVAS L+ NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPC+IFMDEI
Sbjct:    1 MADPERDQALEDYKKSLLELREWEAKLRTLRLGIKDLQKEFDISEENIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKAKLRQGTRVALDMTTLTIMRMLPREVDPMVYNMSLEDPGQINFAGIGGLNEQIRELREVIELPLKNPELFQRVGIKSPKGVLLYGPPGTGKTLLARAVASSLETNFLKVVSSAIVDKYIGESARLIREMFGYAKEHEPCIIFMDEI 236          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A232LX92 (AAA domain-containing protein OS=Elaphomyces granulatus OX=519963 GN=Egran_03589 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 2.870e-122
Identity = 167/230 (72.61%), Postives = 202/230 (87.83%), Query Frame = 1
Query:   31 QKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            ++AL +YKKSLLE  + E++LR  R  I+D++KEF ++ED+IKALQS GQ+IGE++KQL +E FIVK S GPRY+VGC+  +D++KLK G+RVALD  TLTI+R+LPRE+DP+VYNMS EDPG + +  IGGLN+QIRELREVIELPLKNPE+F+RVGIK PKGVLLYGPPGTGKTLLARAVAS LD NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPC+IFMDEI
Sbjct:   10 EQALEDYKKSLLELREWEAKLRALRLGIKDVQKEFDITEDNIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKLKQGTRVALDMTTLTIMRMLPREVDPLVYNMSLEDPGQVSFAGIGGLNDQIRELREVIELPLKNPELFMRVGIKPPKGVLLYGPPGTGKTLLARAVASSLDTNFLKVVSSAIVDKYIGESARLIREMFGYAKEHEPCIIFMDEI 239          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: K9FG86 (Proteasome regulatory particle subunit Rpt4, putative OS=Penicillium digitatum (strain Pd1 / CECT 20795) OX=1170230 GN=PDIP_68600 PE=3 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 4.295e-122
Identity = 166/229 (72.49%), Postives = 204/229 (89.08%), Query Frame = 1
Query:   34 KALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +AL +YKKSLLE  + E++L+T R  I+D+++EF +SED+IKALQS GQ+IGE++KQL +E FIVK S GPRY+VGC+  +D++K+K G+RVALD  TLTI+R+LPRE+DPMVYNMS EDPG++++  IGGLN+QIRELREVIELPLKNPE+F+RVGIK PKGVLLYGPPGTGKTLLARAVAS L+ NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPC+IFMDEI
Sbjct:    8 QALEDYKKSLLELREWEAKLKTLRLGIKDLQREFDISEDNIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKMKQGTRVALDMTTLTIMRMLPREVDPMVYNMSLEDPGSVNFAGIGGLNDQIRELREVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVASSLETNFLKVVSSAIVDKYIGESARLIREMFGYAKEHEPCIIFMDEI 236          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: K9FL66 (Proteasome regulatory particle subunit Rpt4, putative OS=Penicillium digitatum (strain PHI26 / CECT 20796) OX=1170229 GN=PDIG_59160 PE=3 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 4.295e-122
Identity = 166/229 (72.49%), Postives = 204/229 (89.08%), Query Frame = 1
Query:   34 KALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +AL +YKKSLLE  + E++L+T R  I+D+++EF +SED+IKALQS GQ+IGE++KQL +E FIVK S GPRY+VGC+  +D++K+K G+RVALD  TLTI+R+LPRE+DPMVYNMS EDPG++++  IGGLN+QIRELREVIELPLKNPE+F+RVGIK PKGVLLYGPPGTGKTLLARAVAS L+ NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPC+IFMDEI
Sbjct:    8 QALEDYKKSLLELREWEAKLKTLRLGIKDLQREFDISEDNIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKMKQGTRVALDMTTLTIMRMLPREVDPMVYNMSLEDPGSVNFAGIGGLNDQIRELREVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVASSLETNFLKVVSSAIVDKYIGESARLIREMFGYAKEHEPCIIFMDEI 236          
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Match: A0A0A2L9J7 (ATPase, AAA-type, core OS=Penicillium italicum OX=40296 GN=PITC_089710 PE=3 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 5.462e-122
Identity = 166/229 (72.49%), Postives = 204/229 (89.08%), Query Frame = 1
Query:   34 KALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +AL +YKKSLLE  + E++L+T R  I+D+++EF VSED+IKALQS GQ+IGE++KQL +E FIVK S GPRY+VGC+  +D++K+K G+RVALD  TLTI+R+LPRE+DPMVYNMS EDPG++++  IGGLN+QIRELREVIELPLKNPE+F+RVGIK PKGVLLYGPPGTGKTLLARAVAS ++ NFLKVVSS+IVDK+IGESAR+IREMF YAKEHEPC+IFMDEI
Sbjct:    8 QALEDYKKSLLELREWEAKLKTLRLGIKDLQREFDVSEDNIKALQSVGQIIGEVLKQLDEERFIVKASSGPRYVVGCRSKVDKSKMKQGTRVALDMTTLTIMRMLPREVDPMVYNMSLEDPGSVNFAGIGGLNDQIRELREVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAVASSMETNFLKVVSSAIVDKYIGESARLIREMFGYAKEHEPCIIFMDEI 236          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 342.043 bits (876), Expect = 1.115e-117
Identity = 156/233 (66.95%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D+ +K L +Y+K LLE+ +I+  L+  R +++++ K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DSREKGLQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:103029726])

HSP 1 Score: 295.819 bits (756), Expect = 6.333e-100
Identity = 135/180 (75.00%), Postives = 161/180 (89.44%), Query Frame = 1
Query:  181 VIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            ++GE++KQLT+E FIVK + GPRY+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:   32 IVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKTKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 211          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 188.734 bits (478), Expect = 1.393e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 251          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 173.711 bits (439), Expect = 5.771e-52
Identity = 87/182 (47.80%), Postives = 122/182 (67.03%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV+     L+ C        +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   62 GSYVGEVVRAMDKKKVLVKVNI----LLYCW-------VTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 232          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:103027731])

HSP 1 Score: 171.4 bits (433), Expect = 4.335e-51
Identity = 85/182 (46.70%), Postives = 118/182 (64.84%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV+                      RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRAMDKKKVLVKVT-------------------PNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 232          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6547])

HSP 1 Score: 191.43 bits (485), Expect = 2.486e-59
Identity = 93/210 (44.29%), Postives = 141/210 (67.14%), Query Frame = 1
Query:   91 LRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            LR  + +  ++  + ++  + ++ LQ  G  +GE++K +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE +R++RE+F  A+EH P +IFMDEI
Sbjct:   46 LRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEI 255          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006168.1 (pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-1 gene:ENSPMAG00000005566.1 transcript:ENSPMAT00000006168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 4.936e-50
Identity = 80/202 (39.60%), Postives = 132/202 (65.35%), Query Frame = 1
Query:  115 RDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            ++++KE+  +++ +K +QS   VIG+ ++ +   T IV  + G  Y V    +IDR  LK  + VAL   +  ++ VLP E D  +  ++A+   ++ Y  IGG++ Q +E+RE +ELPL + +++ ++GI  P+GVL+YGPPG GKT+LA+AVA    A F++VV S  V K++GE  R++R++F  AKE+ P +IF+DEI
Sbjct:   21 KNLKKEYLHAQEEVKRIQSIPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNALVDVLPPEADSSITMLTADQKPDVTYVDIGGMDIQKQEVREAVELPLTHFDLYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI 222          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001244.1 (pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 gene:ENSPMAG00000001115.1 transcript:ENSPMAT00000001244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 4.102e-45
Identity = 77/170 (45.29%), Postives = 112/170 (65.88%), Query Frame = 1
Query:  211 DETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D  +I+ V    +++V     +    ++ G RV +D     I   LP +IDP V  M  E+  ++ Y+ +GG  EQI +LREV+E PL +PE FV +GI+ PKGVLL+GPPGTGKTL ARAVA++ DA F++V+ S +V K++GE AR++RE+F  A++   C+IF DEI
Sbjct:  118 DAKYIINVKQFAKFVVDLGDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARKA--CLIFFDEI 285          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010299.1 (pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene:ENSPMAG00000009320.1 transcript:ENSPMAT00000010299.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.747 bits (369), Expect = 4.504e-42
Identity = 75/177 (42.37%), Postives = 108/177 (61.02%), Query Frame = 1
Query:  190 ELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +L  Q   +  ++K S    Y +     +D  KLK G  V ++  +  I+  LP E D  V  M  ++     Y+ +GGL++QI+EL E I LP+ + E F  +GI+ PKGVL+YGPPGTGKTLLARA A+Q  A FLK+    +V  FIG+ A+++R+ FA AKE  P +IF+DE+
Sbjct:   88 DLDSQRKGKCAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDVGGLDKQIQELVEAIVLPMTHKERFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPTIIFIDEL 264          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Match: vcp (valosin containing protein [Source:NCBI gene;Acc:327197])

HSP 1 Score: 109.768 bits (273), Expect = 7.416e-29
Identity = 46/107 (42.99%), Postives = 74/107 (69.16%), Query Frame = 1
Query:  400 NIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            N+ +  IGGL    REL+E+++ P+++PE F++ G+   KGVL YGPPG GKTLLA+A+A++  ANF+ +    ++  + GES   +R++F  A++  PCV+F DE+
Sbjct:  130 NVTWEDIGGLESVKRELQELVQYPVEHPEKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVRDVFDKARQAAPCVLFFDEL 236          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT4 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in degradation of ubiquitinated substrates; contributes preferentially to ERAD; required for spindle pole body duplication; mainly nuclear localization [Source:SGD;Acc:S000005785])

HSP 1 Score: 322.013 bits (824), Expect = 3.655e-110
Identity = 151/234 (64.53%), Postives = 193/234 (82.48%), Query Frame = 1
Query:   19 HDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
             +A  KAL+++K+ LLE+ + + +L+  R  IRD+EK +  +E+ IKALQS GQ+IGE++K+L++E +IVK S GPRY+VG + S+DR+KLK G RV LD  TLTI+R+LPRE DP+VYNM++ + G I ++ IGGL EQIRELREVIELPLKNPEIF RVGIK PKGVLLYGPPGTGKTLLA+AVA+ + ANF+   +S IVDK+IGESAR+IREMFAYAKEHEPC+IFMDE+
Sbjct:   50 QEAHNKALNQFKRKLLEHRRYDDQLKQRRQNIRDLEKLYDKTENDIKALQSIGQLIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETDPLVYNMTSFEQGEITFDGIGGLTEQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDEV 283          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT6 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; bound by ubiquitin-protein ligases Ubr1p and Ufd4p; localized mainly to the nucleus throughout the cell cycle; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003016])

HSP 1 Score: 187.578 bits (475), Expect = 5.085e-58
Identity = 90/192 (46.88%), Postives = 132/192 (68.75%), Query Frame = 1
Query:  145 EDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +D ++ LQ  G  +GE+IK ++D+  +VKV    +Y+V   K I+   LK+  RV L + +  + +VL  + DP+V  M  E   +  Y+ +GGL +QI+E++EVIELP+K+PE+F  +GI  PKGV+LYGPPGTGKTLLARAVA   D  F++V  + +V K+IGE +R++RE+F  A+EH P +IFMDEI
Sbjct:   59 KDELRLLQEPGSYVGEVIKIVSDKKVLVKVQPEGKYIVDVAKDINVKDLKASQRVCLRSDSYMLHKVLENKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEI 250          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 160.614 bits (405), Expect = 3.175e-47
Identity = 74/167 (44.31%), Postives = 112/167 (67.07%), Query Frame = 1
Query:  220 FIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +++ +    +++VG  + +    ++ G RV +D     I   LP  IDP V  M+ E+  ++ Y+ +GG  +QI +LREV+ELPL +PE F  +GI  PKG+LLYGPPGTGKTL ARAVA++ DA F++V+ S +V K++GE AR++RE+F  A+  + C+IF DEI
Sbjct:  145 YVINLKQIAKFVVGLGERVSPTDIEEGMRVGVDRSKYNIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGCKDQIEKLREVVELPLLSPERFATLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGEGARMVRELFEMARTKKACIIFFDEI 311          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT2 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for normal peptide hydrolysis by the core 20S particle; N-myristoylation of Rpt2p at Gly2 is involved in regulating the proper intracellular distribution of proteasome activity by controlling the nuclear localization of the 26S proteasome [Source:SGD;Acc:S000002165])

HSP 1 Score: 157.918 bits (398), Expect = 2.360e-46
Identity = 79/186 (42.47%), Postives = 118/186 (63.44%), Query Frame = 1
Query:  163 LQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            ++ N   IG L + + D+  IV     P Y V     +D+  L+ G  V L   T++I+ VL  + DPMV  M  +      Y+ IGGL  QI+E++E +ELPL +PE++  +GIK PKGV+LYG PGTGKTLLA+AVA+Q  A FL++V S ++ K++G+  R+ R++F  A E+ P ++F+DEI
Sbjct:   99 IRGNPLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEI 284          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Match: RPT3 (ATPase of the 19S regulatory particle of the 26S proteasome; one of ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; substrate of N-acetyltransferase B [Source:SGD;Acc:S000002802])

HSP 1 Score: 157.532 bits (397), Expect = 2.672e-46
Identity = 75/202 (37.13%), Postives = 128/202 (63.37%), Query Frame = 1
Query:  115 RDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            R +++E + +++ +K +QS   VIG+ ++ +   T IV  + G  Y+V    ++DR  LK    VAL   +  ++ +LP + D  +  M   +  ++ Y  +GGL+ Q +E+RE +ELPL   +++ ++GI  P+GVLLYGPPGTGKT+L +AVA+   A F++V  S  V K++GE  R++R++F  A+E+ P +IF+DE+
Sbjct:   73 RHLKRELKRAQEEVKRIQSVPLVIGQFLEPIDQNTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGKTMLVKAVANSTKAAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEV 274          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO34160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ60])

HSP 1 Score: 349.747 bits (896), Expect = 3.855e-121
Identity = 161/232 (69.40%), Postives = 200/232 (86.21%), Query Frame = 1
Query:   25 AEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            A +KAL EYKK LLE+ ++++ L+  R +++D  KE+  SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D+ KLK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPGNI Y+ +GGL+EQIRELREVIELPL NPE+F RVGI  PKG LL+GPPGTGKTLLARAVASQLDANFLKVVSS+IVDK+IGESAR+IREMF YA++HEPC+IFMDEI
Sbjct:    6 AREKALLEYKKKLLEHRELDARLKEMREQLKDFTKEYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQVDKAKLKQGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPKGCLLFGPPGTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFGYARDHEPCIIFMDEI 237          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO49524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGH4])

HSP 1 Score: 191.815 bits (486), Expect = 2.323e-59
Identity = 95/215 (44.19%), Postives = 141/215 (65.58%), Query Frame = 1
Query:   76 KIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            ++E++      K+R + +E Q+       LQ  G  +GE++K +  +  +VKV    +++V   K ID  ++    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  +GGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   +  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   36 RLEAQRNELNAKVRMLREELQL-------LQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDIDKGIDMAEVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 243          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO26554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBQ1])

HSP 1 Score: 167.162 bits (422), Expect = 1.920e-50
Identity = 87/226 (38.50%), Postives = 143/226 (63.27%), Query Frame = 1
Query:   49 YKK--SLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            YKK    LE+ +++ E    + + ++++KE   +++ +K +QS   VIG+ ++ +   T IV  + G  Y V    +ID+  LK  + VAL   +  ++ +LP E D  +  ++ E+  N+ Y  IGG++ Q +E+RE +ELPL + E++ ++GI  P+GVLLYGPPG GKT+LA+AVA    A F++VV S  V K++GE  R++R++F  AKE+ P +IF+DEI
Sbjct:   17 YKKLEKQLEFLEVQEEY--IKDEQKNLKKELLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI 240          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO29929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T284])

HSP 1 Score: 165.236 bits (417), Expect = 3.971e-50
Identity = 83/214 (38.79%), Postives = 130/214 (60.75%), Query Frame = 1
Query:   79 IESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +E E    + +++  E++ +     +  L+     +G L + + D   IV  S G  + V     +D++ L+ G  V L+     ++ VL  + DPMV  M  E      Y  IGGL+ QI+E++E +ELPL +PE++  +GIK PKGV+LYG PGTGKTLLA+AVA+Q  A FL+VV S ++ K++G+  +++REMF  A+EH P ++F+DEI
Sbjct:   75 MEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCTVLLNHKVHAVVGVLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPPKGVILYGQPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVAEEHAPSIVFIDEI 288          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Match: EDO43481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL2])

HSP 1 Score: 167.162 bits (422), Expect = 1.188e-49
Identity = 87/226 (38.50%), Postives = 143/226 (63.27%), Query Frame = 1
Query:   49 YKK--SLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            YKK    LE+ +++ E    + + ++++KE   +++ +K +QS   VIG+ ++ +   T IV  + G  Y V    +ID+  LK  + VAL   +  ++ +LP E D  +  ++ E+  N+ Y  IGG++ Q +E+RE +ELPL + E++ ++GI  P+GVLLYGPPG GKT+LA+AVA    A F++VV S  V K++GE  R++R++F  AKE+ P +IF+DEI
Sbjct:   43 YKKLEKQLEFLEVQEEY--IKDEQKNLKKELLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVASTTGSNYYVRILSTIDKELLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPPRGVLLYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI 266          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc6 (proteasome 26S subunit, ATPase 6 [Source:NCBI gene;Acc:101172300])

HSP 1 Score: 343.584 bits (880), Expect = 2.597e-118
Identity = 157/233 (67.38%), Postives = 200/233 (85.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            D  +KAL +Y+K LLE+ +++  L+  R ++RD  K+++ SE+ +KALQS GQ++GE++KQLT+E FIVK + GPRY+VGC++ +D+++LK G+RVALD  TLTI+R LPRE+DP+VYNMS EDPG++ Y+ IGGL+EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLD NFLKVVSSSIVDK+IGESAR+IREMF YA++H+PC+IFMDEI
Sbjct:    3 DTREKALQDYRKKLLEHKEVDGRLKELREQLRDQTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSQLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGSVSYSEIGGLSEQIRELREVIELPLTNPELFQRVGIIPPKGCLLYGPPGTGKTLLARAVASQLDCNFLKVVSSSIVDKYIGESARLIREMFNYARDHQPCIIFMDEI 235          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 187.578 bits (475), Expect = 2.718e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   62 GSYVGEVVRVMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 243          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc5 (proteasome 26S subunit, ATPase 5 [Source:NCBI gene;Acc:101158979])

HSP 1 Score: 187.578 bits (475), Expect = 3.257e-57
Identity = 90/182 (49.45%), Postives = 127/182 (69.78%), Query Frame = 1
Query:  175 GQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            G  +GE+++ +  +  +VKV    +++V   K+ID N +    RVAL   + T+ ++LP ++DP+V  M  E   +  Y  IGGL++QI+E++EVIELP+K+PE+F  +GI  PKGVLLYGPPGTGKTLLARAVA   D  F++V  S +V KFIGE AR++RE+F  A+EH P +IFMDEI
Sbjct:   70 GSYVGEVVRVMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEI 251          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc4 (proteasome 26S subunit, ATPase 4 [Source:NCBI gene;Acc:101162317])

HSP 1 Score: 169.859 bits (429), Expect = 2.729e-50
Identity = 87/226 (38.50%), Postives = 142/226 (62.83%), Query Frame = 1
Query:   43 SEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            S YKK   E   +E +    + + ++++KEF  +++ +K +QS   VIG+ ++ +   T IV  + G  Y V    +IDR  LK  + VAL   +  ++ VLP E D  +  ++++   ++ Y  IGG++ Q +E+RE +ELPL + E++ ++GI  P+GVL+YGPPG GKT+LA+AVA    A F++VV S  V K++GE  R++R++F  AKE+ P +IF+DEI
Sbjct:   41 SRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNALVDVLPPEADSSIMMLTSDQKPDVMYADIGGMDIQKQEVREAVELPLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVAHHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEI 266          
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Match: psmc1a (proteasome 26S subunit, ATPase 1 [Source:NCBI gene;Acc:101161360])

HSP 1 Score: 166.007 bits (419), Expect = 1.776e-48
Identity = 84/218 (38.53%), Postives = 133/218 (61.01%), Query Frame = 1
Query:   67 EYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +Y  +E E    + +++ +E++ +     +  L+     +G L + + D   IV  S G  + V     +D++ L+ G  V L+     +I VL  + DP+V  M  E      Y  IGGL+ QI+E++E +ELPL +PE +  +GIK PKGV+LYGPPGTGKTLLA+AVA+Q  A FL+VV S ++ K++G+  +++RE+F  A+EH P ++F+DEI
Sbjct:   73 DYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDLLEPGCSVLLNHKVHAVIGVLMDDTDPLVTVMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEI 290          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000047180.1 (SMESG000047180.1)

HSP 1 Score: 479.945 bits (1234), Expect = 2.583e-172
Identity = 236/236 (100.00%), Postives = 236/236 (100.00%), Query Frame = 1
Query:   13 MVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            MVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI
Sbjct:    1 MVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 236          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000035469.1 (SMESG000035469.1)

HSP 1 Score: 353.984 bits (907), Expect = 2.002e-122
Identity = 162/233 (69.53%), Postives = 207/233 (88.84%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +A +K L+++K+ L+E+ +IE++L+  R K+RD+ KE++ SE+ +KALQS GQ++G+++KQLT++ FIVK S GPRY+VGC++++D+ KLK+G+RVALD  TLTI+R LPRE+DP+VYNMSAEDPG+++Y SIGGL EQIRELREVIELPL NPE+F RVGI  PKG LLYGPPGTGKTLLARAVASQLDANFLKVVSS IVDK+IGESAR+IREMF+YA++HEPCVIFMDEI
Sbjct:   10 NAREKILNDHKRKLIEHREIETKLKEAREKLRDLSKEYEKSENDLKALQSVGQIVGDVLKQLTEDHFIVKASNGPRYVVGCRRNLDKTKLKAGTRVALDMTTLTIMRYLPREVDPLVYNMSAEDPGDVNYTSIGGLAEQIRELREVIELPLLNPELFQRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFLKVVSSGIVDKYIGESARLIREMFSYARDHEPCVIFMDEI 242          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000047188.1 (SMESG000047188.1)

HSP 1 Score: 320.087 bits (819), Expect = 2.218e-109
Identity = 151/233 (64.81%), Postives = 196/233 (84.12%), Query Frame = 1
Query:   22 DAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            +A +K L+++K+ L+E+ +IE++L+  R K+RD+ KE++ SE+ +KALQS GQ++G+++KQLT++ FIVK S GPRY+VGC++++D+ KLK+G+RVALD  TLTI+R LPRE+DP+VYNMSAEDPG+++Y SIGGL EQIRELREVIELPL NPE+F RV              GTGKTLLARAVASQLDANFLKVVSS IVDK+IGESAR+IREMF+YA++HEPCVIFMDEI
Sbjct:   10 NAREKILNDHKRKLIEHREIETKLKEAREKLRDLSKEYEKSENDLKALQSVGQIVGDVLKQLTEDHFIVKASNGPRYVVGCRRNLDKTKLKAGTRVALDMTTLTIMRYLPREVDPLVYNMSAEDPGDVNYTSIGGLAEQIRELREVIELPLLNPELFQRV--------------GTGKTLLARAVASQLDANFLKVVSSGIVDKYIGESARLIREMFSYARDHEPCVIFMDEI 228          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000062610.1 (SMESG000062610.1)

HSP 1 Score: 315.849 bits (808), Expect = 1.754e-107
Identity = 145/227 (63.88%), Postives = 185/227 (81.50%), Query Frame = 1
Query:   40 LSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            + +++K ++ +S++ +E +  R K+RD EKE +  ED   A Q+ G ++ E++K++TDE ++VKV  G R++VGC+ +I +NKL   SRV LD  TLTI+RVLPRE++  VY M+ EDPG+++Y SIGGL+EQIR+LREVIELPLKNPEIF RVGIK PKG LLYGPPGTGKTLLARAVA QLD NF+KVVSSSIVDK+IGESAR++REMFAYAK HEPCVIFMDEI
Sbjct:   14 IEQWRKKVILHSQVATESKNLRLKLRDAEKEHEKYEDQSNAFQTVGHLVAEILKKITDEKYVVKVCGGSRFIVGCRAAISKNKLTESSRVTLDMNTLTIMRVLPREVNEKVYKMTMEDPGDVNYQSIGGLSEQIRQLREVIELPLKNPEIFERVGIKPPKGCLLYGPPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEI 240          
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Match: SMESG000075089.1 (SMESG000075089.1)

HSP 1 Score: 311.612 bits (797), Expect = 8.953e-106
Identity = 140/227 (61.67%), Postives = 187/227 (82.38%), Query Frame = 1
Query:   40 LSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSEDHIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSGSRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIRELREVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANFLKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI 720
            + +++K ++ +S++ ++ +T+R K++D EKE +  E+   A Q+ G ++ E++K++TD+ ++VKV  G R++VGC+ +I +NKL   +RV LD  TLTI++VLPRE++  VY M+ EDPG+++Y SIGGL+EQIR+LREVIELPLKNPEIF RVGIK PKG LLYGPPGTGKTLLARAVA QLD NF+KVVSSSIVDK+IGESAR++REMFAYAK HEPCVIFMDEI
Sbjct:   14 IEQWRKKVILHSQVATQSKTSRLKLKDAEKEHERYENQSNAFQTVGHLVAEILKKITDDKYVVKVCGGSRFIVGCRAAISKNKLTESARVTLDMNTLTIMKVLPREVNEKVYKMTTEDPGDVNYQSIGGLSEQIRQLREVIELPLKNPEIFERVGIKPPKGCLLYGPPGTGKTLLARAVAKQLDCNFVKVVSSSIVDKYIGESARIVREMFAYAKSHEPCVIFMDEI 240          
The following BLAST results are available for this feature:
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMC69.522e-12067.81proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC62.748e-11867.81proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC65.151e-11866.39proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC61.687e-9659.91proteasome 26S subunit, ATPase 6 [Source:HGNC Symb... [more]
PSMC51.058e-5849.45proteasome 26S subunit, ATPase 5 [Source:HGNC Symb... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpt-43.125e-11364.98Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-43.278e-11364.98Probable 26S proteasome regulatory subunit 10B [S... [more]
rpt-62.916e-6243.75Proteasome Regulatory Particle, ATPase-like [Sour... [more]
F56F11.47.553e-5841.18pep chromosome:WBcel235:III:2858558:2865497:1 gene... [more]
F56F11.47.553e-5841.18pep chromosome:WBcel235:III:2858709:2865386:1 gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpt43.472e-11969.87gene:FBgn0028685 transcript:FBtr0305495[more]
Rpt4R4.754e-11767.38gene:FBgn0036224 transcript:FBtr0346545[more]
Rpt4R4.754e-11767.38gene:FBgn0036224 transcript:FBtr0076040[more]
Rpt66.780e-5943.81gene:FBgn0020369 transcript:FBtr0077189[more]
Rpt6R1.938e-5548.35gene:FBgn0039788 transcript:FBtr0085680[more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc61.273e-11667.39proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.273e-11667.39proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc61.273e-11667.39proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc62.170e-5857.04proteasome 26S subunit, ATPase 6 [Source:ZFIN;Acc:... [more]
psmc51.608e-5749.45proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc65.158e-11866.39proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc61.010e-8876.69proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc61.135e-8653.36proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
map72.736e-5749.45microtubule associated protein 7 [Source:Xenbase;A... [more]
map73.289e-5749.45microtubule associated protein 7 [Source:Xenbase;A... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmc61.887e-11867.81proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc51.337e-5749.45protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc52.196e-5749.45protease (prosome, macropain) 26S subunit, ATPase ... [more]
Psmc44.417e-5038.50proteasome (prosome, macropain) 26S subunit, ATPas... [more]
Psmc11.362e-4838.53protease (prosome, macropain) 26S subunit, ATPase ... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62334|PRS10_MOUSE1.320e-11767.8126S proteasome regulatory subunit 10B OS=Mus muscu... [more]
sp|P62335|PRS10_ICTTR1.320e-11767.8126S proteasome regulatory subunit 10B OS=Ictidomys... [more]
sp|P62333|PRS10_HUMAN1.320e-11767.8126S proteasome regulatory subunit 10B OS=Homo sapi... [more]
sp|Q2KIW6|PRS10_BOVIN1.409e-11767.8126S proteasome regulatory subunit 10B OS=Bos tauru... [more]
sp|O74445|PRS10_SCHPO3.970e-11569.30Probable 26S proteasome subunit rpt4 OS=Schizosacc... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L9W0701.590e-12272.03AAA domain-containing protein OS=Aspergillus glauc... [more]
A0A232LX922.870e-12272.61AAA domain-containing protein OS=Elaphomyces granu... [more]
K9FG864.295e-12272.49Proteasome regulatory particle subunit Rpt4, putat... [more]
K9FL664.295e-12272.49Proteasome regulatory particle subunit Rpt4, putat... [more]
A0A0A2L9J75.462e-12272.49ATPase, AAA-type, core OS=Penicillium italicum OX=... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc61.115e-11766.95proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc66.333e-10075.00proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc51.393e-5749.45proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc55.771e-5247.80proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc54.335e-5146.70proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc52.486e-5944.29proteasome 26S subunit, ATPase 5 [Source:ZFIN;Acc:... [more]
ENSPMAT00000006168.14.936e-5039.60pep scaffold:Pmarinus_7.0:GL486395:211235:217029:-... [more]
ENSPMAT00000001244.14.102e-4545.29pep scaffold:Pmarinus_7.0:GL482260:6416:9764:-1 ge... [more]
ENSPMAT00000010299.14.504e-4242.37pep scaffold:Pmarinus_7.0:GL479893:343:6144:1 gene... [more]
vcp7.416e-2942.99valosin containing protein [Source:NCBI gene;Acc:3... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RPT43.655e-11064.53ATPase of the 19S regulatory particle of the 26S p... [more]
RPT65.085e-5846.88ATPase of the 19S regulatory particle of the 26S p... [more]
RPT13.175e-4744.31ATPase of the 19S regulatory particle of the 26S p... [more]
RPT22.360e-4642.47ATPase of the 19S regulatory particle of the 26S p... [more]
RPT32.672e-4637.13ATPase of the 19S regulatory particle of the 26S p... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO341603.855e-12169.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495242.323e-5944.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265541.920e-5038.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299293.971e-5038.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434811.188e-4938.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmc62.597e-11867.38proteasome 26S subunit, ATPase 6 [Source:NCBI gene... [more]
psmc52.718e-5749.45proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc53.257e-5749.45proteasome 26S subunit, ATPase 5 [Source:NCBI gene... [more]
psmc42.729e-5038.50proteasome 26S subunit, ATPase 4 [Source:NCBI gene... [more]
psmc1a1.776e-4838.53proteasome 26S subunit, ATPase 1 [Source:NCBI gene... [more]
back to top
BLAST of 26S proteasome regulatory subunit 10B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047180.12.583e-172100.00SMESG000047180.1[more]
SMESG000035469.12.002e-12269.53SMESG000035469.1[more]
SMESG000047188.12.218e-10964.81SMESG000047188.1[more]
SMESG000062610.11.754e-10763.88SMESG000062610.1[more]
SMESG000075089.18.953e-10661.67SMESG000075089.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010841 ID=SMED30010841|Name=26S proteasome regulatory subunit 10B|organism=Schmidtea mediterranea sexual|type=transcript|length=720bp
TTTTTTATTGCAATGGTACATGATGCAGAACAAAAGGCCTTATCTGAATA
TAAAAAAAGTTTATTAGAATACAGTAAAATTGAATCAGAATTAAGAACCA
CCAGATTTAAAATTCGAGATATAGAAAAAGAATTCCAAGTTTCTGAAGAT
CATATCAAAGCACTACAAAGTAATGGACAGGTTATTGGAGAACTAATTAA
GCAACTGACGGATGAAACTTTTATTGTTAAAGTCAGTTGTGGACCTCGTT
ATCTAGTGGGATGCAAGAAATCTATTGATCGAAATAAACTTAAATCTGGT
TCTAGAGTAGCCCTTGATACAATGACTTTGACAATAATAAGAGTACTTCC
ACGAGAAATAGATCCGATGGTCTATAATATGTCAGCAGAAGATCCTGGAA
ATATTGATTATAATTCTATTGGTGGATTAAACGAACAAATCAGAGAATTG
AGAGAAGTCATAGAATTACCTTTAAAAAATCCCGAAATTTTTGTGAGAGT
TGGCATAAAAGCACCCAAAGGTGTATTACTTTATGGTCCCCCAGGAACTG
GGAAAACACTTTTAGCTAGGGCTGTTGCGTCACAGCTTGATGCAAACTTT
TTGAAAGTCGTTTCAAGTTCTATTGTAGACAAATTTATCGGTGAAAGTGC
CAGAGTAATTCGGGAAATGTTTGCATATGCTAAAGAGCATGAACCCTGTG
TTATATTTATGGATGAAATA
back to top

protein sequence of SMED30010841-orf-1

>SMED30010841-orf-1 ID=SMED30010841-orf-1|Name=SMED30010841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
FFIAMVHDAEQKALSEYKKSLLEYSKIESELRTTRFKIRDIEKEFQVSED
HIKALQSNGQVIGELIKQLTDETFIVKVSCGPRYLVGCKKSIDRNKLKSG
SRVALDTMTLTIIRVLPREIDPMVYNMSAEDPGNIDYNSIGGLNEQIREL
REVIELPLKNPEIFVRVGIKAPKGVLLYGPPGTGKTLLARAVASQLDANF
LKVVSSSIVDKFIGESARVIREMFAYAKEHEPCVIFMDEI
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR032501Prot_ATP_ID_OB
IPR027417P-loop_NTPase
IPR003959ATPase_AAA_core
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0019904protein domain specific binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0008540proteasome regulatory particle, base subcomplex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006289nucleotide-excision repair
GO:0006508proteolysis
GO:0030163protein catabolic process
GO:0030433ubiquitin-dependent ERAD pathway
GO:0032968positive regulation of transcription elongation from RNA polymerase II promoter
GO:0045899positive regulation of RNA polymerase II transcriptional preinitiation complex assembly
GO:0070682proteasome regulatory particle assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 37..57
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 133..239
e-value: 4.8E-41
score: 142.9
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 23..129
e-value: 1.3E-29
score: 104.2
NoneNo IPR availablePANTHERPTHR2307326S PROTEASE REGULATORY SUBUNITcoord: 7..239
NoneNo IPR availablePANTHERPTHR23073:SF3126S PROTEASOME REGULATORY SUBUNIT 10Bcoord: 7..239
NoneNo IPR availableCDDcd00009AAAcoord: 140..239
e-value: 3.20348E-17
score: 74.1047
IPR032501Proteasomal ATPase OB C-terminal domainPFAMPF16450Prot_ATP_ID_OBcoord: 62..116
e-value: 5.2E-7
score: 29.5
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 174..239
e-value: 2.0E-22
score: 80.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 132..239