AGAP003596-PA-like protein

Overview
NameAGAP003596-PA-like protein
Smed IDSMED30010838
Length (bp)2310
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AGAP003596-PA-like protein (SMED30010838) t-SNE clustered cells

Violin plots show distribution of expression levels for AGAP003596-PA-like protein (SMED30010838) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AGAP003596-PA-like protein (SMED30010838) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AGAP003596-PA-like protein (SMED30010838) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010838

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30010838SMESG000029629.1 SMESG000029624.1 SMESG000029622.1 SMESG000012817.1 dd_Smed_v4_4842_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30010838SMESG000029624.1 SMESG000029622.1 DN313153ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30010838SMESG000029624.1 SMESG000029622.1 DN313153ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
zeta neoblastSMED30010838SMESG000029629.1 SMESG000029624.1 SMESG000029622.1 SMESG000012817.1 dd_Smed_v4_4842_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Match: Y41E3.1 (pep chromosome:WBcel235:IV:14954206:14958914:-1 gene:WBGene00012762.1 transcript:Y41E3.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.1)

HSP 1 Score: 277.715 bits (709), Expect = 1.387e-82
Identity = 173/525 (32.95%), Postives = 268/525 (51.05%), Query Frame = 2
Query:  689 NYFIVSCHRNEQ---YVITAVKDENLINKYQSTLGNKT-----KPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDD-FDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRN------ILPTLKANADILTSALDFHATLEDFIGL----------YKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLV-KVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            +Y  +SC +  Q    ++  V DE  I++    +  +      KP +V  +G DSLS  SFR  LP+T     E L  V    +N  GDGT       LT   +TE   TRKR   +  VDD + +I+K+Y+  GYVT++ E+    GTF YRL GF +QPTD Y RT     E     N  C G+ P H  + +    F K YE +P+F  +   ++SHD    +   D +LS  +  +       ++++ + +DHGHRF   R T +G+ EER+PFF +SLP+++RN      +   L+ NA+ LTS  D HA+L D + L           + +   R +S+ +P+PVDR C      PHWC+CL+WK+  +   D+KL  ++AN +   I+     ++ LC+ L L +I+ A +L  +K +L +K   D DGFV DLS   K     Y++ L  +PG   +EVT +  D      + + G+     +S VN++     C+     K++ ++    FC+C D
Sbjct:  170 DYATISCIQGFQKWKSILWDVNDEPEIHERARKMRKEQADPEKKPYNVYFLGFDSLSQMSFRRKLPQTVKFLEETLGSVVLNGYNIVGDGTPQAFIPILTAQTETELPLTRKRYKNANYVDDVYPFIWKNYSDKGYVTMYAEDAFSIGTFTYRLKGFRQQPTDHYTRTLFEEVEKLNDRN--CIGSIPLHRMWLQNGRQFMKKYEDVPRFLLMHQSLLSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVVIVMADHGHRFAKLRDTHQGQLEERMPFFSISLPKQLRNTEKGRKMEQNLRENAEKLTSPFDIHASLMDILNLSELGENELNRMQDASSKRSLSVFKPIPVDRTCSQAGIEPHWCTCLSWKDAMDTGEDRKLTRRIANAVVREINKEIVAEKDLCAPLSLAKIIDAKKLLPDKGLLAYKNVKDADGFVPDLSGSTKAAFAHYQLKLQTTPGEAIYEVTLFY-DIVRDEVKLDFGS-----MSHVNKFGDTPHCI---IDKNYYLA---TFCVCYD 680          
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Match: Y41E3.1 (pep chromosome:WBcel235:IV:14954206:14956694:-1 gene:WBGene00012762.1 transcript:Y41E3.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y41E3.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.124e-48
Identity = 103/326 (31.60%), Postives = 171/326 (52.45%), Query Frame = 2
Query: 1259 FQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRN------ILPTLKANADILTSALDFHATLEDFIGL----------YKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVK-VANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            F K YE +P+F  +   ++SHD    +   D +LS  +  +       ++++ + +DHGHRF   R T +G+ EER+PFF +SLP+++RN      +   L+ NA+ LTS  D HA+L D + L           + +   R +S+ +P+PVDR C      PHWC+CL+WK+  +   D+KL + +AN +   I+     ++ LC+ L L +I+ A +L  +K +L +K   D DGFV DLS   K     Y++ L  +PG   +EVT +  D      + + G+     +S VN++     C+     K++ ++    FC+C D
Sbjct:    9 FMKKYEDVPRFLLMHQSLLSHDDINLVGVEDEDLSAHLSHMNDEGLFDDSVVIVMADHGHRFAKLRDTHQGQLEERMPFFSISLPKQLRNTEKGRKMEQNLRENAEKLTSPFDIHASLMDILNLSELGENELNRMQDASSKRSLSVFKPIPVDRTCSQAGIEPHWCTCLSWKDAMDTGEDRKLTRRIANAVVREINKEIVAEKDLCAPLSLAKIIDAKKLLPDKGLLAYKNVKDADGFVPDLSGSTKAAFAHYQLKLQTTPGEAIYEVTLFY-DIVRDEVKLDFGS-----MSHVNKFGDTPHCI---IDKNYYLA---TFCVCYD 322          
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Match: F10C2.3 (pep chromosome:WBcel235:V:12021164:12023600:1 gene:WBGene00008644.1 transcript:F10C2.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10C2.3)

HSP 1 Score: 162.155 bits (409), Expect = 7.279e-42
Identity = 150/543 (27.62%), Postives = 236/543 (43.46%), Query Frame = 2
Query:  596 ECTYKCISWKTDFEYQLSESKTLSHLQTVP--CNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKP----GDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTK-DTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYN---NFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRF-NSRLTIEGKYEERLPFFGLSLPRKMR---NILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 2182
            EC Y+        + QL+ S+ +S   +V     +  VSC R   +  T V   N     Q    ++++P      VIVI +DS+S+ +FR  + KT    H       F      GD +  N   F  G   +TE  +           DD D I+KHY  NGY TL+ E+   +  F Y   GF+++P D Y R   L       +    N C+GN   H+    + + F   Y+  PKF+  +   + HD    + Y D +L+  +        N+ + + SDHGHRF N R T  G+ EERLPFF +SLP+K+R    ++ T++ N+  LTS  D +AT    +   K     R  SL  P+  DRNC+       +C C + +   N +++ ++  +A   A  I+   D   + C  L L            K V+   Q  D           VK+    Y+ T+ +SP N  FE     +  +S+T    +G     +++R+N+Y     C++ +         +RK C C+  L
Sbjct:  111 ECQYRTYDKMDGDDEQLNYSEWISFNMSVKIESEFVEVSCQR-AWFPRTKVYSNN---HNQIIPISRSQPVSDKSSVIVIVLDSVSHSNFRRTMNKTLDVMHSLYGSFIFDGMTKIGDNSFSNAVGFFAGKWWNTEFGDAHGYF------DDHDLIWKHYRENGYRTLYAEDYPGFNLFNYLSKGFKKKPVDHYFRPYWLNVYWTYVHRRSRNLCYGNHRMHNLQLNYLSQFVSKYKDQPKFAISWLTELGHDWLNQVRYGDEDLANFLKKHVEDLENSYLFIMSDHGHRFDNIRKTSIGRLEERLPFFSVSLPKKLRKDSKLVDTVRKNSKKLTSFFDVYATFRHILNNSKQPDVMRGESLFLPIK-DRNCETAHIPEEFCVC-DTEVPLNVSANAQIRTMAEDFAKDINQRLDPHPQ-CVQLYL------------KNVISVSQVGD-----------VKEQR--YRFTIEVSPSNAIFEALLLYDPFESQTTV--IG-----DINRINKYGNQSLCVQDQF--------LRKLCFCSTFL 600          
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Match: F15H10.7 (pep chromosome:WBcel235:V:10403184:10406424:-1 gene:WBGene00008874.1 transcript:F15H10.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F15H10.7)

HSP 1 Score: 135.191 bits (339), Expect = 1.167e-32
Identity = 96/341 (28.15%), Postives = 164/341 (48.09%), Query Frame = 2
Query:  806 VIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS--KAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYR--LNGFERQPTDFYLRTALLAA-----EGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLP----RKMRNILPTLKANADILTSALDFHATLEDF----IG-LYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVI 1771
            VI+IG+DS+S  +F   + KT+  + +E   +         D T  NL A LTG +     E    I  S   A D+FD+I+K ++ NGY TL+ E+  + GTF Y+  L GF +QPTD Y+R   ++A       R   +  C+ + P H    K+  +F + Y+   KF+F +   MSH     I  +D +  +   +      +++I ++SDHGHR++  R T+ G+ E R+PF  + +P    +K   I+  L  N+ ++T+  D + +L       +G  +  + R R  S   P P    C +      +C C +   I    + +  V++  ++
Sbjct:  197 VIMIGLDSMSRGNFVRQMQKTYK-YMKEAGFIDMEGHMKIHDNTYGNLLAILTGKRGVGVKEFSTEINESWHIAFDEFDFIWKTFSDNGYATLFAEDRPDIGTFTYKNMLEGFLKQPTDHYIRPFWISAFWSLISRRSVAS--CYDSTPQHKIQLKYLEEFLEKYDKKRKFAFWWSQDMSHGFLNLIGKVDDDFEKFFKNNEKRMEDSIIIVFSDHGHRYDKIRETVIGRIESRMPFHSIRIPDGIKKKYPQIVENLMVNSKLMTTQFDVNDSLRKIATGKVGEKWTQTDRKRSYSYFDPFPKRIGCYEAGIPSDFCPCFSEIEIPKSEAKEAAVELMRIV 534          
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Match: Y73F8A.35 (pep chromosome:WBcel235:IV:15533167:15539559:-1 gene:WBGene00013539.1 transcript:Y73F8A.35b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73F8A.35)

HSP 1 Score: 104.76 bits (260), Expect = 3.549e-23
Identity = 122/510 (23.92%), Postives = 200/510 (39.22%), Query Frame = 2
Query:  803 DVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTK---------DTE--TYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQY-RLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGN--------RPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMR---NILPTLKANADILTSALDFHATLEDFIGLYKPS----------PRSRHMSLLRPLP-VDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQD------RKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTL-LLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL*ILYLPVR 2206
            DV VI +DSL++      LP+  +     ++ V F   N  G+ +  N      G           D E  T +       ++  D+   IF  +   GY TL  E+  E GT  +    GF+  P D Y+R    A E R ++  F   N        R  H+   ++ + F   Y +  KFS+++   + HD+    S+ D +    ++  R    N+ + L  DHG RF + R T+ G+ E   PF G+S+P+ +R    IL  +K NA  L +  D  AT+ D +     +          P  +  S +R  P   RNC  +     +C C   +   + +SD     +A+ +A  +++  + +      +  C  ++ + IL   RLD      KF+                   S LY + + +  P N  F+     N     T E  V       + RVN Y         +TA   K    R +C C + + + Y   R
Sbjct:  102 DVTVILLDSLAHAQALRSLPRAISYMTSHMSAVVFPYVNKVGENSRSNGVPLWFGKSLEKLDKSLFDEEDVTVDWTHEYMCNEFKDNETSIFNEFRDYGYKTLLAEDWAE-GTLNFPNCKGFDNPPIDHYMRPFQNALE-RPHHGEFITRNHLSPGNLTREHHNTLLEYLSKFMNAYPNEKKFSWIWASHLGHDSMNGFSHADNDFYNFLVKHREKLDNSFVILMGDHGPRFGANRKTVSGELEVHNPFLGISIPKALRKTTEILSLMKGNAKKLQTHYDTRATILDILKYQSTTNFLDTEILKIPGEKGFSFIRKQPDTPRNCKTMPIPIQYCLCKFNRTTESIHSD-----LAHSMAKALTAAVNTELENGKLQSRCIKMEYSIILSLDRLDE-----KFR------------------GSILYTIVVEMKKPSNAWFK----ANIKMLSTGELKVLGI----IERVNEYG--------QTAHCIKSEYHRPYCFCRNQINVFYAQDR 565          
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Match: CG6236 (gene:FBgn0038318 transcript:FBtr0083121)

HSP 1 Score: 272.707 bits (696), Expect = 1.066e-80
Identity = 160/491 (32.59%), Postives = 256/491 (52.14%), Query Frame = 2
Query:  803 DVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNF-CFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDL--RTSNPNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGLY--------------KPSP---------RSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKK--LVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            +V++ G DSLS  +F   LP+T+    ++L       +N  GDGT   L   LTG  + E  ETRKR++G+ +VD +  I+K +   GY+T + E++   GTF YR+ GFE QP D YLRT  + AE     +   C G++P H    ++  +F   Y   P+F+F F G +SHD+   +   D ++ + ++ L  R+   + ++ + +DHG+RF   R T++GK EERLPFF    P   +   P       AN   LT+  D HATL+  I L               + SP         R R MSLL P+P +R+C D    PHWC+CLNW  +   +S     ++K A  I + I+  T + R+ C+ L+++++  A RL  +K +L+F+ +SD DGF+AD++ +      +Y++ ++  PG G FE +       + +      T +  ++SRVN+Y    +C+  R        ++RK+C C D
Sbjct:  202 NVLMFGFDSLSRNAFIRKLPRTYEYLTQQLGATVLKGYNIVGDGTPQALVPLLTGFTELELPETRKRLSGAGSVDSYPMIWKDFARLGYMTSFNEDLPNVGTFTYRMTGFEAQPVDHYLRTYYVQAEHMAAESKPNCIGHQPDHITMLEYTKNFMLKYRDAPRFAFSFHGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQGKQEERLPFFSFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEINDPKTETSPPGIRISELARGRAMSLLDPIPSNRSCADAYIEPHWCACLNWLPLQLNDSRYTGIILKAAQSIVNAINLATVEQRQYCAPLEIHRVNWALRLQPHKELLQFRTNSDRDGFLADMTGQTLVRDEMYQLQVVTMPGEGLFEASV------AYSLHTFSATTKLTDISRVNKYGNQARCIYDRD------PELRKYCYCRD 680          
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Match: CG6236 (gene:FBgn0038318 transcript:FBtr0083122)

HSP 1 Score: 272.707 bits (696), Expect = 1.066e-80
Identity = 160/491 (32.59%), Postives = 256/491 (52.14%), Query Frame = 2
Query:  803 DVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNF-CFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDL--RTSNPNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGLY--------------KPSP---------RSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKK--LVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            +V++ G DSLS  +F   LP+T+    ++L       +N  GDGT   L   LTG  + E  ETRKR++G+ +VD +  I+K +   GY+T + E++   GTF YR+ GFE QP D YLRT  + AE     +   C G++P H    ++  +F   Y   P+F+F F G +SHD+   +   D ++ + ++ L  R+   + ++ + +DHG+RF   R T++GK EERLPFF    P   +   P       AN   LT+  D HATL+  I L               + SP         R R MSLL P+P +R+C D    PHWC+CLNW  +   +S     ++K A  I + I+  T + R+ C+ L+++++  A RL  +K +L+F+ +SD DGF+AD++ +      +Y++ ++  PG G FE +       + +      T +  ++SRVN+Y    +C+  R        ++RK+C C D
Sbjct:  202 NVLMFGFDSLSRNAFIRKLPRTYEYLTQQLGATVLKGYNIVGDGTPQALVPLLTGFTELELPETRKRLSGAGSVDSYPMIWKDFARLGYMTSFNEDLPNVGTFTYRMTGFEAQPVDHYLRTYYVQAEHMAAESKPNCIGHQPDHITMLEYTKNFMLKYRDAPRFAFSFHGGLSHDSINLVGAADDDVHDWLVALKERSLLDDTILIMMADHGNRFAEVRATLQGKQEERLPFFSFVFPESFKKRFPQEYKNFLANEHHLTTPFDIHATLKHVIQLQTAVDQFGEINDPKTETSPPGIRISELARGRAMSLLDPIPSNRSCADAYIEPHWCACLNWLPLQLNDSRYTGIILKAAQSIVNAINLATVEQRQYCAPLEIHRVNWALRLQPHKELLQFRTNSDRDGFLADMTGQTLVRDEMYQLQVVTMPGEGLFEASV------AYSLHTFSATTKLTDISRVNKYGNQARCIYDRD------PELRKYCYCRD 680          
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Match: CG7120 (gene:FBgn0035888 transcript:FBtr0307376)

HSP 1 Score: 154.451 bits (389), Expect = 7.178e-39
Identity = 129/470 (27.45%), Postives = 207/470 (44.04%), Query Frame = 2
Query:  794 KPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNG-VSFTKFNTRGDGTTVNLQAFLTGTK-DTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNF-----CFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDL--RTSNPNALIALYSDHGHRFN-SRLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGL--------YKPSPRSRH-MSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDR-----KLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVN--DDQSKTAEENVGTFRPEEVSRVNRYAPWVKCL 2113
            +P  V+++GIDS+S  +    +PKT    ++  NG      +N   D T  N+ A LTG       +     + G   +D  D+I+K Y   GYVT + E+  +  TF Y   GF+  P D+YLR  L AAE +  +        C G        + +  +F + + +   F F +    SH      S MD  + E +  L  + +  N ++  +SDHG RF  +R T  G  EERLP   + LP+ +R   P    +L+ N + LT+  D H T++  + +          P+P      SLL P+   R+C D+    HWC+C  +  I++ + + ++  +   + S +++Y  + R     KLC+ L L+ I  A+R   N                A   D+V      Y++  + SP  GQ+E T   N  DD  K             VSR+N Y+    C+
Sbjct:  236 RPPSVLMLGIDSISRVNLIRAMPKTAQYLYD--NGWFELAGYNKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVG--GLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGLVHCLGYLTAAEHVYDYGLEFTRRFLNETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRM--LGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHN----------------ALDPDEVHT----YRLIFVTSPNKGQYEATLRHNHTDDSVKVT---------GSVSRLNVYSGEADCM 670          
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Match: CG7120 (gene:FBgn0035888 transcript:FBtr0307377)

HSP 1 Score: 154.451 bits (389), Expect = 7.178e-39
Identity = 129/470 (27.45%), Postives = 207/470 (44.04%), Query Frame = 2
Query:  794 KPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNG-VSFTKFNTRGDGTTVNLQAFLTGTK-DTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNF-----CFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDL--RTSNPNALIALYSDHGHRFN-SRLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGL--------YKPSPRSRH-MSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDR-----KLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVN--DDQSKTAEENVGTFRPEEVSRVNRYAPWVKCL 2113
            +P  V+++GIDS+S  +    +PKT    ++  NG      +N   D T  N+ A LTG       +     + G   +D  D+I+K Y   GYVT + E+  +  TF Y   GF+  P D+YLR  L AAE +  +        C G        + +  +F + + +   F F +    SH      S MD  + E +  L  + +  N ++  +SDHG RF  +R T  G  EERLP   + LP+ +R   P    +L+ N + LT+  D H T++  + +          P+P      SLL P+   R+C D+    HWC+C  +  I++ + + ++  +   + S +++Y  + R     KLC+ L L+ I  A+R   N                A   D+V      Y++  + SP  GQ+E T   N  DD  K             VSR+N Y+    C+
Sbjct:  236 RPPSVLMLGIDSISRVNLIRAMPKTAQYLYD--NGWFELAGYNKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVG--GLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGLVHCLGYLTAAEHVYDYGLEFTRRFLNETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRM--LGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHN----------------ALDPDEVHT----YRLIFVTSPNKGQYEATLRHNHTDDSVKVT---------GSVSRLNVYSGEADCM 670          
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Match: CG7120 (gene:FBgn0035888 transcript:FBtr0307378)

HSP 1 Score: 154.451 bits (389), Expect = 1.005e-38
Identity = 129/470 (27.45%), Postives = 207/470 (44.04%), Query Frame = 2
Query:  794 KPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNG-VSFTKFNTRGDGTTVNLQAFLTGTK-DTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNF-----CFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDL--RTSNPNALIALYSDHGHRFN-SRLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGL--------YKPSPRSRH-MSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDR-----KLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVN--DDQSKTAEENVGTFRPEEVSRVNRYAPWVKCL 2113
            +P  V+++GIDS+S  +    +PKT    ++  NG      +N   D T  N+ A LTG       +     + G   +D  D+I+K Y   GYVT + E+  +  TF Y   GF+  P D+YLR  L AAE +  +        C G        + +  +F + + +   F F +    SH      S MD  + E +  L  + +  N ++  +SDHG RF  +R T  G  EERLP   + LP+ +R   P    +L+ N + LT+  D H T++  + +          P+P      SLL P+   R+C D+    HWC+C  +  I++ + + ++  +   + S +++Y  + R     KLC+ L L+ I  A+R   N                A   D+V      Y++  + SP  GQ+E T   N  DD  K             VSR+N Y+    C+
Sbjct:  251 RPPSVLMLGIDSISRVNLIRAMPKTAQYLYD--NGWFELAGYNKVDDNTFPNIMAVLTGYNLPNAMHACSPFVVG--GLDKCDYIWKQYQQRGYVTAYAEDAVKINTFNYLKKGFKNPPADYYLRPYLSAAESQLDHTTVNGLVHCLGYLTAAEHVYDYGLEFTRRFLNETYFGFFWTNTHSHSDISQTSSMDSYMEEYLRKLVRQGTMENTVVVFFSDHGMRFGPTRATWSGHLEERLPAIFIWLPQHLRRSHPQFVRSLQLNRNRLTTPYDLHLTMKHILAISGRAEMESLGPAPDCPQCQSLLTPVSPQRSCSDVGIADHWCTCWEYDTISSTSKESRM--LGKRVVSYLNNYVAEFRNGTFAKLCAPLSLHSIKSAFRAHHN----------------ALDPDEVHT----YRLIFVTSPNKGQYEATLRHNHTDDSVKVT---------GSVSRLNVYSGEADCM 685          
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Match: A0A0L7QSC4 (Uncharacterized protein OS=Habropoda laboriosa OX=597456 GN=WH47_06048 PE=4 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 2.980e-91
Identity = 217/662 (32.78%), Postives = 324/662 (48.94%), Query Frame = 2
Query:  338 FRKSRGCLIFVTILILCLLK-----FGFN---FFNFETV--------NVKILPVSEDLQVCPIPNLFDKYPKNAKLLTD---LKC-PESENLVS-----IENGTIHKLSPHECTYK--------CISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLI---NKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKA--VDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNP--NALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILPTLKAN----ADILTSALDFHATLEDFIGLYKPSPRSRH---MSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            FR+     +FV IL+ C+++      GFN     N + +        N +   + + +  C +P L    P+  K + D   L C PE   ++      I N    K  P  C Y          IS+ T  E   S     S    V C        +    ++  V+D+  +   NK+++ +GN+    ++++ G DSLS  +F   LPKT+    E L  +    +N  GDGT   L   LTG  + E  +TRKR+ GSKA  V+ +  I+  Y  NGY+T + E++   GTF YRL GF+ QPTD Y+RT  LAA     YYN FC G+ P H     +  +    Y+  PKF F F G +SHD+   I  +D +L   I DL       N ++ L SDHGHRF   R T++GK EERLPFF    P   + + P   AN       LT+  D H TLE+ +    P    R+   +SL   +P+DR C +    PHWC+CL+W+ IA    D K +  A  +   +++YT+    +C  LKL +IL A +L  NK +L+F++S D DGFV D S K K T+ +Y++ +   PG+G FEV+       +   ++N  + +  ++SR+N Y    +C+E        +  +RK+C C D
Sbjct:    8 FRRFVITALFV-ILLFCVVQIFRSELGFNDNDLLNLDKLIRMSQLIKNTEQSHIMKGVVACKLPKLDVSNPEITKFIHDIPPLSCTPEDWVILHGSRLVISNKAKKKYGPMTCFYSEILRDDDYTISFTTPVESDDSYVLKYSDFVDVKCE---SKTGKEWHSIMAGVRDDPEVKETNKWEN-VGNQALKLNILMFGFDSLSRNTFIRKLPKTYQYLKEYLEALILEGYNIVGDGTPQALIPILTGKIELELPDTRKRM-GSKAKYVNVYPMIWNEYKKNGYITGFMEDVHHIGTFTYRLKGFKEQPTDHYMRTFYLAATPYFRYYNKFCIGSIPRHMTMLNYIKEIFNVYKHQPKFLFGFHGELSHDSYNDIGVVDNDLHNWIKDLHEFGHLNNTVLILMSDHGHRFAEIRNTLQGKQEERLPFFSFVFPPWFKKVHPEAYANFVHNTHYLTTPFDVHKTLENILNFQTPKDGDRYQRAISLFDKIPIDRTCGNAFIEPHWCACLSWQEIAI--DDDKTIAAAKYLIQFLNTYTEGHHDICEQLKLKEILWAAKLIPNKGLLEFQKSGDQDGFVGDFSAKTKLTTEIYQLKVRTEPGDGLFEVSI------TYDIKKNTFSTKISDISRINMYGSQARCVEN------SLYHLRKYCYCKD 649          
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Match: A0A0M9A6K9 (Uncharacterized protein (Fragment) OS=Melipona quadrifasciata OX=166423 GN=WN51_10377 PE=4 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.295e-90
Identity = 205/606 (33.83%), Postives = 301/606 (49.67%), Query Frame = 2
Query:  449 VSEDLQVCPIPNLFDKYPKNAKLLTD---LKC-PESENLVS-----IENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFI-VSCHRNE----QYVITAVKDENLI---NKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKA--VDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNP--NALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILPTLKAN----ADILTSALDFHATLEDFIGLYKPSP---RSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            + E +  C +P L    P+  K + D   L+C PE   ++      I N    K     C++  I    D+      +        +  + F+ V C          ++  VKD++ +   NK++  +GNK    +V++ G DSLS  +F   LPKT+    E L  +    +N  GDGT   L   LTG  + E  +TRKR+ G KA  VD +  I+  Y  N Y+T + E++   GTF YRL GF+++PTD Y+RT  LAA     YYN FC G+ P H     +  +    Y+  PKF F F G +SHD+   I  +D +L   + DL       + ++ L SDHGHRF   R T++GK EERLPFF    P   + + P   AN       LT+  D H TLE  +    P     R R +SL   +P+DR C D    PHWC+CLNW+ I+    D  ++  A      +++YT+  R +C  LK  +IL A +L  NK +LKF +S D DGF+ D S K K T+  Y++ +   PG+G FEV+  +N D     + NV + +  ++SR+N Y    KC+E        +  +RK+C C D
Sbjct:   15 IGEGVVACKLPQLDISNPEITKFIHDVPPLQCTPEDWVILHGSRLVISNKIKKKYGSLICSFSEILRDDDYNISYETAVESDDFYVLKHSDFVDVKCESKNGNKWHSIMAGVKDDSEVKEKNKWE-YVGNKALKLNVLMFGFDSLSRNTFIRKLPKTYQYLKEHLGALILKGYNIVGDGTPQALIPILTGKIELELPDTRKRM-GVKASYVDVYPMIWNQYKENNYITGFMEDVHHIGTFTYRLKGFKKEPTDHYMRTFYLAAAPYFRYYNKFCIGSIPRHMVMLNYIKEIFNVYKHQPKFLFGFHGELSHDSYNDIGVVDEDLHNWLKDLHEFGHLNDTVLILMSDHGHRFAKIRNTLQGKQEERLPFFSFIFPPWFKKVYPEAYANFVHNTHYLTTPFDVHKTLESILNFEIPKVGDRRQRAISLFDKIPLDRTCADAFIEPHWCACLNWQEISI--DDDNVIAAAKYFIQFLNTYTEDHRDICEELKFKKILWAAKLIPNKGLLKFYKSGDQDGFIGDFSAKTKLTTETYQLKVKTVPGDGLFEVS--INYD----IKNNVFSTKISDISRINMYGSQAKCVEN------SLFHLRKYCYCKD 604          
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Match: A0A087ZVH2 (Uncharacterized protein OS=Apis mellifera OX=7460 PE=4 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 4.880e-89
Identity = 202/608 (33.22%), Postives = 298/608 (49.01%), Query Frame = 2
Query:  449 VSEDLQVCPIPNLFDKYPKNAKLLTD---LKC-PESENLVS-----IENGTIHKLSPHECTYKCI--------SWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQY-VITAVKDENLINKYQ--STLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIA-GSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNP--NALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILPTLKAN----ADILTSALDFHATLEDFIGLYKPSPRSRH---MSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            + E +  C +P L    P+  K + D   L+C PE   ++      I N    K     C +  I        S+ T  E   S     S    V C     S +RNE + ++  VKD+  + +      +GNK    +V++ G DSLS  +F   LPKT+    E L+ +    +N  GDGT   L   LTG  + E  +TRKR+   +K V+ +  I+  Y  NGY+T + E++   GTF YRL GF +QPTD Y+RT  LAA     YYN FC G  P H     +  +    Y+  PKF F F G +SHD+   I  +D +    I DL       N ++ + SDHGHRF   R T++GK EERLP+F    P   + + P   AN       LT+  D H TLE+ +    P    RH   +SL   +P+DR C D    PHWC+CL+W+ I+  N +  ++  A      ++SYT+  R +C  LK+ +IL A +L  NK +LKF++S D DGF+ D S K K T+  Y++ +   PG   FEV+       +   ++N    +  ++SR+N Y    +C+E        +  +RK+C C +
Sbjct:   60 IGEGIVACKLPQLDVSNPEITKFIHDVSPLQCTPEDWVILRGSRLVISNKAKKKYGSITCLFSEILRDDDYNVSFMTPIESDDSYVLKYSDFVDVKCE----SKNRNEWHSIMVGVKDDPKVKEKSKWENVGNKALKLNVLMFGFDSLSRNTFIRKLPKTYQYLKEYLDALILEGYNIVGDGTPQALIPILTGKIELELPDTRKRMGLKAKYVNVYPMIWNQYKENGYITGFMEDVHHIGTFTYRLKGFNKQPTDHYMRTFYLAATPYFRYYNKFCIGGIPRHMVMLNYIKEIFNVYKHQPKFVFGFHGELSHDSYNDIGMVDEDFYNWIKDLHEFGHLNNTVLIIMSDHGHRFAEIRNTLQGKQEERLPYFSFVFPLWFKKVYPEAYANFLHNTRYLTTPFDIHKTLENILNFETPKIGDRHQRAISLFDKIPLDRTCADAFIEPHWCACLSWQEISIDNDN--VIAAAKYFIQFLNSYTEDHRDICEKLKIKEILWAAKLIPNKGLLKFQKSGDQDGFIGDFSAKTKLTTETYQLKVKTEPGAALFEVSI------TYDIKKNSFLTKISDISRINMYGSQARCVEN------SLFHLRKYCYCKN 649          
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Match: Q7QAP4 (AGAP003596-PA OS=Anopheles gambiae OX=7165 GN=AgaP_AGAP003596 PE=4 SV=5)

HSP 1 Score: 303.138 bits (775), Expect = 5.307e-89
Identity = 201/642 (31.31%), Postives = 327/642 (50.93%), Query Frame = 2
Query:  350 RGCLIFVTI-LILCLLKFGFNFFNFETVNVKILPVSEDLQ------VCPIPNLFDKYPKNAKLLTD---LKC-PESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFI-VSC---HRNEQY---VITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYE-SIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLP----RKMRNILPTLKANADILTSALDFHATLEDFIGLY----KPSPR-SRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADL-SDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            R  L  +TI ++  LL   FN  ++     K++ + E ++       C +P+L    P+    L D   ++C  E ++ V+ E   I +     C Y  I  K+DF+    E+   S   T+  + F+   C    R E++   +I   +DE L  +   +  NK    +V+++G DSLS  +F+  LPK +    + L       +N  GDGT   L   LTG  + E  +TR+R+  ++ V+ +  I+K Y   GYVT + E++   GTF YRLNGF+ QPTD Y+RT  +A E    YY   C G +P H     +  DF  +Y  S P+F F F G +SHD+   +   D +L+  +++L+ S    + ++ L SDHG+RF   R T++GK EERLPFF  + P       R      + N D L +  D H TL+D + L     K  P  SR +SL   +P +R+C D    PHWC+CLNW+ I +  S +++ + A  I   I+ +T++ R +C+ L L++I  A RL  ++ +++FKQ+ D DGF+ D  SD ++    +Y++ L+ +P    +E +  ++D  +      +G     ++SR+N+Y     C+  R        ++RKFC C +
Sbjct:   10 RNLLFLLTIGVVYLLLDHYFNGEDYGDNREKLVLIEESIKSLANQGACKMPSLPVDSPEMLSFLKDEPLIECGSELQDWVTCEPEVIKEKGKITCDYADILRKSDFKLSFGETTRTSGSYTLQSSDFVRAKCWTDSRTERWQGLLIGIRQDEQLRAR---SGWNKESALNVLMLGFDSLSRNAFQRKLPKAYKYLTKYLAADVLQGYNIVGDGTPQALIPLLTGFTELELPDTRRRMKNTEYVNVYPLIWKEYEKYGYVTAFNEDVPNIGTFSYRLNGFDEQPTDHYMRTYYVAIEAYLSYYKRLCIGAKPRHKVMLDYTRDFMTSYRPSTPRFVFSFHGELSHDSINLVGVADTDLTNWLVELKKSGILNSTILVLMSDHGNRFAEVRNTLQGKQEERLPFFSFTFPDWFKTHHREQYENFRQNLDRLVTPFDVHETLQDILTLQTLKAKQKPAISRAISLFDVIPQNRSCADAYIEPHWCACLNWQPINDTTSSEEVFRSAKTIVDTINHHTERHRGICALLTLDEIRWAARLQPHEGLVRFKQNRDTDGFLGDFSSDAIRAPHDMYQVKLVTNPSKAIYEASV-LHDRANNRFRVKLG-----DISRINKYGEQANCIYERDP------EMRKFCYCKE 636          
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Match: A0A182IU05 (Uncharacterized protein OS=Anopheles atroparvus OX=41427 PE=4 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 6.929e-89
Identity = 203/652 (31.13%), Postives = 335/652 (51.38%), Query Frame = 2
Query:  347 SRGCLIFVTIL--ILCLLKFGFNFFNFETVNVKILPVSEDLQ------VCPIPNLFDKYPKNAKLLTD---LKC-PESENLVSIENGT-------IHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFI-VSC---HRNEQY---VITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYE-SIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPR----KMRNILPTLKANADILTSALDFHATLEDFIGL------YKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSD-KVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            +R  LIF+ I+  I  LL   FN  ++     K++ + E ++       C +PNL    P+    L D   ++C  E ++ V+ E          I +     C Y  I  K+DF+    ++   S   T+  + F+   C    R E++   +I   +DE L ++      NK    +V+++G DSLS  +F+  LPK +    + L G     +N  GDGT   L   LTG  + E  +TR+R+  ++ V+ +  I+K Y   GYVT + E++   GTF YRLNGF+ QPTD Y+RT  +A E    YY   C G +P H     +  DF ++Y  ++P+F F F G +SHD+   +   D +L+  ++DL+ S    + ++ L SDHG+RF   R T++GK EERLPFF  + P     + R     L+ N + L +  D H TL+D + L       KP+  +R +SL   +P +R+C D    PHWC+CLNW+ I +  S +++ + A  I   I+ +T++ R +C+ L L++I  A RL  ++ +++FKQ+ D DGF+ D S   V+    +Y++ L+ +P    +E +  ++D  +   +  +G     ++SR+N+Y     C+  R        ++RKFC C +
Sbjct:    8 TRRNLIFLLIVGVIYLLLDHFFNGEDYGDNREKLVLIEESIKSLANQGACKMPNLPVDSPEMLSFLKDEQPIECGSELQDWVACEKSVCTIKPEVIKEKGTITCDYADILRKSDFKLSFGDTTRTSGSYTLRASDFVRAKCWTESRTERWQGLLIGIRQDEALRSRPS---WNKESALNVLMLGFDSLSRNAFQRKLPKAYKYLTKYLGGDVLQGYNIVGDGTPQALIPLLTGFTELELPDTRRRMKNTEYVNVYPLIWKEYEKYGYVTAFNEDVPNIGTFSYRLNGFDEQPTDHYMRTYYVAIEAYLSYYKRLCIGAKPRHKAMLDYTRDFMESYRTTMPRFVFSFHGELSHDSINLVGVADTDLTNWLVDLKKSGLLNSTILVLMSDHGNRFAEVRNTLQGKQEERLPFFSFTFPEWFKVQYREQYENLRKNLNRLVTPFDIHETLQDILTLQTLKAKQKPAV-TRAISLFDVIPQNRSCADAYIEPHWCACLNWQTINDTASSEEVFRSAKTIVDTINHHTERHRGICALLTLDEIRWAARLQPHEGLVRFKQNRDTDGFLGDFSSVAVRVAHDMYQVKLVTNPSKAIYEASV-LHDRLNNRFQVKLG-----DISRINKYGEQANCIYERDP------EMRKFCYCKE 643          
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Match: EDO42770 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0N8])

HSP 1 Score: 216.083 bits (549), Expect = 4.937e-61
Identity = 150/474 (31.65%), Postives = 230/474 (48.52%), Query Frame = 2
Query:  797 PGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNP--NALIALYSDHGHRF-NSRLTIEGKYEERLPFFGLSLP----RKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRS--RHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRK---LCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVAD-LSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFR-PEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            P +V++IG DSLS   F+    K  +   +ELN V    ++  GDGTT  L AFL G  + E  E R+    S  VD + W+FK Y + GY TL++E+   YG F YRL+GF++ PTD + R    AA      + +C  ++P H  +F +   F + Y    KF   FF  +SH+    I +   +   L+ +L  +N   N ++  + DHG R+ +SR T++G  EERLP    + P     +  +++  L+ N++ +TS  D +ATL+  + LY  SP    R MS+   +P  R C+      H+C CLN K  A+PN    + + A  +   I+  T  D K   LC  L L  I  +++  AN    +F  S D  G     L  KV      Y++ +  +PG+  F+V     D          G FR   ++SR+N Y    +C+           D+RK+C+C D
Sbjct:  137 PVNVMMIGFDSLSAAHFKRVFTKANSFLSKELNTVFMKGYSIVGDGTTPALTAFLAGQFEKELPEARRSYENSDTVDKWPWVFKDYKSAGYATLFSEDCPGYGAFNYRLHGFKQTPTDHFGRYFWEAAR---LTSPYCIHSKPQHRIHFDYIESFFEAYPKKRKFGLSFFTDISHNNLNSIYHSAEDFFRLLKNLHQANHLNNTILITFGDHGFRYGSSRTTLQGHLEERLPHLAFTFPYWFEAEYPDVVENLRDNSETVTSPFDLYATLKHIL-LYPESPTGLKRGMSMFNEIPKTRGCEAAGVAEHYCPCLNLKP-ADPNHG-HIRRSAEAVVKFINDLTSSDPKSSQLCERLSLKAIKSSHQQMANTKFAQFLGSRDAHGREPMFLKGKVVPHECNYRIQVETTPGDALFDVAVRYLD----------GEFRVSGDISRINMYGEQPRCILSSRP------DLRKYCLCKD 588          
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Match: EDO44909 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUI3])

HSP 1 Score: 210.305 bits (534), Expect = 2.803e-60
Identity = 147/476 (30.88%), Postives = 235/476 (49.37%), Query Frame = 2
Query:  803 DVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNT-RGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPR----KMRNILPTLKANADILTSALDFHATLEDFIGL-YKPSPRSRHMSLLRPL-PVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIA-SRISSYTDQD---RKLCSNLKLNQILLAYRLDANKAVLKFK---QSSDVDGFVADLSDKVKQTSF---LYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCIC 2170
            +V++I  DS S  +F   +P+T   + +EL  V     +T  GDGTT  L A LTG  +    E R+R+ G+K VDD+ WIF+ Y   GYVT+++E+    GTF YRL GF   PTD Y R   L A      N++C GN+  H     +       Y   PKF+F+ F  + HD    + Y D +   L+  +         ++ ++ DHGHRF   R T++GK EERLP   ++ P+    K  ++   +K N++ LT+  D +ATL+  +   + P+      SL +P+ P++R C       HWC+CL+++ ++   +  +LVK   + A   I+   D D   ++LC  L L +I +A R   N+ + KFK   Q    D   A   +K K T +   LY++  +  P NG +E +  + + +       VG     ++SRV+R+     C++           + K+C C
Sbjct:    2 NVVMIMFDSTSAANFLRKMPRTLE-YLQELPTVFLKGGHTIVGDGTTAQLCAMLTGIDERYQPEARRRMPGAKHVDDWRWIFRDYAERGYVTMFSEDSPGLGTFNYRLKGFRHPPTDHYGRYFWLEANKYD-KNDYCTGNKATHKLTMDYLYSLFNAYPKNPKFAFLLFSALVHDNLNTLGYGDEDTYFLLKRMEKDFFLDETIVIIFGDHGHRFGPFRKTLQGKLEERLPHMSITFPKSFPLKYPHLYENIKRNSNYLTTPFDMYATLQHILTYPFPPAGIKTGQSLFQPIEPLNRTCKSAGVEDHWCTCLDFEKVS---TKSELVKSIAIFAVGHINKLLDFDARVKRLCRKLTLGEIKVALREMPNEKLQKFKMSYQDHHCDSCGAMFGEKAKDTMYRDALYQIHFVTFPNNGFYEASVKLEEGKPLKV---VG-----DISRVDRFGTQPDCIKDTYVH------LIKYCYC 458          
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Match: EDO32647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH0])

HSP 1 Score: 204.527 bits (519), Expect = 3.717e-58
Identity = 147/473 (31.08%), Postives = 230/473 (48.63%), Query Frame = 2
Query:  797 PGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGR-GYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPRKMRNILP----TLKANADILTSALDFHATLEDFIGLYKPSPR-SRHMSLLRPLPVDRNCDDIESLP-HWCSCLNWKNIANPNSDKKLVKVANV--IASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFL-YKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICND 2176
            P +V++I  DS S   F   LP       +EL+  SF+ ++T GDGTT  +   L G  +    E R R  G   VD + +IF  ++ NGYVT W+E+  +YGTFQYRL GF+ +P D YLR   +A     G   + C G+ P   + F+F     + Y    K S  FF I +HD    I Y+  +    +  +++     N ++ +  DHG R+   R TI GK EERLP+  +S+P+  ++  P     LKAN D LTS  D HATL   +  Y  +P+     SL + +P  R C ++  +P H+C+C++WK ++  +   K +    V  I  RI      D+  C+ L+L  I  A  +  ++ V  FK S D+  +  ++ +         Y++ L  SP +G FEVT +++   S +   N        +SR++ Y    +C+            +R+ C C D
Sbjct:    2 PVNVLIIAFDSTSRSHFMRKLPHVKQWLDKELDTFSFSGYSTVGDGTTPAMIGMLVGKLEERLPEAR-RSRGGVNVDVWHFIFPEFHDNGYVTAWSEDQAKYGTFQYRLEGFKVKPVDHYLRNFWVAVSAHTGDMGSLCIGSEPAFEKRFRFIESLFEKYPKTRKLSLEFFCI-THDDMNDIGYVQDDFLRFLGSMKSKGYLDNTMLVVMGDHGARYGPIRSTIIGKLEERLPYLSISVPKWFKSKHPDVHNALKANTDRLTSPFDLHATLLHIL-RYPDTPKVDVGQSLFQEVPKSRTC-EVAGIPVHYCTCMDWKQVSPGHHHIKQLAEEAVRHINERIQREGVADK--CAELRLTGIHNAVFIAPSRQVQTFKGSDDM--YYREIYEGDNPKGMCNYQVQLKTSPNDGIFEVTGYIS---SYSPHVN------PMMSRLDAYGDQPQCITESHPH------MREVCYCLD 451          
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Match: EDO48202 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK82])

HSP 1 Score: 202.986 bits (515), Expect = 1.359e-57
Identity = 141/475 (29.68%), Postives = 221/475 (46.53%), Query Frame = 2
Query:  797 PGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSN--PNALIALYSDHGHRFNS--RLTIEGKYEERLPFFGLSLP----RKMRNILPTLKANADILTSALDFHATLEDFIGL-YKPSPRSRHMSLLRPL-PVDRNCDDIESLPHWCSCLNWKNIANPN-SDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQS---SDVDGFVADLSDKVKQTSF---LYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCIC 2170
            P ++++I  DS S  +F   +P T       L+ V        GDGTT  L A LTG  +    E RK    +  VD + WIFK +   GYVT+++E+      F +RL GF   PTD Y R   + AE       FC  N+  H+  F +     +TY   PKF+ V F  + H     I + DR+L  L++ ++  +   + ++ ++ DHG+RF    + T++GK EERLP F ++LP    RK  N+   LK N+ ILTS  D +ATL+  I   ++PS  +   SL   L P  R C +     HWC CL    +   N   + + +VA    +R+ + T + R +C+ L L ++  A R   ++ V  FK S    + D     L+   K T     LY++  + SP +  +E +  +N                 ++SR++       C++        +S + KFC C
Sbjct:    2 PVNILMIMFDSTSAANFHRKMPNTTNLLKNTLDTVFLRGQTIVGDGTTAQLSAILTGIAEKNQPEARKGRKKATTVDKWRWIFKDFKDRGYVTMYSEDSPTTAAFNFRLKGFRDPPTDHYSRYYWMEAENY-IRKEFCSNNQAMHNMTFNYLLSLFRTYTKNPKFAMVNFCTLVHREPNAIGHADRDLYNLLLKMKKESFLDSTVVMIFGDHGYRFGGMRKQTLQGKLEERLPHFSITLPPWFRRKHWNMYKNLKFNSRILTSPFDIYATLKHIISYPWRPSGVNSGQSLFDKLDPSYRRCTNAGVKDHWCPCLIMNKVPVKNIIVQDIAQVAVAAINRLLNETQESRDMCTGLTLKEVKSASRELPSQVVQTFKYSFPNRECDSCGVKLAAPAKNTMVKDTLYQIKFVTSPNSAYYEASISLNGGVPSID---------GDISRIDAIGEQADCVKE------SLSHLIKFCFC 460          
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Match: EDO43929 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXA2])

HSP 1 Score: 201.83 bits (512), Expect = 4.083e-57
Identity = 144/484 (29.75%), Postives = 221/484 (45.66%), Query Frame = 2
Query:  797 PGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEG---RGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNP--NALIALYSDHGHRFNS-RLTIEGKYEERLPFFGLSLPR----KMRNILPTLKANADILTSALDFHATLEDFIGLYK-PSPRSRHMSLL-RPLPVDRNCDDIESLPHWCSCLNW--KNIANPNSDKKLVKVANVIASRISSYTDQ-------DRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVD-----GFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCIC 2170
            P +V  I ++S S   F+  L +T     E  + + F      GDGTT  L A LTG  + +  E RK   G++ VD ++WIF+ +  +GY T+ +E+    G F  RL GF   PTD Y R   +  +    +   N  C GN+  H     +  DF   Y   PKF  VFF  ++H+    + Y D++L EL  +L   +   N+++ +  DHG RF   R T+ GK EERLP   L+LP        ++   LK+N+++LTS LD +ATL   +   K P+      SLL R  P  R C       HWC CL W  +++  P        +A +IA+RI  + ++          LC  LKL +I    +   N  V  F ++   D     G V     +   +   Y++  ++SPG+G FE +  + D +    +          +SR+N Y     C++ +         + KFC C
Sbjct:    2 PVNVFFIILESTSAAQFQRKLKRTRQYLIEHGHTLFFKGEGIVGDGTTAQLSALLTGMPEYQQTEARKGEPGAQTVDGWNWIFRDFVKHGYATMHSEDDPSLGAFNLRLKGFHEPPTDHYARPFWIHVDETIVQETDNKRCVGNQAIHKISLNYLEDFVNAYWDRPKFGVVFFSYLTHNDENALGYADKDLVELFSNLERDSHLNNSMVFIMGDHGIRFGEWRKTMHGKLEERLPHLSLTLPPWFAFNFPDLYSNLKSNSEVLTSPLDLYATLRHILSYPKQPTGIRVGQSLLNRIEPSSRTCASAGIDRHWCPCLTWEREDVRQP--------IAGIIANRIVKFINELTVKGSKTLNLCEKLKLTEIKSLSKQMPNIKVQTFIKTKKNDICDSCGTVHGRKARDSMSEGGYQVQFVVSPGDGMFEASVRLKDGELVVDQRF--------ISRINSYGDQSYCVKDQ-------PHLLKFCYC 462          
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Match: SMESG000029622.1 (SMESG000029622.1)

HSP 1 Score: 1298.11 bits (3358), Expect = 0.000e+0
Identity = 624/626 (99.68%), Postives = 625/626 (99.84%), Query Frame = 2
Query:  305 MSRKNFNFTKLFRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 2182
            MSRKNFNFTKLFRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS+AVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYY NFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL
Sbjct:    1 MSRKNFNFTKLFRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSRAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYKNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 626          
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Match: SMESG000029624.1 (SMESG000029624.1)

HSP 1 Score: 1274.61 bits (3297), Expect = 0.000e+0
Identity = 612/617 (99.19%), Postives = 614/617 (99.51%), Query Frame = 2
Query:  332 KLFRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 2182
            K  RKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQS LGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS+AVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKL+KVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL
Sbjct:    2 KFHRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSALGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSRAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLMKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 618          
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Match: SMESG000029629.1 (SMESG000029629.1)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 540/591 (91.37%), Postives = 562/591 (95.09%), Query Frame = 2
Query:  410 FFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 2182
            +F  +T++    PVSE LQVCPIPNLFDKYPKN KLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS+AVDDFDWIFKHYNANGYVTLWTEEMT+YGTFQYRLNGFERQPTDFYLRTALLAAEGRGYY NFCFGNRPFHSEYFK+FNDFQKT++ IPKFS VFF  M+HDANKYISYMDRELSE+II+LRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFE+T  +N+         + +FRPE+VSR+NRYAPWVKCL+RRT K F ISD+RK+CIC DVL
Sbjct:    3 YFPSKTIHKNNSPVSEILQVCPIPNLFDKYPKNVKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSRAVDDFDWIFKHYNANGYVTLWTEEMTDYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYKNFCFGNRPFHSEYFKYFNDFQKTFKKIPKFSLVFFSKMTHDANKYISYMDRELSEVIINLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEITIRLNETSLTKENFQIESFRPEDVSRINRYAPWVKCLDRRTGKHFAISDLRKYCICKDVL 593          
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Match: SMESG000012817.1 (SMESG000012817.1)

HSP 1 Score: 1124 bits (2906), Expect = 0.000e+0
Identity = 538/591 (91.03%), Postives = 559/591 (94.59%), Query Frame = 2
Query:  410 FFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCICNDVL 2182
            +F  +T++ K  PVSE LQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQS LGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS+AVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYY NFCF N PFHSEYFK+FNDFQKT++ IPKFS VFF  M+HDANKYISYMDRELSE+II+LR SNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFE+T  +N+         + +FR E+VSR+NRYAPWVKCL+RRT K F ISD+RK+CIC DVL
Sbjct:    3 YFPSKTIHKKNSPVSEILQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSALGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSRAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYKNFCFRNWPFHSEYFKYFNDFQKTFKKIPKFSLVFFSKMTHDANKYISYMDRELSEVIINLRMSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEITIRLNETSLPKENFQIESFRSEDVSRINRYAPWVKCLDRRTGKHFAISDLRKYCICKDVL 593          
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Match: SMESG000029619.1 (SMESG000029619.1)

HSP 1 Score: 535.028 bits (1377), Expect = 0.000e+0
Identity = 271/614 (44.14%), Postives = 377/614 (61.40%), Query Frame = 2
Query:  341 RKSRGCLIFVTILILC--LLKFGFNFFNFETVNVKILPVSEDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECTYKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDENLINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVSFTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGS-KAVDDFDWIFKHYNANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNNFCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDRELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLPRKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLPVDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQDRKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFLYKMTLLLSPGNGQFEVTTWVNDDQSKTAEEN-VGTFRPEEVSRVNRYAPWVKCLERRTAKSFKISDIRKFCIC 2170
            R S+  +  +   + C  +LK G +F     +    L  S + + CP P  F   P N KL  DL CP  ++LV I NGT+HKLS   CTY+CI WKTDF+YQL   K L++ Q VPC+YFIV C   EQ V+T V+ + ++N+      + T   D+I+IGI SLSYQ+F+  LPKTF+  H +LNGVSF KFNTR +  TVNL + LTG  DTE YE    I    + +D+++WI+  Y A GY TL+ E+MTE GTFQ+ L GF   PTD+YLRT L+  E   YY ++C GNRP  +E+F+F   FQ TY +IPKF+ +F   +SH  NKY+SYMD EL+  + + +TS PN+ I ++SDHG+   ++ +++   EERLPF G+ LP+    + P L+ N+++L S LD HATLEDFI +YKP   S+HMSL RP+P  R C+DI     WCSCL W+ I N    +KL K++ +I +RISS+T  DR LC+ L    +LLAY L AN   LKF  +     +     ++V  +    K+ +  +PGN +FE+T  V +   K A +  V    PE V+R+++    +KCL RR  K + + D+RKFCIC
Sbjct:   11 RISKNQVKIILFFVSCCGILKLGSDFTKGSPLEKDPLNFSTEFESCPTPK-FSNSPINEKLFKDLACPPKDDLVFIINGTVHKLSMEPCTYQCIYWKTDFDYQLGIIKVLNNFQPVPCDYFIVKCKDVEQIVLTTVRYDYILNRRPLKQYSNTNSNDIIMIGISSLSYQAFKDLLPKTFSTLHNDLNGVSFVKFNTRSNDQTVNLLSILTGFNDTEKYEAFNHIKRDIRPIDNYNWIWNSYAAEGYATLYGEDMTENGTFQHNLRGFINDPTDYYLRTPLMFIERNNYYKDYCLGNRPIFTEHFQFLKKFQLTYTNIPKFAVLFLKQLSHANNKYVSYMDEELAMFVKNTKTSYPNSFIIIFSDHGYESKNQGSLDSISEERLPFLGMILPKNREELFPILRQNSELLVSGLDLHATLEDFIQIYKPDVGSKHMSLWRPIPKTRKCEDIGLSYRWCSCLKWEEIHNQKMYEKLNKISQIIVTRISSFTKPDRDLCAPLAFKALLLAYHLTANNEALKFANALSTLRYKDSSENEVYLSMIWLKLIVATTPGNAKFELTISVKEIVEKNALKILVENVFPENVNRIDKVNHLIKCLSRRKNKYYALKDVRKFCIC 623          
The following BLAST results are available for this feature:
BLAST of AGAP003596-PA-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y41E3.11.387e-8232.95pep chromosome:WBcel235:IV:14954206:14958914:-1 ge... [more]
Y41E3.11.124e-4831.60pep chromosome:WBcel235:IV:14954206:14956694:-1 ge... [more]
F10C2.37.279e-4227.62pep chromosome:WBcel235:V:12021164:12023600:1 gene... [more]
F15H10.71.167e-3228.15pep chromosome:WBcel235:V:10403184:10406424:-1 gen... [more]
Y73F8A.353.549e-2323.92pep chromosome:WBcel235:IV:15533167:15539559:-1 ge... [more]
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG62361.066e-8032.59gene:FBgn0038318 transcript:FBtr0083121[more]
CG62361.066e-8032.59gene:FBgn0038318 transcript:FBtr0083122[more]
CG71207.178e-3927.45gene:FBgn0035888 transcript:FBtr0307376[more]
CG71207.178e-3927.45gene:FBgn0035888 transcript:FBtr0307377[more]
CG71201.005e-3827.45gene:FBgn0035888 transcript:FBtr0307378[more]
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L7QSC42.980e-9132.78Uncharacterized protein OS=Habropoda laboriosa OX=... [more]
A0A0M9A6K92.295e-9033.83Uncharacterized protein (Fragment) OS=Melipona qua... [more]
A0A087ZVH24.880e-8933.22Uncharacterized protein OS=Apis mellifera OX=7460 ... [more]
Q7QAP45.307e-8931.31AGAP003596-PA OS=Anopheles gambiae OX=7165 GN=AgaP... [more]
A0A182IU056.929e-8931.13Uncharacterized protein OS=Anopheles atroparvus OX... [more]
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO427704.937e-6131.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449092.803e-6030.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326473.717e-5831.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482021.359e-5729.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439294.083e-5729.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AGAP003596-PA-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AGAP003596-PA-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029622.10.000e+099.68SMESG000029622.1[more]
SMESG000029624.10.000e+099.19SMESG000029624.1[more]
SMESG000029629.10.000e+091.37SMESG000029629.1[more]
SMESG000012817.10.000e+091.03SMESG000012817.1[more]
SMESG000029619.10.000e+044.14SMESG000029619.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010838 ID=SMED30010838|Name=AGAP003596-PA-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2310bp
GTAATCCGTTGTAAAATGAAAATATTTTCCATTTAATAATAATAAATTTT
ACATCACTCGAAAACGTGTCTGAATTGCTATTTATTGTGACTTCATAATT
TTATTATCGACTGCTATAAAATTTAAATTCTAAATCCAATTTAAAGACAA
ATCAATAAAATTCTCAGGATGACTTGCAATATGCTAGATAAAAGCACACG
GAATTACAAGCAAATTTTTTGACAAATCTGATTTCGTGAATCATTCTGAT
TGGTCGATTCCAAATCGATTTAAAACCAGAAAATGATATACAAAAATATT
CAACATGAGTCGAAAAAATTTTAATTTTACGAAATTATTTCGGAAATCTC
GAGGATGTTTAATTTTTGTTACGATTCTAATATTGTGTCTTTTGAAATTT
GGATTTAATTTTTTCAATTTCGAAACAGTGAATGTGAAAATTTTACCGGT
CAGTGAAGATTTACAAGTTTGTCCTATTCCAAATCTTTTTGATAAATATC
CGAAAAATGCCAAACTGTTGACAGATTTAAAATGTCCAGAAAGTGAGAAT
TTGGTTTCAATCGAAAATGGAACCATTCATAAATTGAGTCCTCACGAATG
TACTTACAAATGTATTTCCTGGAAAACCGATTTCGAGTATCAATTGAGTG
AAAGTAAAACATTAAGCCATTTACAAACAGTTCCATGCAATTATTTCATT
GTTTCATGCCATCGAAATGAACAATATGTGATAACTGCTGTCAAAGATGA
AAATCTCATCAACAAATACCAATCTACATTAGGTAATAAGACAAAACCTG
GTGATGTAATTGTCATTGGAATTGATTCTTTATCTTATCAGTCATTTCGA
TATCATTTACCGAAAACATTTGCAGCGTTTCATGAGGAGTTAAATGGCGT
ATCTTTCACAAAGTTCAACACGAGAGGTGACGGAACTACTGTTAATTTAC
AGGCATTTCTAACCGGAACCAAAGATACGGAAACTTATGAAACTCGGAAA
CGAATTGCGGGCTCAAAAGCAGTTGATGATTTTGATTGGATATTTAAACA
TTACAACGCAAACGGCTACGTCACCTTATGGACAGAAGAAATGACAGAAT
ATGGAACATTTCAATACAGATTGAATGGATTTGAACGTCAACCGACAGAT
TTTTACCTTCGAACTGCCCTATTGGCAGCCGAAGGTCGAGGATATTATAA
TAATTTCTGCTTCGGAAATCGGCCATTTCATTCGGAATACTTCAAATTTT
TCAATGACTTCCAAAAAACTTATGAATCAATCCCGAAATTCTCTTTTGTC
TTTTTTGGAATAATGTCGCACGATGCAAATAAATACATCAGCTACATGGA
CAGAGAGCTGTCGGAACTTATCATCGATTTGAGAACGTCTAATCCAAATG
CTTTGATAGCGTTATATTCAGACCATGGTCACAGGTTCAATAGCCGACTG
ACAATTGAGGGCAAATATGAAGAAAGGTTGCCTTTCTTTGGATTATCCTT
ACCGAGGAAAATGAGGAATATTTTACCGACACTGAAAGCTAATGCGGATA
TTCTAACAAGTGCTCTTGACTTTCACGCAACTTTGGAAGATTTTATTGGC
TTATATAAACCGAGTCCTAGAAGCAGGCACATGAGCTTACTGAGGCCTTT
GCCTGTCGACCGGAACTGTGATGATATTGAGTCATTGCCTCACTGGTGCT
CGTGTTTGAATTGGAAGAACATTGCAAATCCCAATTCTGATAAGAAACTG
GTGAAGGTGGCCAATGTCATTGCTAGTCGGATTTCATCTTATACAGATCA
AGATCGGAAGTTGTGTTCGAATTTGAAATTAAATCAGATTTTATTGGCAT
ATCGACTCGATGCCAATAAAGCCGTTTTGAAATTCAAGCAAAGCTCCGAT
GTTGACGGATTCGTTGCGGACCTCTCGGATAAAGTCAAGCAAACCAGTTT
TCTATATAAGATGACTTTGCTGCTGAGCCCGGGAAATGGACAATTCGAAG
TTACAACTTGGGTAAATGATGACCAATCTAAAACTGCTGAAGAAAATGTA
GGAACTTTCCGACCGGAAGAAGTCAGTAGAGTTAATAGGTATGCTCCTTG
GGTGAAATGTCTAGAGCGAAGAACTGCCAAATCTTTTAAAATTTCAGATA
TAAGAAAGTTTTGTATTTGTAACGATGTTTTATAAATTTTATATTTACCT
GTAAGATTAATATTTTATGACGTAATATGTAAATAGCTGAAATTTTGTTT
TGGTGTTTCATTTGTTTGCATTTTTACGCTTTGAAATGTTTTATTTTTTT
ACATAAATGC
back to top

protein sequence of SMED30010838-orf-1

>SMED30010838-orf-1 ID=SMED30010838-orf-1|Name=SMED30010838-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=627bp
MSRKNFNFTKLFRKSRGCLIFVTILILCLLKFGFNFFNFETVNVKILPVS
EDLQVCPIPNLFDKYPKNAKLLTDLKCPESENLVSIENGTIHKLSPHECT
YKCISWKTDFEYQLSESKTLSHLQTVPCNYFIVSCHRNEQYVITAVKDEN
LINKYQSTLGNKTKPGDVIVIGIDSLSYQSFRYHLPKTFAAFHEELNGVS
FTKFNTRGDGTTVNLQAFLTGTKDTETYETRKRIAGSKAVDDFDWIFKHY
NANGYVTLWTEEMTEYGTFQYRLNGFERQPTDFYLRTALLAAEGRGYYNN
FCFGNRPFHSEYFKFFNDFQKTYESIPKFSFVFFGIMSHDANKYISYMDR
ELSELIIDLRTSNPNALIALYSDHGHRFNSRLTIEGKYEERLPFFGLSLP
RKMRNILPTLKANADILTSALDFHATLEDFIGLYKPSPRSRHMSLLRPLP
VDRNCDDIESLPHWCSCLNWKNIANPNSDKKLVKVANVIASRISSYTDQD
RKLCSNLKLNQILLAYRLDANKAVLKFKQSSDVDGFVADLSDKVKQTSFL
YKMTLLLSPGNGQFEVTTWVNDDQSKTAEENVGTFRPEEVSRVNRYAPWV
KCLERRTAKSFKISDIRKFCICNDVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003133T_Ag_DNA-bd
IPR004245DUF229
IPR017849Alkaline_Pase-like_a/b/a
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 157..435
e-value: 1.9E-11
score: 46.0
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 167..437
IPR004245Protein of unknown function DUF229PFAMPF02995DUF229coord: 92..512
e-value: 2.7E-77
score: 260.5
IPR004245Protein of unknown function DUF229PANTHERPTHR10974UNCHARACTERIZEDcoord: 21..603
IPR004245Protein of unknown function DUF229CDDcd16021ALP_likecoord: 167..429
e-value: 2.71102E-83
score: 260.915
NoneNo IPR availablePANTHERPTHR10974:SF1coord: 21..603
NoneNo IPR availableTMHMMTMhelixcoord: 17..39