Thioredoxin domain-containing protein

Overview
NameThioredoxin domain-containing protein
Smed IDSMED30010837
Length (bp)1495
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010837

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30010837SMESG000016749.1 dd_Smed_v4_10655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010837SMESG000016749.1 dd_Smed_v4_10655_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016749.1 Contig49435newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016749.1 Contig49435uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
prepharyngeal regionSMED30010837SMESG000016749.1 dd_Smed_v6_10655_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010837SMESG000016749.1 OX_Smed_1.0.08043ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010837SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Match: sp|O13811|PDI2_SCHPO (Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17H9.14c PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 2.581e-18
Identity = 84/326 (25.77%), Postives = 147/326 (45.09%), Query Frame = 3
Query:  270 CIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIP----DIDWMDIPSTVKDVSKHSVLILYDEDCANPCKIL----ENVAKVFEKENDVSFYKMS---FEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAFI 1214
            C   +  ++EL      + D++ G I  D+ S +  +Y++  FP +  FP          N R            DS+       T +  R+   +V+P    ++D ++    V D  K  VL+ +  D    CK L    E + KVF+ E +V   K++   F   G L +   F   PT+ +F K DK+K  +Y GD   E L+E++N  +G  R   G L   AGRI   D+   E     L  +     + L + K   L  ++++  YY  V ++I    + +  + +E   ++ +LR+K + +A  D++K   NI+++F+
Sbjct:   54 CKSLAPVYEELGALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNAR----------DVDSLTQFVSEKTGIKKRK---IVLPSNVVELDSLNFDKVVMD-DKKDVLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVASF---PTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSGTQRSPDGTLLSTAGRIPTFDEFAAE----FLDMSNAAKEVVLEKVKQLALEDSSRWTKYYKKVFEKIL---NDENWVHKEAKRLSKLLRQKSIALASADDFKTRLNILNSFL 355          
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Match: sp|P38661|PDIA6_MEDSA (Probable protein disulfide-isomerase A6 OS=Medicago sativa OX=3879 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.020e-14
Identity = 90/356 (25.28%), Postives = 166/356 (46.63%), Query Frame = 3
Query:  186 FTQRDFDQWIDENNFLVVLF----CNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTD-QVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVS-NRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCK----ILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKEL-PHATKYIDYYLAVLKE-IRKGSD--SDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAF 1211
             T+ +F++ +  +   +V F    C       C K + ++++L +   K   ++   +  D    + ++Y V  +P ++ FP    + + +      + L E +           +  TNV     P  VV+   +  +    V D +K  ++  Y   C + CK    I E VA VF+ E+DV    +  +K   L +    +  PT+ +F K +K  G  YGG    +  V F+N+ +G SRD  GQL  +AG + ++D+++KE + +   + K   V   +E++ K+L   A++Y   YL V K+ + KGSD   ++I + E+      L +K ++ A+ DE     NI+S +
Sbjct:   34 LTEENFEKEVGHDKGALVEFYAPWCGH-----CKKLAPEYEKLPNSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFV---------NTEGGTNVKIATAPSHVVVLTPETFN--EVVLDGTKDVLVEFYAPWCGH-CKSLAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNK-AGEDYGGGRDLDDFVAFINEKSGTSRDAKGQLTSEAGIVEDLDELVKEFVAANDEEKKA--VFARIEEEVKKLEGSASRYGKIYLKVSKKYLEKGSDYAKNEIQRLER------LLEKSISPAKADELTLKKNILSTY 363          
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Match: sp|O22263|PDI21_ARATH (Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 9.485e-14
Identity = 84/323 (26.01%), Postives = 144/323 (44.58%), Query Frame = 3
Query:  270 CIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTD-QVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVS-NRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCKIL----ENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHA-TKYIDYYLAVLKE-IRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAFI 1214
            C K + ++++L     K   ++   +  D    +  +Y V  +P ++ FP    + Q Y      + L E +          ++  TNV     P+ VV+   D  D    V D +K  ++  Y   C + CK L    E VA VF++E  V    +  +    L +    +  PT+ +F K D + G  Y G    +  V F+N+ +G SRD  GQL   AG +  +D ++KE + +   + K   V+  +E+++  L  + T+Y   YL + K  I KGSD      +E   +  VL K +  + + DE     NI++ F+
Sbjct:   55 CKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYV---------NKEGGTNVKLAAVPQNVVVLTPDNFD--EIVLDQNKDVLVEFYAPWCGH-CKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPK-DNKAGHDYDGGRDLDDFVSFINEKSGTSRDSKGQLTSKAGIVESLDALVKELVAASEDEKKA--VLSRIEEEASTLKGSTTRYGKLYLKLAKSYIEKGSD---YASKETERLGRVLGKSISPV-KADELTLKRNILTTFV 358          
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q942L2|PDI22_ORYSJ (Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-2 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.941e-12
Identity = 86/353 (24.36%), Postives = 154/353 (43.63%), Query Frame = 3
Query:  186 FTQRDFDQWIDENNFLVVLF----CNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTD-QVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRR-PKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCK----ILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEI-RKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAF 1211
             T+  F++ + ++   +V F    C       C K + ++++L     K   +    +  D    + ++Y V  +P ++ FP    + + Y      + L E +           +  TNV     P  VV+   D  D  S V D +K  ++  Y   C + CK    I E +A V++ ++ V    +  +K   L +    +  PT+ +F K +K  G  Y G    +  V+F+N+  G SRD  GQL  +AGRI  +D + KE  L      +   +  + E+  K    A K+   Y+A+ K+I  KG D     ++E   +  +L K + + ++ DE+    N++S F
Sbjct:   40 LTESTFEKEVGQDRGALVEFYAPWCGH-----CKKLAPEYEKLGASFKKAKSVFIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRSAEALAEFV---------NTEGGTNVKLATIPSSVVVLGPDNFD--SIVLDENKDILVEFYAPWCGH-CKHLAPIYEKLASVYKLDDGVVIANLDADKHKDLAEKYGVSGYPTLKFFPKGNK-AGEDYDGGRELDDFVKFINEKCGTSRDTKGQLTSEAGRIASLDALAKE-FLGAANDKRKEILSNMEEEVVKLSGSAAKHGKVYIAIAKKILDKGHD---YTKKETERLERMLEKSI-SPSKADEFIIKKNVLSTF 369          
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Match: sp|Q75M08|PDI21_ORYSJ (Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-1 PE=2 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 3.801e-11
Identity = 83/353 (23.51%), Postives = 155/353 (43.91%), Query Frame = 3
Query:  186 FTQRDFDQWIDENNFLVVLF----CNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTD-QVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVS-NRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCK----ILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEI-RKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAF 1211
             T+  F++ + ++   +V F    C       C K + ++++L     K   ++   +  D    + ++Y V  +P ++ FP    + + Y      + L E +           +++TNV     P  VV+   +  D  S V D +K  ++  Y   C + CK    I E +A V++++  V    +  +K   L +    +  PT+ +F K +K  G  Y G    +  V+F+N+  G SRD  GQL  +AG +  +  ++KE  L      +   +  + E  +K    A KY   Y+   K+I  KGS   +  ++E   +  +L K + + ++ DE+    NI+S F
Sbjct:   35 LTESTFEKEVGQDRAALVEFYAPWCGH-----CKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKYEGQRTAEALAEYV---------NSEAATNVKIAAVPSSVVVLTPETFD--SVVLDETKDVLVEFYAPWCGH-CKHLAPIYEKLASVYKQDEGVVIANLDADKHTALAEKYGVSGFPTLKFFPKGNK-AGEDYDGGRELDDFVKFINEKCGTSRDSKGQLTSEAGIVESLAPLVKE-FLGAANDKRKEALSKMEEDVAKLTGPAAKYGKIYVNSAKKIMEKGS---EYTKKESERLQRMLEKSI-SPSKADEFVIKKNILSTF 364          
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Match: A0A267F114 (Thioredoxin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032001g1 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 2.573e-33
Identity = 92/389 (23.65%), Postives = 182/389 (46.79%), Query Frame = 3
Query:  156 IYPSES-IIRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELS-DDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSV------------NIRIKD-LKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHS----------VLILYDEDCANPCKILENVAKVFEKE-NDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKV---------LTIAEKDEWKKFYNIVSAFID 1217
            I P+E+  +   T+++    +      +VLF  S   + C++     + L+    + +PD+ FG I    + ++  R++ D+ P++K FP++    T+               +R++  +K  +    +S+       T   +            W    + V + S ++          +L LY  +C  PC + E +A VF  E + V F +    +   L +     +NPT+ WF + DK   + YGGD+    +V F+ND  G  R   G+L+  AGR+ +I++++++    ++L   +  +   V + + +LPH+ +Y+ YY  +L+++ KGS  D++L++E   I+ +L             ++ AE+DE  K +NI+S  +D
Sbjct:   15 ISPAEAKRVLDITEKNLASVVGTKTLALVLFY-SPGCQPCVEVLSVMQRLALSHSVSHPDVKFGRIDIRQEPVLAMRFHADEVPVLKAFPHSSTPITFYGEVTEEALVKFLRGLRLQSAVKAGLTRSGESLYGGASLETATDDGGAADEGDSANPWTTGATVVVNASSYASVILDNETNAMLALYTPECGEPCAVYEKIADVFRHEGHHVVFGRADVTREPQLARFFQAQRNPTLLWFPRGDKNNIVRYGGDVDLHEIVGFINDMTGSHRQPDGKLEPGAGRVAQIERLLRDRAADLVLGRNLQQLSEEVAQAASDLPHSKRYVFYYQRLLRQLMKGSPIDRVLERENAAIDQLLNGGSGGGIGGGSKMSRAERDEAHKLHNIISGVVD 402          
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Match: A0A267EVI3 (Thioredoxin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034270g1 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 5.858e-33
Identity = 92/391 (23.53%), Postives = 182/391 (46.55%), Query Frame = 3
Query:  156 IYPSES-IIRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELS-DDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSV------------NIRIKD-LKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHS----------VLILYDEDCANPCKILENVAKVFEKE-NDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKV-----------LTIAEKDEWKKFYNIVSAFID 1217
            I P+E+  +   T+++    +      +VLF  S   + C++     + L+    + +PD+ FG I    + ++  R++ D+ P++K FP++    T+               +R++  +K  +    +S+       T   +            W    + V + S ++          +L LY  +C  PC + E +A VF  E + V F +    +   L +     +NPT+ WF + DK   + YGGD+    +V F+ND  G  R   G+L+  AGR+ +I++++++    ++L   +  +   V + + +LPH+ +Y+ YY  +L+++ KGS  D++L++E   I+ +L               ++ AE+DE  K +NI+S  +D
Sbjct:   15 IGPAEAKRVLDITEKNLASVVGTKTLALVLFY-SPGCQPCVEVLSVMQRLALSHSVSHPDVKFGRIDIRQEPVLAMRFHADEVPVLKAFPHSSTPITFYGEVTEEALVKFLRGLRLQSAVKAGLTRSGESLYGGASLETATDDGGAADEGDSANPWTTGATVVVNASSYASVILDNETNAMLALYTPECGEPCAVYEKIADVFRHEGHHVVFGRADVTREPQLARFFQAQRNPTLLWFPRGDKNNIVRYGGDVDLHEIVGFINDMTGSHRQPDGKLEPGAGRVAQIERLLRDRAADLVLGRNLQQLSEEVAQAASDLPHSKRYVFYYQRLLRQLMKGSPIDRVLERENAAIDQLLNGGGGGGGGIGGGSKMSRAERDEAHKLHNIISGVVD 404          
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Match: A0A1I8HKW0 (Thioredoxin domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.042e-29
Identity = 65/219 (29.68%), Postives = 119/219 (54.34%), Query Frame = 3
Query:  591 STVKDVSKHSVLILYDEDCANPCKILENVAKVFEKE-NDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKV---------LTIAEKDEWKKFYNIVSAFID 1217
            S + D   +++L LY  +C  PC + E +A VF  E + V F +    +   L +     +NPT+ WF + DK   + YGGD+    +V F+ND  G  R   G+L+  AGR+ +I++++++    ++L   +  +   V + + +LPH+ +Y+ YY  +L+++ KGS  D++L++E   I+ +L             ++ AE+DE  K +NI+S  +D
Sbjct:   33 SVILDNETNAMLALYTPECGEPCAVYEKIADVFRHEGHHVVFGRADVTREPQLARFFQAQRNPTLLWFPRGDKNNIVRYGGDVDLHEIVGFINDMTGSHRQPDGKLEPGAGRVAQIERLLRDRAADLVLGRNLQQLSEEVAQAASDLPHSKRYVFYYQRLLRQLMKGSPIDRVLERENAAIDQLLNGGSGGGIGGGSKMSRAERDEAHKLHNIISGVVD 251          
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Match: A0A1I8IX74 (Thioredoxin domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.851e-29
Identity = 65/221 (29.41%), Postives = 119/221 (53.85%), Query Frame = 3
Query:  591 STVKDVSKHSVLILYDEDCANPCKILENVAKVFEKE-NDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKV-----------LTIAEKDEWKKFYNIVSAFID 1217
            S + D   +++L LY  +C  PC + E +A VF  E + V F +    +   L +     +NPT+ WF + DK   + YGGD+    +V F+ND  G  R   G+L+  AGR+ +I++++++    ++L   +  +   V + + +LPH+ +Y+ YY  +L+++ KGS  D++L++E   I+ +L               ++ AE+DE  K +NI+S  +D
Sbjct:   33 SVILDNETNAMLALYTPECGEPCAVYEKIADVFRHEGHHVVFGRADVTREPQLARFFQAQRNPTLLWFPRGDKNNIVRYGGDVDLHEIVGFINDMTGSHRQPDGKLEPGAGRVAQIERLLRDRAADLVLGRNLQQLSEEVAQAASDLPHSKRYVFYYQRLLRQLMKGSPIDRVLERENAAIDQLLNGGGGGGGGIGGGSKMSRAERDEAHKLHNIISGVVD 253          
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Match: A0A1I8GZB2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.809e-29
Identity = 66/222 (29.73%), Postives = 119/222 (53.60%), Query Frame = 3
Query:  591 STVKDVSKHSVLILYDEDCANPCKILENVAKVFEKENDVSFYKMSFEKA--GPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKV-----------LTIAEKDEWKKFYNIVSAFID 1217
            S + D   +++L LY  +C  PC + E +A VF  E     + + F +A   P   A    +NPT+ WF + DK   + YGGD+    +V F+ND  G  R   G+L+  AGR+ +I++++++    ++L   +  +   V + + +LPH+ +Y+ YY  +L+++ KGS  D++L++E   I+ +L               ++ AE+DE  K +NI+S  +D
Sbjct:   33 SVILDNETNAMLALYTPECGEPCAVYEKIADVFRHEG----HHVVFGRARRDPGTSAGEAQRNPTLLWFPRGDKNNIVRYGGDVDLHEIVGFINDMTGSHRQPDGKLEPGAGRVAQIERLLRDRAADLVLGRNLQQLSEEVAQAASDLPHSKRYVFYYQRLLRQLMKGSPIDRVLERENAAIDQLLNGGGGGGGGIGGGSKMSRAERDEAHKLHNIISGVVD 250          
BLAST of Thioredoxin domain-containing protein vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 83.5741 bits (205), Expect = 1.355e-17
Identity = 82/352 (23.30%), Postives = 150/352 (42.61%), Query Frame = 3
Query:  186 FTQRDFDQWIDENNFLVVLF----CNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQV-QTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPK-PVVIPDIDWMDIPSTVKDVSKHSVLILYD---EDCANPCKILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINY-VIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAF 1211
             T+ +FD+ ++   F +V F    C       C + +  +++L +   +  D+I   +  D D  + +R++V  FP +K FP      + Y+    I D  + I  K           T V  R P  P  + D+D  +    VK+   + ++  +      C N   + E V + F+ E +    K+  +    L Q    +  PT+ +FSKT+K+ G  Y      +  V+F+N+  G  R   G L   AGRI   D    E      +K K     ++   K + +     K   YY+ V++ ++  S  D  +Q E + +  +L  ++ +  +KD++    N++S F
Sbjct:   27 LTKDNFDEVVNGEKFALVEFYAPWCGH-----CKQLAPTYEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEK-----------TGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKD-GEEYSSGRDEQSFVDFMNEKCGTKRTPGGGLNEQAGRINAFDGFAVE-----FMKNKDGRDNVYNNAKSAVDKQDDQKMATYYVKVMERVQ--SKGDSFIQTETSRLERLLEGQI-SAGKKDQFIMRKNVLSQF 353          
BLAST of Thioredoxin domain-containing protein vs. Ensembl Nematostella
Match: EDO43544 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYL9])

HSP 1 Score: 67.781 bits (164), Expect = 2.813e-12
Identity = 86/368 (23.37%), Postives = 169/368 (45.92%), Query Frame = 3
Query:  156 IYPSESI----IRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLF-PYTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCKILE----NVAKVFEKENDVSFYKMSFEK--AGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEV-----LVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAF 1211
            I+ S S+    I +FT  + D+++D + F+ + F  +  D  C +  + F +++D+     DI+ G  +   D  I  RY +D++PM + F   +   +TY    +  D    I  +  S L   K+  ++      P++  +++  +    VK+ +K  ++  Y+ +C   C  +     +V + F  E D    +++ +      LQQ IP  + PT+  +SK +K+ G  Y     +E+     L  F+N      R  +G+L   AGR+ E D++ +E +     + +I   +  V +K+   P + KY  YY  V+  I   ++   ++Q E   +  ++   V   ++ DE ++  NI+  F
Sbjct:   17 IFTSTSVHCKKIVEFTNENVDEYVDGSKFVFIFF-YAPWDDHCQRILQIFDQVADEFADRDDIVVGKSNAYEDVKIATRYWIDRYPMFRYFIKGSTTEETYDGGFKPDDFIRFIAAR--SYLKLNKAMFDL------PLI--ELEKSNFERVVKNRAKDVLVFYYNGNC-KLCDQMAYPYYHVGQAFRNEPDCVVARLNCDTNDGVCLQQKIP--RFPTLKVYSKKNKD-GWTYEPGKNNEMYSQQNLTTFMNSLCKTERLESGRLNTRAGRLDEFDKLAEEFVSDWHRREQI---LRTVREKTATHP-SKKYAAYYAIVMTRI--INEGSHMVQMEIERLERLIAGHVHA-SKSDELERKKNILHHF 362          
BLAST of Thioredoxin domain-containing protein vs. Planmine SMEST
Match: SMESG000016749.1 (SMESG000016749.1)

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 391/391 (100.00%), Postives = 391/391 (100.00%), Query Frame = 3
Query:  144 TCGLIYPSESIIRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCKILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAFIDYAAMALREDTPKHPAEIKEDLTFKYSRSYRDEL 1316
            TCGLIYPSESIIRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCKILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAFIDYAAMALREDTPKHPAEIKEDLTFKYSRSYRDEL
Sbjct:    9 TCGLIYPSESIIRKFTQRDFDQWIDENNFLVVLFCNSEKDKLCIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFPYTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPDIDWMDIPSTVKDVSKHSVLILYDEDCANPCKILENVAKVFEKENDVSFYKMSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVNDHAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKSKELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAEKDEWKKFYNIVSAFIDYAAMALREDTPKHPAEIKEDLTFKYSRSYRDEL 399          
The following BLAST results are available for this feature:
BLAST of Thioredoxin domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O13811|PDI2_SCHPO2.581e-1825.77Protein disulfide-isomerase C17H9.14c OS=Schizosac... [more]
sp|P38661|PDIA6_MEDSA1.020e-1425.28Probable protein disulfide-isomerase A6 OS=Medicag... [more]
sp|O22263|PDI21_ARATH9.485e-1426.01Protein disulfide-isomerase like 2-1 OS=Arabidopsi... [more]
sp|Q942L2|PDI22_ORYSJ1.941e-1224.36Protein disulfide isomerase-like 2-2 OS=Oryza sati... [more]
sp|Q75M08|PDI21_ORYSJ3.801e-1123.51Protein disulfide isomerase-like 2-1 OS=Oryza sati... [more]
back to top
BLAST of Thioredoxin domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F1142.573e-3323.65Thioredoxin domain-containing protein OS=Macrostom... [more]
A0A267EVI35.858e-3323.53Thioredoxin domain-containing protein OS=Macrostom... [more]
A0A1I8HKW01.042e-2929.68Thioredoxin domain-containing protein OS=Macrostom... [more]
A0A1I8IX741.851e-2929.41Thioredoxin domain-containing protein OS=Macrostom... [more]
A0A1I8GZB22.809e-2929.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO473401.355e-1723.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435442.813e-1223.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thioredoxin domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Thioredoxin domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000016749.10.000e+0100.00SMESG000016749.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010837 ID=SMED30010837|Name=Thioredoxin domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1495bp
TTAAAGAAATCTTATTCATTCATTACCCCAGGAATAATCAACGCTAAATC
TTGTCTCTTCCCGCAGCTGTTGTTTAAATGGCATAGAATTCATTTTCACT
ATTCTTCATTTTATTAGCAATGCTCTTTTTTTTGTTTATATTGACATGCG
GCTTGATTTATCCGTCAGAATCCATCATTAGAAAATTCACTCAGCGCGAT
TTCGATCAATGGATTGATGAAAATAATTTTCTTGTTGTTTTATTTTGTAA
TTCCGAAAAAGATAAACTTTGCATCAAGGAAAGTGAAAAATTCAAGGAGC
TTTCAGATGATATGATCAAATACCCTGACATTATCTTTGGATATATATCT
AAAGACTCTGACTCAATAATACTTGCAAGATATAATGTAGACAAATTTCC
CATGGTGAAATTGTTTCCTTATACCGACCAAGTTCAAACGTATTCTGTCA
ATATCCGAATAAAGGATCTTAAAGAAATGATAATGCTGAAAAGAGACAGC
ATTTTAAATCAACGAAAATCTTCGACCAATGTATCAAATCGTAGGCCAAA
ACCTGTTGTCATTCCTGACATAGATTGGATGGATATTCCATCAACGGTAA
AGGATGTTTCGAAACATAGCGTTTTGATATTATACGATGAAGATTGCGCA
AATCCGTGCAAAATCCTAGAAAATGTTGCCAAAGTTTTTGAAAAAGAAAA
TGATGTGTCTTTCTATAAAATGTCCTTTGAAAAAGCCGGCCCACTACAAC
AAGCAATTCCATTTAACAAAAATCCAACAGTTTTCTGGTTTTCAAAAACT
GACAAAGAAAAAGGATTAGTTTACGGTGGGGATATTCGACATGAAGTACT
GGTAGAATTTGTCAATGACCATGCTGGACTGTCTCGAGATTATACAGGTC
AATTAAAGTTTGATGCTGGACGGATTTTAGAAATTGATCAAATAATAAAG
GAAAATATTTTATCAATTCTTTTGAAAACCAAAATCAACTACGTCATATT
TCTAGTAGAAAAAAAGAGTAAAGAACTTCCACATGCGACGAAGTACATAG
ACTATTATCTTGCTGTCTTGAAGGAAATACGAAAAGGTTCAGACTCAGAT
CAAATTTTACAACAAGAGCAAACTTTTATTAATAATGTTCTCAGAAAGAA
GGTATTGACCATTGCAGAAAAGGATGAATGGAAAAAATTTTATAATATAG
TTTCAGCTTTTATAGATTATGCCGCCATGGCTCTCCGAGAAGACACCCCT
AAGCACCCTGCAGAAATCAAAGAAGACTTGACCTTCAAATATTCACGATC
TTATCGTGATGAACTGTAGAAAGGTTTTTGTCGCTTTAGTGCATTTGAAT
ACCTTATCATGTAATTTGTACTAAAATTGTTCTTAACAGTAGTCTTGAAT
GGTTCAGTTGATCTTTGAATGAATTGCCATGTGTGATGCTTGAGTTTCAA
TTCAAATAATGATATTTTACATTACACCTTTGCTAGATTTATGTA
back to top

protein sequence of SMED30010837-orf-1

>SMED30010837-orf-1 ID=SMED30010837-orf-1|Name=SMED30010837-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MLFFLFILTCGLIYPSESIIRKFTQRDFDQWIDENNFLVVLFCNSEKDKL
CIKESEKFKELSDDMIKYPDIIFGYISKDSDSIILARYNVDKFPMVKLFP
YTDQVQTYSVNIRIKDLKEMIMLKRDSILNQRKSSTNVSNRRPKPVVIPD
IDWMDIPSTVKDVSKHSVLILYDEDCANPCKILENVAKVFEKENDVSFYK
MSFEKAGPLQQAIPFNKNPTVFWFSKTDKEKGLVYGGDIRHEVLVEFVND
HAGLSRDYTGQLKFDAGRILEIDQIIKENILSILLKTKINYVIFLVEKKS
KELPHATKYIDYYLAVLKEIRKGSDSDQILQQEQTFINNVLRKKVLTIAE
KDEWKKFYNIVSAFIDYAAMALREDTPKHPAEIKEDLTFKYSRSYRDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR011679ERp29_C
IPR012336Thioredoxin-like_fold
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
Vocabulary: molecular function
TermDefinition
GO:0016853isomerase activity
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 15..128
e-value: 1.1E-9
score: 39.9
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 135..251
e-value: 9.9E-7
score: 30.6
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 164..253
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 18..121
NoneNo IPR availablePANTHERPTHR45672FAMILY NOT NAMEDcoord: 53..364
NoneNo IPR availablePANTHERPTHR45672:SF6PROTEIN DISULFIDE-ISOMERASE LIKE 2-1coord: 53..364
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.691