Cadherin-23

Overview
NameCadherin-23
Smed IDSMED30010835
Length (bp)5803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cadherin-23 (SMED30010835) t-SNE clustered cells

Violin plots show distribution of expression levels for Cadherin-23 (SMED30010835) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cadherin-23 (SMED30010835) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cadherin-23 (SMED30010835) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010835

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010835SMESG000081529.1 SMESG000081574.1 SmedASXL_016735SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30010835SMESG000081529.1 SMESG000081574.1 dd_Smed_v4_15356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010835SMESG000081529.1 SMESG000081574.1 dd_Smed_v4_15356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010835SMESG000081529.1 SMESG000081574.1 dd_Smed_v4_15356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010835SMESG000081529.1 SMESG000081574.1 dd_Smed_v4_15356_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010835SMESG000081529.1 SMESG000081574.1 dd_Smed_v6_15356_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30010835SMESG000081529.1 SMESG000081574.1 SMED30010835smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30010835SMESG000081529.1 SMESG000081574.1 SMED30010835smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cadherin-23 vs. Ensembl Human
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 412.149 bits (1058), Expect = 1.209e-115
Identity = 454/1630 (27.85%), Postives = 717/1630 (43.99%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG--DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L    +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +IT+ A+D D      V Y++  GN  N  F I+   G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G  +E ++      + +  +  D+D   N Q   S + +      F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG   ++ +++   +  + F I+++TG +  N         LDRE      +     D          +   ++I L D NDN P+F    YQA + ENS   T      GP+     D+D+      + YQ      G       F IN+STG VT+ + V  DRE     IL+LL++A D     +  T  + I + D NDN P F   T +V++ +N     ++L + ATD D       ++ YR+       F++  V    TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  + A D D N  L Y I+           VP     N  +   +N   G V V+S ++RE  +T    + VID A++  LP ++     A L + +LDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D     YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGTI     A D+D+G N  +I Y   +  S F ++   G + +++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  ++ATD+D G NG ++Y  L     + F + +       D G +     L++   +F+  V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATDKD GLNG +R++    + N D EFF I PISG +   +  DRE++ +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y      +   F+L P  G L  +++ DRE +  +S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F + LSN+    +  D+V+   D +G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNT-FRIDRHMGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGP-FEVTEGQPGPRVWT-FLAHDRDSGPNGQVEYS-IMDGDPLGEFVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGMP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAV---VTYQLLGAQSG------LFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED--IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLIHLV----TGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVP-----NQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASD--LPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATP------GTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSG-NFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMMATDQDEGPNGELTYS-LEGPGVEAFHVDM-------DSGLVTTQRPLQSY-EKFSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQP-DGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYSILAIHYFRA-LANDSED--VGQVFTMGSMDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 343.584 bits (880), Expect = 2.891e-94
Identity = 401/1340 (29.93%), Postives = 594/1340 (44.33%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIF-----TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TAID D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D++L  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D+G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN+I Y   + S  G  +Y D   +    G +++  P+D E+I N ++ L V+A D  N  +  T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +N+T  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I    +MLDRE       ++  +++    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E       I  G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y LI+E +DN P G  H   +  V + V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          IV A ++ +  + ++  V V + DIND  P FT       G      I     T + ++ ATD+DSG  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D   P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F     T    +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGN-TNSIFALDYISGVLTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNQITYSIVSASAFG--SYFD-ISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--STQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRH-TGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRER---NSS-------HVLIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIG----TSVIVVQATDRDSGDGGLVNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPP-----------------FNQGFCSVYITLLNELDEA----VQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1418          

HSP 3 Score: 257.684 bits (657), Expect = 5.514e-68
Identity = 357/1393 (25.63%), Postives = 576/1393 (41.35%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFK--KFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYK---ILLQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE--NIYPFQSDLAAQL 4867
            LDYE      + + A D A   +  F   +I +++  D    F N+SY + + E L + T ++ V A   D   +   +++          F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       S+ E+   G  +   + +   D D  +N Q     V++  + +I   + IV  N +I    V R  +   LD+  I  +  S +G         P      + + ILD+NDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  K   F +D  +G I T           DRE      +VA   D G   L   T V + + D NDN P+F+   Y+  L E         + ++A D D +  N  + Y     ++   N ++ F+I+   G +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+        T N   ++G    + F       +N T GIV V   LDRE+       I V D   E P   +  +  L I + D NDN P+F  S +Q  + E+    + ++           D DI   + Y L    S  F ++S +G + +     +DRE  S   L   +   D + L+NST    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F + L   +  +   TI         + ++   RGT+    +  V I + D+N++ P F       S + E    GT+I  + A D D   N  + Y    I+ + DTD  +        VN + G ++V S + + L A +   ++ +DN   +P  S    N  + V ++D+NDN P F     P   +     I E     T +  ++A D D GLNG + + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G +    TA D D G  ALI Y        F ++P +G ++ +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D      LTY +E   +  F  D+ + L
Sbjct: 1271 LDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRV---ATVKAWDPDAGSNGQ----VVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDH-YILQVVASDRGTP-------PRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAPP------DRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLD-EGPNGTVTY-----AIVAGNIVNTFRIDRHMGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSIMDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARL-----TFNI--TAGNRERAFF-------INATTGIVTVNRPLDRERIPEYKLTISVKDN-PENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED-IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTVIANITAIDHDL--NPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQF----KPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGL 2564          

HSP 4 Score: 236.498 bits (602), Expect = 1.686e-61
Identity = 383/1431 (26.76%), Postives = 594/1431 (41.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR--VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSN------LNFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN---------NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAV------DRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E+         + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + I + I   D+D         + V  N T+SIF +  I      +L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD D           F  +S    +  D F ++  TG + ++  +D E I      L ++A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL++ V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      Q +I         + SL   T    +N   G +   S+LDRE  S     ++ +D         +T  AT+ I +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I    A LDRE              VS +D G   + +T S TV    LD+NDN+P F +   V  + E    G    + VA D D G N +V +  P          NSSS       G +   T L    I  Y+L +   D   GT     +  + I+V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I     T   +   F +   +   + +V    +   A +  I+ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I  + ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +   V A  +DLG   + S+V +                  ++    I +    FT    S L   +   + T+V      DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A   +              PFN     V + +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  + Q K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYETTQA------YQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAI---DQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGVLTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNISLYE---NVTVGTSVLTVLATDNDAGT--------FGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTIIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYG----QESI---------IYSLEGSTQF-RINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS-------GVVVTTTELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFI-----TGGNVDGKFSVGYRDAVVRTVVGLDRETTAA-YMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLG--PMRSSVRV------------------IVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQA-------------PPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSID----NLNQITYR------FNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFY 1385          

HSP 5 Score: 230.72 bits (587), Expect = 9.285e-60
Identity = 335/1303 (25.71%), Postives = 553/1303 (42.44%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + ++TA D+D G    I Y++   +    F +D  +G +  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD ++  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    +++++ +N++  T++L + ATD D       +++Y     D   F ++      TG I+     ARL    ++    T+ A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I+         S     S F+    I L +  G++ V   LD E+ S   G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV+IT+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++       ++  NS++    +    L    P         K+++ + D  R  +    S  V + ++D+N+N P F  + +  + + E    G  I +V+A D D G NG VSY++ +      F++        +  G ++  + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + +   N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE      S+      G  I  +  A D D G    + Y I  G+    F +   +G L  G +  DRE   ++   V A     +  GP            S  RV+V + DIND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYETTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTF--GEVSY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTIIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIV---------SASAFGSYFD----ISLYEGYGVISVSRPLDYEQIS--NGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLIN-------SSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNG-----PVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSILQLK-ATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY---NHDLGPMR----------SSVRVIVYVEDINDEAPVFT 1209          

HSP 6 Score: 187.193 bits (474), Expect = 1.568e-46
Identity = 281/1058 (26.56%), Postives = 460/1058 (43.48%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKD---------SGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDR-EKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG---TIHFKKS---KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   I + D  D  P+F  S+Y + + E  P  T +      + A+D D+ + + V Y L      +  F IN ++G + +   +IIDRE+      F     +L ++A +    L NS+   + I ILD NDN   F        + EN   G +++   ++   D+D  LN    Y + A   ++    F ++ +        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  +TA D D          GI  K       P ++  F ++ +TG++      N +        YE  L V+  A+D       + N    + +L D+NDN P F+   + +Y   + E +   T   + V A D D  + N  + Y    + + PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V +++   T IL + ATDAD  N   + I Y L G     F +    NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D   N +L Y        ++   GV     F+V      +   G+V  Q  L   EK+S     + V+  A +   PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE+ +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    N    F L  DG L ++  L       +  I++   N     PRG   T+        +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQ--SGLFDINSSTGVVTVRSGVIIDREA------FSPPILELLLLAEDIG--LLNSTAHLL-ITILDDNDNRPTFSPATLTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHLVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELV----ATYEVTLSVIDNASDLPERSVSVPNAKLTVNVL-DVNDNTPQFKPFGITYYMERILEGATPGTT-LIAVAAVDPDKGL-NGLVTYTL--LDLVPPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNF--ALIEYSL-GDGESKFAI----NPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMMATDQDEGPNGELTY--------SLEGPGV---EAFHV------DMDSGLVTTQRPLQSYEKFS-----LTVV--ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNV------YEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYSIL 2886          

HSP 7 Score: 138.658 bits (348), Expect = 8.711e-32
Identity = 154/578 (26.64%), Postives = 260/578 (44.98%), Query Frame = 2
Query:  779 GSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQD--SAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSR---TFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGN--SSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLM---NMTTVIIILKDLNDNPPIFEVR----FYQAWLFENSYNFTFGPVRVKATDK-DVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVA-----YDPSN--SSMFDTCI------IQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESN 2413
            G V L   S  ++     +DYE    +   ++A D  S    +    +++++D+ D  PIF   SY   + E++PV T ++TVTA D D    + ++YSL DG      FAIN T+G+I +   +DRE +D       + LT +A +    + ++ R     V IQ+LD+ND    F +P +  SVYEN  AG ++I    +M  D+D   N +      Y+ +   +   +  V M+  ++  +    S   YE+     V+  G +  P++         + + ++DVNDN P+F    +     I E  P  + +  V ATDKD G+ G + YS      N  ++ F+ID  +G I T          LDRE+     ++ +A+D G  +    M  + + L+D++DN P+F VR      Q  L     +   G +    T   D D   N I+Y F    +   N   NF +    G + ++  +DRE+    I   +V A     + P    S   D         ++++++D+ND  P F    ++  V  +    + ++ + A DAD  N
Sbjct: 2342 GYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDG---ESKFAINPTTGDIYVLSSLDREKKD------HYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVIT---MMATDQDEGPNGEL----TYSLEGPGVEAFH--VDMDSGLVTTQRPLQS---YEKFSLTVVATDGGE-PPLWGT-----TMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQT-------AQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLF-VRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYF----IAAGNEEKNFHLQPD-GCLLVLRDLDRER--EAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN 2877          

HSP 8 Score: 117.472 bits (293), Expect = 2.555e-25
Identity = 160/578 (27.68%), Postives = 238/578 (41.18%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDS--GLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD   GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D G    + Y F+ D   F LD  +G +  I   D E    ++ T+    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I +   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYSTN-IYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNISLYENVTVGTSVL-----------TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTI----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNQITYSIVSASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Human
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 412.149 bits (1058), Expect = 1.308e-115
Identity = 454/1630 (27.85%), Postives = 717/1630 (43.99%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG--DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L    +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +IT+ A+D D      V Y++  GN  N  F I+   G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G  +E ++      + +  +  D+D   N Q   S + +      F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG   ++ +++   +  + F I+++TG +  N         LDRE      +     D          +   ++I L D NDN P+F    YQA + ENS   T      GP+     D+D+      + YQ      G       F IN+STG VT+ + V  DRE     IL+LL++A D     +  T  + I + D NDN P F   T +V++ +N     ++L + ATD D       ++ YR+       F++  V    TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  + A D D N  L Y I+           VP     N  +   +N   G V V+S ++RE  +T    + VID A++  LP ++     A L + +LDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D     YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGTI     A D+D+G N  +I Y   +  S F ++   G + +++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  ++ATD+D G NG ++Y  L     + F + +       D G +     L++   +F+  V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATDKD GLNG +R++    + N D EFF I PISG +   +  DRE++ +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y      +   F+L P  G L  +++ DRE +  +S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F + LSN+    +  D+V+   D +G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNT-FRIDRHMGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGP-FEVTEGQPGPRVWT-FLAHDRDSGPNGQVEYS-IMDGDPLGEFVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGMP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAV---VTYQLLGAQSG------LFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED--IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLIHLV----TGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVP-----NQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASD--LPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATP------GTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSG-NFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMMATDQDEGPNGELTYS-LEGPGVEAFHVDM-------DSGLVTTQRPLQSY-EKFSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQP-DGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYSILAIHYFRA-LANDSED--VGQVFTMGSMDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 339.732 bits (870), Expect = 4.344e-93
Identity = 400/1340 (29.85%), Postives = 592/1340 (44.18%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIF-----TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TAID D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+    N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D+G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN+I Y   + S  G  +Y D   +    G +++  P+D E+I N ++ L V+A D  N  +  T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +N+T  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I    +MLDRE       ++  +++    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E       I  G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y LI+E +DN P G  H   +  V + V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          IV A ++ +  + ++  V V + DIND  P FT       G      I     T + ++ ATD+DSG  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D   P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F     T    +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGN-TNSIFALDYISGVLTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDETQGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNQITYSIVSASAFG--SYFD-ISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--STQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRH-TGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRER---NSS-------HVLIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIG----TSVIVVQATDRDSGDGGLVNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPP-----------------FNQGFCSVYITLLNELDEA----VQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVQVYITVLDENDNSPRF 1418          

HSP 3 Score: 257.299 bits (656), Expect = 8.203e-68
Identity = 359/1393 (25.77%), Postives = 574/1393 (41.21%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFK--KFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYK---ILLQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE--NIYPFQSDLAAQL 4867
            LDYE      + + A D A   +  F   +I +++  D    F N+SY + + E L + T ++ V A   D   +   +++          F I+  +G I +  ++DRE  D      F+ LTV+A +  P +   S   V I +LD NDNS  FD       S+ E+   G  +   + +   D D  +N Q     V++  + +I   + IV  N +I    V R  +   LD+  I  +  S +G         P      + + ILD+NDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  K   F +D  +G I T           DRE      +VA   D G   L   T V + + D NDN P+F+   Y+  L E         + ++A D D +  N  + Y     ++   N ++ F+I+   G +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+        T N   ++G    + F       +N T GIV V   LDRE+       I V D   E P   +  +  L I + D NDN P+F  S +Q  + E+    + ++           D DI   + Y L    S  F ++S +G + +     +DRE  S   L   +   D + L+NST    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F + L   +  +   TI         + ++   RGT+    +  V I + D+N++ P F       S + E    GT+I  + A D D   N  + Y    I+ + DTD  +        VN + G ++V S + + L A +   ++ +DN   +P  S    N  + V ++D+NDN P F     P   +     I E     T +  ++A D D GLNG + + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G +    TA D D G  ALI Y        F ++P +G ++ +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D      LTY +E   +  F  D+ + L
Sbjct: 1271 LDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGD------FYTLTVVADDGGPKV--DSTVQVYITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRV---ATVKAWDPDAGSNGQ----VVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDH-YILQVVASDRGTP-------PRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAPP------DRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLD-EGPNGTVTY-----AIVAGNIVNTFRIDRHMGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSIMDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARL-----TFNI--TAGNRERAFF-------INATTGIVTVNRPLDRERIPEYKLTISVKDN-PENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED-IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTVIANITAIDHDL--NPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQF----KPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGL 2564          

HSP 4 Score: 236.498 bits (602), Expect = 1.788e-61
Identity = 383/1431 (26.76%), Postives = 594/1431 (41.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR--VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSN------LNFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN---------NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAV------DRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E+         + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + I + I   D+D         + V  N T+SIF +  I      +L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD D           F  +S    +  D F ++  TG + ++  +D E I      L ++A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL++ V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      Q +I         + SL   T    +N   G +   S+LDRE  S     ++ +D         +T  AT+ I +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I    A LDRE              VS +D G   + +T S TV    LD+NDN+P F +   V  + E    G    + VA D D G N +V +  P          NSSS       G +   T L    I  Y+L +   D   GT     +  + I+V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I     T   +   F +   +   + +V    +   A +  I+ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I  + ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +   V A  +DLG   + S+V +                  ++    I +    FT    S L   +   + T+V      DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A   +              PFN     V + +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  + Q K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYETTQA------YQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAI---DQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGVLTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDETQGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNISLYE---NVTVGTSVLTVLATDNDAGT--------FGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTIIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYG----QESI---------IYSLEGSTQF-RINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS-------GVVVTTTELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFI-----TGGNVDGKFSVGYRDAVVRTVVGLDRETTAA-YMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLG--PMRSSVRV------------------IVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQA-------------PPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSID----NLNQITYR------FNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFY 1385          

HSP 5 Score: 228.794 bits (582), Expect = 4.100e-59
Identity = 335/1303 (25.71%), Postives = 551/1303 (42.29%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + ++TA D+D G    I Y++   +    F +D  +G +  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD     N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    +++++ +N++  T++L + ATD D       +++Y     D   F ++      TG I+     ARL    ++    T+ A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I+         S     S F+    I L +  G++ V   LD E+ S   G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV+IT+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++       ++  NS++    +    L    P         K+++ + D  R  +    S  V + ++D+N+N P F  + +  + + E    G  I +V+A D D G NG VSY++ +      F++        +  G ++  + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + +   N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE      S+      G  I  +  A D D G    + Y I  G+    F +   +G L  G +  DRE   ++   V A     +  GP            S  RV+V + DIND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYETTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDETQGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTF--GEVSY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTIIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIV---------SASAFGSYFD----ISLYEGYGVISVSRPLDYEQIS--NGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLIN-------SSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNG-----PVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSILQLK-ATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY---NHDLGPMR----------SSVRVIVYVEDINDEAPVFT 1209          

HSP 6 Score: 187.193 bits (474), Expect = 1.594e-46
Identity = 281/1058 (26.56%), Postives = 460/1058 (43.48%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKD---------SGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDR-EKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG---TIHFKKS---KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   I + D  D  P+F  S+Y + + E  P  T +      + A+D D+ + + V Y L      +  F IN ++G + +   +IIDRE+      F     +L ++A +    L NS+   + I ILD NDN   F        + EN   G +++   ++   D+D  LN    Y + A   ++    F ++ +        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  +TA D D          GI  K       P ++  F ++ +TG++      N +        YE  L V+  A+D       + N    + +L D+NDN P F+   + +Y   + E +   T   + V A D D  + N  + Y    + + PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V +++   T IL + ATDAD  N   + I Y L G     F +    NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D   N +L Y        ++   GV     F+V      +   G+V  Q  L   EK+S     + V+  A +   PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE+ +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    N    F L  DG L ++  L       +  I++   N     PRG   T+        +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQ--SGLFDINSSTGVVTVRSGVIIDREA------FSPPILELLLLAEDIG--LLNSTAHLL-ITILDDNDNRPTFSPATLTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHLVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELV----ATYEVTLSVIDNASDLPERSVSVPNAKLTVNVL-DVNDNTPQFKPFGITYYMERILEGATPGTT-LIAVAAVDPDKGL-NGLVTYTL--LDLVPPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNF--ALIEYSL-GDGESKFAI----NPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMMATDQDEGPNGELTY--------SLEGPGV---EAFHV------DMDSGLVTTQRPLQSYEKFS-----LTVV--ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNV------YEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYSIL 2886          

HSP 7 Score: 138.658 bits (348), Expect = 9.317e-32
Identity = 154/578 (26.64%), Postives = 260/578 (44.98%), Query Frame = 2
Query:  779 GSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQD--SAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSR---TFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGN--SSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLM---NMTTVIIILKDLNDNPPIFEVR----FYQAWLFENSYNFTFGPVRVKATDK-DVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVA-----YDPSN--SSMFDTCI------IQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESN 2413
            G V L   S  ++     +DYE    +   ++A D  S    +    +++++D+ D  PIF   SY   + E++PV T ++TVTA D D    + ++YSL DG      FAIN T+G+I +   +DRE +D       + LT +A +    + ++ R     V IQ+LD+ND    F +P +  SVYEN  AG ++I    +M  D+D   N +      Y+ +   +   +  V M+  ++  +    S   YE+     V+  G +  P++         + + ++DVNDN P+F    +     I E  P  + +  V ATDKD G+ G + YS      N  ++ F+ID  +G I T          LDRE+     ++ +A+D G  +    M  + + L+D++DN P+F VR      Q  L     +   G +    T   D D   N I+Y F    +   N   NF +    G + ++  +DRE+    I   +V A     + P    S   D         ++++++D+ND  P F    ++  V  +    + ++ + A DAD  N
Sbjct: 2342 GYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDG---ESKFAINPTTGDIYVLSSLDREKKD------HYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVIT---MMATDQDEGPNGEL----TYSLEGPGVEAFH--VDMDSGLVTTQRPLQS---YEKFSLTVVATDGGE-PPLWGT-----TMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQT-------AQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLF-VRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYF----IAAGNEEKNFHLQPD-GCLLVLRDLDRER--EAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN 2877          

HSP 8 Score: 117.472 bits (293), Expect = 2.576e-25
Identity = 160/578 (27.68%), Postives = 238/578 (41.18%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDS--GLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD   GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D G    + Y F+ D   F LD  +G +  I   D E    ++ T+    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I +   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYSTN-IYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDETQGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNISLYENVTVGTSVL-----------TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTI----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNQITYSIVSASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Human
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 339.732 bits (870), Expect = 1.016e-94
Identity = 361/1177 (30.67%), Postives = 538/1177 (45.71%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLSL-DGYLTLITPLTIYGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP 4249
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TAID D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D++L  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D+G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN+I Y   + S    +Y D   +    G +++  P+D E+I N ++ L V+A D  N  +  T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +N+T  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I    +MLDRE       ++  +++    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E       I  G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y LI+E +DN P G  H   +  V + V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          IV A ++ +  + ++  V V + DIND  P FT       G      I     T + ++ ATD+DSG  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D   P
Sbjct:  187 VTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNT-NSIFALDYISGVLTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNQITYSIVSASAFG-SYFD-ISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--STQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRH-TGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRER---NSS-------HVLIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIG----TSVIVVQATDRDSGDGGLVNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPP 1291          

HSP 2 Score: 234.572 bits (597), Expect = 1.830e-61
Identity = 363/1317 (27.56%), Postives = 556/1317 (42.22%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR--VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSN------LNFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN---------NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAV------DRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTY----SATVRAVPMSQ 4594
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E+         + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + I + I   D+D         + V  N T+SIF +  I      +L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD D           F  +S    +  D F ++  TG + ++  +D E I      L ++A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL++ V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      Q +I         + SL   T    +N   G +   S+LDRE  S     ++ +D         +T  AT+ I +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I    A LDRE              VS +D G   + +T S TV    LD+NDN+P F +   V  + E    G    + VA D D G N +V +  P          NSSS       G +   T L    I  Y+L +   D   GT     +  + I+V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I     T   +   F +   +   + +V    +   A +  I+ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I  + ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +   V A  +DLG   + S+V +                  ++    I +    FT    S L   +   + T+V      DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y    SAT +A P +Q
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYETTQA------YQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAI---DQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGVLTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNISLYE---NVTVGTSVLTVLATDNDAGT--------FGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTIIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYG----QESI---------IYSLEGSTQF-RINARSGEITTTSLLDRETKSEYILIVRAVDGGVGH--NQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS-------GVVVTTTELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFI-----TGGNVDGKFSVGYRDAVVRTVVGLDRETTAA-YMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLG--PMRSSVRV------------------IVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQ 1294          

HSP 3 Score: 231.876 bits (590), Expect = 1.253e-60
Identity = 335/1303 (25.71%), Postives = 553/1303 (42.44%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + ++TA D+D G    I Y++   +    F +D  +G +  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD ++  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    +++++ +N++  T++L + ATD D       +++Y     D   F ++      TG I+     ARL    ++    T+ A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I+         S     S F+    I L +  G++ V   LD E+ S   G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV+IT+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++       ++  NS++    +    L    P         K+++ + D  R  +    S  V + ++D+N+N P F  + +  + + E    G  I +V+A D D G NG VSY++ +      F++        +  G ++  + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + +   N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE      S+      G  I  +  A D D G    + Y I  G+    F +   +G L  G +  DRE   ++   V A     +  GP            S  RV+V + DIND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYETTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTF--GEVSY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTIIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIV---------SASAFGSYFD----ISLYEGYGVISVSRPLDYEQIS--NGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLIN-------SSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNG-----PVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSILQLK-ATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY---NHDLGPMR----------SSVRVIVYVEDINDEAPVFT 1209          

HSP 4 Score: 116.316 bits (290), Expect = 3.580e-25
Identity = 162/581 (27.88%), Postives = 238/581 (40.96%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENT---ITLITIISATDKDS--GLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F       N S    +I E       L   I   DKD   GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D G    + Y F+ D   F LD  +G +  I   D E    ++ T+    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I +   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYS-TNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEF-------NSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNISLYENVTVGTSVL-----------TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTI----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNQITYSIVSASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Human
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 335.88 bits (860), Expect = 2.197e-93
Identity = 359/1177 (30.50%), Postives = 536/1177 (45.54%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLSL-DGYLTLITPLTIYGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP 4249
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TAID D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D++L  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D+G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN+I Y   + S    +Y D   +    G +++  P+D E+I N ++ L V+A D  N  +  T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +N+T  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I    +MLDRE       ++  +++    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E       I  G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y LI+E +DN P G  H   +  V + V+DVN+N PIF Q  YE S   +     +I+    ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          IV A ++ +  + ++  V V + DIND  P FT       G      I     T + ++ ATD+DSG  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D   P
Sbjct:  187 VTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNT-NSIFALDYISGVLTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNQITYSIVSASAFG-SYFD-ISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--STQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRH-TGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSILQA--ATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRER---NSS-------HVLIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIG----TSVIVVQATDRDSGDGGLVNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPP 1290          

HSP 2 Score: 235.343 bits (599), Expect = 1.081e-61
Identity = 363/1316 (27.58%), Postives = 557/1316 (42.33%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR--VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSN------LNFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN---------NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII-SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAV------DRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTY----SATVRAVPMSQ 4594
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E+         + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + I + I   D+D         + V  N T+SIF +  I      +L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD D           F  +S    +  D F ++  TG + ++  +D E I      L ++A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL++ V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      Q +I         + SL   T    +N   G +   S+LDRE  S     ++ +D         +T  AT+ I +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I    A LDRE              VS +D G   + +T S TV    LD+NDN+P F +   V  + E    G    + VA D D G N +V +  P          NSSS       G +   T L    I  Y+L +   D   GT     +  + I+V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I     T   +   F +   +   + +V    +   A +  I+ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+ +ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +   V A  +DLG   + S+V +                  ++    I +    FT    S L   +   + T+V      DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y    SAT +A P +Q
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYETTQA------YQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAI---DQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGVLTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNISLYE---NVTVGTSVLTVLATDNDAGT--------FGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTIIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYG----QESI---------IYSLEGSTQF-RINARSGEITTTSLLDRETKSEYILIVRAVDGGVGH--NQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS-------GVVVTTTELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFI-----TGGNVDGKFSVGYRDAVVRTVVGLDRETTAA-YMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSILQAATDADEGEFGRVWYRI--LHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLG--PMRSSVRV------------------IVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPPFNQ 1293          

HSP 3 Score: 233.032 bits (593), Expect = 6.183e-61
Identity = 336/1303 (25.79%), Postives = 553/1303 (42.44%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + ++TA D+D G    I Y++   +    F +D  +G +  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD ++  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    +++++ +N++  T++L + ATD D       +++Y     D   F ++      TG I+     ARL    ++    T+ A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I+         S     S F+    I L +  G++ V   LD E+ S   G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV+IT+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++       ++  NS++    +    L    P         K+++ + D  R  +    S  V + ++D+N+N P F  + +  + + E    G  I +V+A D D G NG VSY++ +      F++        +  G ++  + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + +   N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE      S+      G  I   AT  D D G    + Y I  G+    F +   +G L  G +  DRE   ++   V A     +  GP            S  RV+V + DIND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYETTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTF--GEVSY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTIIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIV---------SASAFGSYFD----ISLYEGYGVISVSRPLDYEQIS--NGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLIN-------SSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNG-----PVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSILQAAT--DADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY---NHDLGPMR----------SSVRVIVYVEDINDEAPVFT 1208          

HSP 4 Score: 116.316 bits (290), Expect = 3.671e-25
Identity = 162/581 (27.88%), Postives = 238/581 (40.96%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENT---ITLITIISATDKDS--GLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F       N S    +I E       L   I   DKD   GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D G    + Y F+ D   F LD  +G +  I   D E    ++ T+    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I +   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYS-TNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEF-------NSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNISLYENVTVGTSVL-----------TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTI----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNQITYSIVSASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Human
Match: FAT4 (FAT atypical cadherin 4 [Source:HGNC Symbol;Acc:HGNC:23109])

HSP 1 Score: 303.523 bits (776), Expect = 7.459e-82
Identity = 378/1377 (27.45%), Postives = 607/1377 (44.08%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFP--MIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRS--PVQYSLKDGNPFNEYFAINET---SGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE-DSYADVSIAILDVNDNTPI-----FGNSSYTFMIFENSPNFTLIGVVTATDKDS----GIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGL---------MNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDV-ANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGL-NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF--DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRET------KDLYKFRVLANDLGTPS-LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY--IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKD 4792
            S   L  T+ +D E  P  +I L + +    Y   +    + V D+ D  P+F + S   T  E+      VI  TA D D          Y +  GN     F ++ T   SGE     ++ +   D      +  L  +  +  P      +  V +Q  DINDN   F    YQ  V E++  G +++   ++   D D   NA+ +Y L         + F++ P       ++ +R      LD+E  +  +++++ +       +P     A+  I +LDVNDN P+     F  +S    + EN+   T++ ++T TD DS    G     I   N+  + F + SS      N++     + LDRE      +    +D  G           ++ +++I + D+ND+PP+F  + Y+  L E +   ++    + ATD D  + AN R     Y++  G  N L  F I+  +G VT  +   +DRE     +L   + A D           + + + DVND  PVF     + V+V +N  T T +L L ATD D  +      + +    D  +F ++    P +G +       R +   ++  V A+D G PP S+   I +++ +IND  PVF    +     EN   G  I  V+ATDPD  TN  + Y I         S+G    S F V      N   G++  +  LDRE+ +    Q+Q++         P  A  T  I +LD  DNPP+F    + F +FE      N++ G     V A+ +D+   + YL    D    F ++ ++GQ+     +DRE  S     V  S G    ++ V+ITV D+NDN P+F+  I+ +N+ E  Q G    +  A D D G N +V++    N  + F +   +G ++L+ PL ++   Y    IEI+ +  G      S  + +YV DVN+N P+F Q+ YE + ++E   + +   +V A+DKD G NG ++Y I      D F         +   GQ+ + S L + L  R+  +V A D  V  LS    V V + D+NDN P F      S   +  F   +   + +  +SA DKD G NGE+R++ + +  D   F +  ISG ++N   FDRE+        ++ F V+A D G P  L     + V + D++DN P F     L +F  Y+      +IS S+ +  ++  V +A D D G N LI Y  I   +   F +D  SG +  I + D E    YS  ++AV             SG  P N S   + + ILD NDN P F   T+   +++    N +I ++   VT  D
Sbjct:   86 STGALYTTSTIDRESLPSDVINLVVLSSAPTYPTEVR---VLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGR-FRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQ--DINDNPPVFGSSHYQAGVPEDAVVGSSVL---QVAAADADEGTNADIRYRL-----QDEGTPFQMDP----ETGLITVREP----LDFEARRQYSLTVQAMDRG----VPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQ-RHFEVQSSK---VPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSY-VSGISATDGDSGLNANLR-----YSIVSG--NGLGWFHISEHSGLVTTGSSGGLDRELASQIVLN--ISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLD----PVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSI---------SAGD--RSRFQV------NAQSGVISTRMALDREEKTAY--QLQIVATDGGNLQSPNQAIVT--ITVLDTQDNPPVFSQVAYSFVVFE------NVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQ---IEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVT-LSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAF--------GIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFN-----STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPD---FELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKF-----LKDF--YQA-----TISESAANLTQVLRV-SASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVD------------SGTIPLN-STCTLNIDILDENDNTPSFPKSTLFVDVLE----NMRIGELVSSVTATD 1341          

HSP 2 Score: 298.901 bits (764), Expect = 2.086e-80
Identity = 396/1420 (27.89%), Postives = 618/1420 (43.52%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTF---IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIF---EVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENS----PNFTLIGVVT---ATDKDSGIFGKIIYSL-NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNR-----ILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMF---DTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGV----PVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRI--EILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD------GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITL---ITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI--ENIYPFQSD------LAAQLKNLNIDTVFALNITSG 4915
            Q+TL   LDYE  P   L +QA DS   + +N T    I ++D  D  P F  S+    + E + +   V +VTA D D    + + YS+   N     F+I+  +G I +A  +D E+Q +      + L + A +      +S+ + V I + D NDN  +F       S+ EN   G ++I    +   D D + N Q + + +      + F   EV   +  N  I           D E      +++K    A        +  +V+I + D+NDN P+F        I +N+    P+  +  V+T   A D D G  G+I Y + N     F++D  +G +           L+  +    L V A         + T + IIL+ L+   P+F    Y   L E        P+        ++ A+ R     + Y   ++          F I   TG +     +DRE+        LV  Y    S+ F       ++I +QD+NDN PVF  +   + V +NI   + I+ L A DADE     + +TY +I     +F ++    P++G +I      R +   ++  V A D G    S+ + I I V+++ND  P F++ ++SF   E+   G  +  + ATD D+  N ++ Y +     N  +  G+    P+  +FN+T L+               + ++Y  LT  ++  D   +        F T+R+   ILDVNDNPPIF  + +  SL E      N+  G+T      TD D  I   L Y +    SL  +    +G + ++KALDRE+ S  N  V   D        F   + VSI +LDVNDN P F+   ++  I E T + T+  K  A D D+G N+ + +   N   + F + ++DG + L   L    +  Y L +   D  +G      S EV + V+D+N+N PIF+Q  Y+   I E T  GT I +V A D D G NG V Y I+   +T+    Q FRI  V   G I V   L +     +   V A D G    ++  TV++ ++DIND  P F   +SP + + P     EN  TL   I  + A D D G N ++ + L   N D+ F   +  SG L   +S DRETK+ +   + A D G+P+LT    I V+V D++DN+P F S               FT+I   + +G  +  +  A D D   NA+I  I  G    F ++P +G +      DRETKD Y+  V    +      P    S  S        V+V + D+NDNPP F     +  I     P S +  ++  VTD DI   + L Y +   N   F  D      +AA   N   +  F++++  G
Sbjct: 1266 QVTLIGKLDYEATPAYSLVIQAVDSGT-IPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGT-FSISPNTGSIFLAKKLDFETQSL------YKLNITAKDQGRPPRSSTMSVV-IHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVI---SVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEI-----------DREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMF--------ISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDL------RVASALVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDG--PVFTQPKYITILKEGE------PIGTNVIS--IEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQ---GACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEG--ANALVTYTIISGADDSFRID----PESGDLIATRRLDRERRSKYSLLVRADD-GL--QSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIV-----NEDDEDGIFFLNPITGVFNLTRLLDY-------------EVQQYYILT--VRAEDGGGQ--------FTTIRVYFNILDVNDNPPIFSLNSYSTSLME------NLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLS-PKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATD--KGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVE-INENTLTGTDIIQVFAADGDEGTNGQVRYGIV-NGNTN----QEFRIDSVT--GAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFE--LSPYSVNVP-----ENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSA--SGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAY------------FTTIPEDAPTGTDV-LLVNASDADASKNAVIRII--GGNSQFTINPSTGQIITSALLDRETKDNYTLVV----VCSDAGSPEPLSSSTS--------VLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVT--VTDADIGPNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHVKDG 2543          

HSP 3 Score: 283.878 bits (725), Expect = 6.832e-76
Identity = 401/1508 (26.59%), Postives = 649/1508 (43.04%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITN-VFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE-DSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGL--MNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITL------ITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--------SNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNT 5242
            LT  LDYE      L ++A+D     +    +  ++DV D PPIF  +SYS+++ E LPV + V+     D D  + S + YS+  G+   ++    + +G + +   +DRESQ   N V    DL  I     P+   +S   V I +LD+NDN   F  P     + EN+     ++  ++    D   N+  +Y L     NK    F +  I           V+    LD E++ +  +++    +A     P   S  +V + +LD+NDN PIF  + Y   I EN+   T I  V A D D G  G++ Y +   +  ++F IDS TGAI       T    LDRE      +   ATD G     + +TV I+L D+ND  P+FE+  Y   + EN        ++V A D D   +N+++ Y  +       N  + F ++AS G++ +   +DRE    +   L++ A D  + ++  T  I +IV DVNDN P F    +   +P++  T T +L +NA+DAD S     +   R+IG +S  F +    NP TG II      R     +   V  SD G P PLS+   +L+ VT++ND PP F    +          G  +  V  TD D   N +L Y     +++  NS        F++  L G     G +           S +T  + V D  +     P+T   T+ +  ++  D P +      Q  +F + +P S++ T  TG  ++         + Y     +L  +F +D ++GQ+ + + LD E +      +   DG F   S+   + ITVLDVNDN P F +   +  I E      I     A D D+G N  + +   N N  + F ++   G +  + PL    + +Y L I+  D  +G+     S +V I ++D N+N P FSQ+F    P  E + +G  +  V  +D+D G N    Y I+     D  +   F I      G I+++  L +    R+   V+A D+G   +S + T+ VT  DINDN P F+           + S Y +   L      +T + ATD D G NG++ + + S +   E+F I+  +G +         N+  F     + + F V ++D G PSL S   + + ++D +DN P F  S Y             FT ++ +   G K+  V    D+D G N+ + Y  + D  +  F LD  +G +        +    +  TV A      G+ P S          S+A V + + + N + P F+   +   I +  +  S +  +S    D+D      + Y I               + N + +FA+N ++GIL+ A  + ++  +    +M+I   DG +         + S T  VI V  N P F+                      S + F  V  N PSG T +  +A    S T
Sbjct: 1900 LTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTV--DKNGVLKVLKALDRESQSFYNLVVQVHDLPQI-----PASRFTSTAQVSIILLDVNDNPPTFLSPKLT-YIPENTPIDT-VVFKAQATDPDSGPNSYIEYTLLNPLGNK----FSIGTIDG--------EVRLTGELDREEVSNYTLTV----VATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAI-------TVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRG-SNSKLSYVLFGG-----NEDNAFTLSAS-GELGVTQSLDRET--KERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASK----NAVIRIIGGNS-QFTI----NPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHY-----SLSGRNSEK------FHIDPLRGAIMAAGPL--------NGASEVTFSVHVKDGGSF----PKTDSTTVTVRFVNKADFPKVRAKE--QTFMFPENQPVSSLVTTITGSSLRGE------PMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILT-VSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSD--KGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVP--ENSPLGYTVTRVTTSDEDIGINAISRYSIM-----DASLP--FTINP--STGDIVISRPLNREDTDRYRIRVSAHDSGW-TVSTDVTIFVT--DINDNAPRFS-----------RTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQS---EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKY-------------FTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTA---KDKGNPPLS----------SQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVS--ARDRDAAMNGLIKYSI--------------SSGNEEGIFAINSSTGILTLAKALDYE--LCQKHEMTISAIDGGWV----ARTGYCSVTVNVIDVNDNSPVFL----------------------SDDYFPTVLENAPSGTTVIHLNATDADSGT 3225          

HSP 4 Score: 280.796 bits (717), Expect = 6.109e-75
Identity = 381/1338 (28.48%), Postives = 576/1338 (43.05%), Query Frame = 2
Query:  788 SLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYH---VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN--DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT--VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQF-YNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD---PSNSSMFDTCIIQIIVQDVNDNAPVF-GLNTFSVNVPQNI-STNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDP-DTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTL-TGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL----SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDN--GVP--RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS-IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDT-VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTI 4708
            + G +   QL + + LD E      L + A D A      ++N T I + DV D  P+F +++Y+    EE    + V  V+A+D D      V+YS +   P  E  AI   SGEI      DRES         F  TVIAT+         +  V + + DINDN+  F +  YQ ++ E S A +  ++   +   D D   N   + S +  N+       + I + +  + +I       LDYE   + ++ I+ +       IP +S   ++I ILD NDNTP F  S+    + EN     L+  VTATD DSG    + YS+   +    F I  +TG+I+           LD E      +   A D G     +T  V+I ++D NDNPP F        + EN        + V A D D D+ N ++ Y     M  G     ++F I+   G +     +DRE    ++ +L V A D   P  +  +    + I+V D+NDN P+F   N  + +    I S  TTI+   A D DE      +I Y +I  D+  FIV+  Y+          P+      ++N  V A+D G  P   +    + +     + PVFTQ  +     E   IG N+  + A  P  +   + Y+I+     +V      V  LF +    G+ QT  I      LDRE+ + L    +  I+K+   P   +T  A + I + D+NDNPP+F T +   ++ E      NI  G+    + A D D        Y        SF +D  SG +   + LDRE  S  +  V   DG+   +  ++ITV DVND+ P F   +   +I E T  G++ A  +A D D+G N  + +    N     G+     + G   L   L      YY L +   D   G   F   + V   ++DVN+N PIFS   Y  S + E   +G+ +     TD D G N  ++Y I        F         V+  G + V  +L      F  +V  V +   +P  R ++   V++ ++D+NDN P+F          SP+ + I ENT   T++    ATD DSG N  I + L  +N     F I  I G +      DRE    Y   V+A D G PSL+S+  + V+VLD++D            N  I+   L    I+ ++L+G  I  V  A D D G N  + Y I  G+T   F +D  +G +   K  DRE   TY  TV+A   +  G  P +  S           V +++LDIND  PVF +
Sbjct: 1043 AFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVI-LEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAI---SGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISE-SAANLTQVL--RVSASDVDEGNNGLIHYSIIKGNEERQ----FAIDSTSGQVTLI-----GKLDYEATPAYSLVIQAVDSG---TIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKK-------LDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVEN-IPIGTSVISVTAHDPDADI-NGQLSYTIIQQMPRG-----NHFTIDEVKGTIYTNAEIDREFA--NLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIM---AADPDEG--ANGEIEYEIINGDTDTFIVDR-YSGDLRVASALVPSQL----IYNLIVSATDLG--PERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIV-----SVRCEEKTVGRLFTIGRHTGIIQTAAI------LDREQGACLYLVDVYAIEKSTAFP---RTQRAEVEITLQDINDNPPVFPTDMLDLTVEE------NIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIV--NEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAED---GGGQFTTIR-VYFNILDVNDNPPIFSLNSYSTS-LMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFT--------VDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFL---------SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTL--LNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDIND------------NNPIFAQALYKVEINENTLTGTDIIQVF-AADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQA---TDRGSTPRTDTS----------TVSIVLLDINDFVPVFEL 2261          

HSP 5 Score: 269.626 bits (688), Expect = 1.444e-71
Identity = 377/1398 (26.97%), Postives = 594/1398 (42.49%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQI-APVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKI-IYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG---LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNV------PQNISTNTTILFLNATD-----ADE------SNTPQSDITYRLIG-----------VDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYL--------TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLA-TDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTN-------PVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRA--VPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            ++ LT  LD E      L + A D       S     + V+D+ D  PIF  + Y   +NE     T +I V A DGD      V+Y + +GN  N+ F I+  +G I +A  +DRE          + LTV AT+   +    + T V I +LDIND    F+   Y  +V EN       I+  +++  D D  +N++ +      N+ ++       ++ +  + V +      LD E  +   + I      +P           +++ + DVNDN P F + +Y   I E++P  T + +V A+D D+     I I   N    +F I+ STG I T+        LLDRE  +   +V + +D G    L + T+V++ + D+NDNPP F+   Y   +   +   +F       T  D D+  N  L+  Y++S                         + EK   D L+  ++A  P N +            +V          TFSV+V      P+  ST  T+ F+N  D     A E       N P S +   + G           + S N       +  TG +    P    +++ +   +EA D G+PP S+   + I V ++ND  P+F +  F     ENL     I  V+A D D+  N  L Y I+                  N+ N   +N   G +     LDREK S     I+  DK +    P Q+    + I ILD NDN P F        +F    P+ N   G T   V  +D DI      +Y   D SL F ++  +G I + + L+RE        VS  D  + V++ V+I V D+NDN P F      L+  E+T++G+   +  A D D G N  V FYF  + S  F + +  G +          +T  +   I  +  I+   D  RG         V I ++D N+N P F +  Y F+P+T+   +GT +  V A  DKDFG N  V Y   +  D       L + +  ND G I V SSL  +L   F   V A D G P LS+  TV +T+ + N + P F+        P S S GS            ++  +SA D+D+ +NG I++++ S N +   F I+  +G L+  ++ D E    ++  + A D G  + T   ++ V V+D++DN PVF S+              F ++  ++ SG  + ++  A D D G NA+I Y + + D+ +F +DP +G +      D ETK +Y  TV+A  VP  +                CS A V + +   N+  P F +  +    +  A P   IV    + +D+D+ +   + Y I
Sbjct: 2105 EVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGN-TNQEFRIDSVTGAITVAKPLDREKTPT------YHLTVQATDRGSTPRTDTST-VSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTIL--QVVARDDDRGSNSKLSYVLFGGNEDNAF-----TLSASGELGVTQS-----LDRETKERFVLMITATDSGSPALT----GTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGN---SQFTINPSTGQIITSA-------LLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSF---VFAVTVTDADIGPNSELH--YSLSG-----------------------RNSEKFHIDPLRGAIMAAGPLNGA-----------SEV----------TFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSP-RKILTVSAMDKDSGPNGQLDYEIVNG----------------NMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGS----PSQSTSVKVMINILDENDNAPRFS------QIFSAHVPE-NSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQV-FYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSD--RGKPSLISETTVTINIVDSNDNAPQFLKSKY-FTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEY--FISNDN-----HLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGS------------IVRTVSARDRDAAMNGLIKYSISSGN-EEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDY------------FPTVLENAPSGTTVIHL-NATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEE---------------RCSFATVNIQLKGTNEYVPRF-VSKLYYFEISEAAPKGTIVG-EVFASDRDLGTDGEVHYLI 3337          

HSP 6 Score: 244.973 bits (624), Expect = 5.745e-64
Identity = 322/1161 (27.73%), Postives = 503/1161 (43.32%), Query Frame = 2
Query:  914 FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVY---ENSQAG--VAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIA-PVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPN----ARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT---NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGL----NQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLS-------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNP-RGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN--NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG-DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNI 4273
             + V DV D PP FQ+  Y + +       + V  VT  D D    S + YSL   N  +E F I+   G I+ A  ++  S+   +V           +   S   +  T V ++ +    N A+F +   +   +   EN      V  I GS +  E         Y +++     T  I ++   V++++            LD+E+I+   V I+      P F+    SY  + I +LDVNDN PIF    +   I EN SP   L   V+A DKDSG  G++ Y +   +    F I+ +TG I +          LDRE      +   ++D G     T+V +++   D NDN P F  + + A + ENS    +   RV  +D+D+ + N    Y   + S+        F IN STGD+ I  P++RE    D  ++ V A+D   +   D   + I V D+NDNAP F   ++ ++ P+     + +  + ATD DE +  Q    +  I   S  F + A         I KY N    + + +  H+F V +SDRG P L +   + IN+ + ND  P F +S +     +N+ +G  + +V A D      N ++ YFI  +                   N +G     N TG I    S++     S L     +   A +   PP ++ AT+ I + + N + P F  S    ++     P+S+ S G+    V A D D    G ++Y     S+S       F ++S +G + L KALD E       T+S  DG ++  +   +V++ V+DVNDN P F+       + E    GT      A D+D+G NAV+ +   ++ S  F +  + G +T    L       Y L ++  + P      F     V I +   N   P F    Y F  I+E    GTI+GEV A+D+D G +G V Y I        F        ++N K GQI V+  L +    R +  V A + G  R ++    TV VT++D ND       P+   N  S Q S      T +T +SA D DS +    RF+    +G ++  F I+P +G ++     DRET  +Y   VLA D GTPS T + ++
Sbjct: 2453 LVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRN--SEKFHIDPLRGAIMAAGPLNGASEVTFSVH---------VKDGGSFPKTDSTTVTVRFV----NKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEP------MSYYIASGNLGNTFQIDQLTGQVSISQP-----------LDFEKIQKYVVWIEARDGGFPPFS----SYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKIL--TVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRS-------VRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFS-QIFSAHVPENS-PLGYTVTRVTTSDEDIGI-NAISRYSIMDASL-------PFTINPSTGDIVISRPLNRED--TDRYRIRVSAHDSGWTVSTD---VTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQ---VFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISND-------------------NHLGKFKLDNDTGWISVASSLI-----SDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATI-----PESH-SIGSIVRTVSARDRDAAMNGLIKY-----SISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFAT---VNIQLKGTNEYVPRFVSKLYYFE-ISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGF--------QINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDP------PIFTLNIYSVQISEGVPIGTHVTFVSAFDSDS-IPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASL 3496          

HSP 7 Score: 238.424 bits (607), Expect = 5.102e-62
Identity = 346/1300 (26.62%), Postives = 540/1300 (41.54%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRES--QDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKA------ILVIRVKNGSFLDYEQIKSINVSIKGL--QIAPVFNI----------PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSY--NFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAST----GDVTIVTPVDREKIPNDILQLLV---VAYDPSNSSMFDTCIIQII--VQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADE---SNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQ-SLFSFSTYENLDIGINIGQVNATDPD-TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLIT-------IISATDKDSGLNGEIRFNLDSMN-GDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVF 4702
            EE P  T V T+         R    Y L + +     FAIN ++G +     IDRES   D+ N        ++   +AP+      T VR+ + D+NDN+  F  P    +  E+S +G  +I+ +     D D+ +N   + S             Y I+  N+A      I +     G+FL         VS  GL  ++ P + +              Y  V++ + D+NDN P+FG+S Y   + E++   + +  V A D D G    I Y L D    F +D  TG I       T    LD EA  +  +   A D G   L      +I L D+NDN P+ + R++ A     S   N   G V   +  TD D   AN  I  Q         N   +F++ +S       + + + +DRE+IP+  L + V       P  +    + +  ++  V D+ND+ PVF    + VN+ +     + +  ++ATD D    +N   S ++   +G   ++     V    +G + ++  +  +        + A D+G  P  +   +++ + ++NDE PVF+Q   +  S  EN   G  +  + ATD D  +     F +Q       S                L+   G +   S LDRE+ +  +  +   D  +    PPQ++ A + + +LD+NDN P+F    +   + E+    S I+T      V ATD D+   GT++Y +       F V++ SG I    ALDRE  +     +  +DG  L +   + V+ITVLD  DN P F        + E   +G       A+  D   N +       +    F +  + G LT    +      +Y+L +       GT+       V I V D+N+N P F Q   E   + E    G  I +  A D D G NG V Y  L Q   ++F         +N+K G I +   L      +   + A D GVP+LS++  + V + D+NDN P F            Q S YE T++           + A+DKDSG NGEI + +   N GD   F I P  G L      DRE +D Y   V+A+D     L++ VN+ V++ D++DN P+F S     N++ Y              +G  +G V +AVD+D G N  + Y F      F L   SG +    +FDRE+            M + G    SF       G       +A V V + DINDN P F
Sbjct:   53 EEQPPGTLVGTIQT-------RPGFTYRLSESHAL---FAINSSTGALYTTSTIDRESLPSDVIN--------LVVLSSAPTY----PTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDT---ATDSDIGSNGVDHRS-------------YRIIRGNEAGRFRLDITLNPSGEGAFLHL-------VSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLI-------TVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGG-----NEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIV------LNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRS--------------FRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGS----PPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITT------VSATDPDLGTNGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSN-ISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASG---GTV--TGDTMVNITVKDLNDNSPHFLQAI-ESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYS-LKQNPKNLF--------AINEKNGTISLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFD-----------QLS-YEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGD--AFGIFP-DGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNS----TNYTFY--------FEEEQRAGSFVGKV-SAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESL-----------MRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKF 1210          

HSP 8 Score: 223.787 bits (569), Expect = 1.529e-57
Identity = 246/904 (27.21%), Postives = 398/904 (44.03%), Query Frame = 2
Query: 1673 FMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAS---TGDVTIVTPV-----DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLF-SFSTYENLDIGINIGQV-------NATDPDTNCDLAYFIIQNTIN---AVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETP---LPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY--LYFDPSLSFYVDSISGQIFLIKA--LDRETVSNLNFTVSCSD-GVF--LVNSTVSITVLDVNDNEPYFVDYIQV-LNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHE-FFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNI 4273
            F + E  P  TL+G +              Y L++    F I+SSTGA+YT        + +DRE+     V+ +          T V ++++DLNDN P+F          E+S   + G   +  T  D D+ +N + ++ Y +  G  N    F+++ +   +G+   +  V     DRE  P    QLLV   D           + + VQD+NDN PVFG + +   VP++    +++L + A DADE     +DI YRL   +   F ++    P+TG I  + P      R ++ TV+A DRG P L+ R   LI + ++ND  PV     F + S Y ++D    +G V       +A  P  N +++  I+         V SS VP  SL               + V S LDRE+  +    + V D     P   +  +++ A+L I + D+ND+PP+F   +++ +L E+  P S +S       + ATD D  +   L+Y  +  +    F++   SG +    +  LDRE  S +   +S  D GV   +  + + +T+LDVND +P F       +++ E    GT      A D D G+N  V F      +      LD   G L+ I+ L      +Y L++   D   G+        + + ++D+N+N P+F  V Y F+ I E    G+ I  V ATD D G NG V Y I     +        R Q     G I    +L +     +   + A D G  +  N   V +T++D  DN P F+         +  F ++EN      + S +     LN  I + + +  GD +  F I+ ++G L+     DRE +  Y+ +V+A+  GT +  + VNI
Sbjct:   49 FQVLEEQPPGTLVGTIQTRPG-------FTYRLSESHALFAINSSTGALYTT-------STIDRESLPS-DVINLVVLSSAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDS---SSGRQVILDTATDSDIGSNGVDHRSYRIIRG--NEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQ--YQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGT--NADIRYRLQD-EGTPFQMD----PETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSL---------------IKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSG------ISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATD--LGSPPQSSMARINVSLLDINDNSPVFYPVQY-FAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRS--------RFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQ-------VAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITT--GDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASG-GTVTGDTMVNI 881          

HSP 9 Score: 219.935 bits (559), Expect = 1.931e-56
Identity = 288/1094 (26.33%), Postives = 483/1094 (44.15%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYH--VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGV----VTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAI-------YTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKAT---DKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQ---LLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY--NPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGEN-GNVSYKIL-LQKDTDVFILQ---LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDN 3970
            Q++++ PLD+E+     + ++A+D  +    S     I V+DV D  PIF+   + S + E L     ++TV+A+D D      + Y + +GN  N  F+IN  +GEI     +DRE          + LT+ +++   S   S+   V I ILD NDN+  F Q ++   V ENS  G  +   + +   D+D+  NA    S +     S  F + P       I++ R  N    D  +I+ ++    G  ++           DV+I + D+NDN P F  +SY    + + P  T IG     V ATD D G  G++ Y +    + F I+++TG I       Y NV   ++  + +R ++     +  ++D G   L++ TTV I + D NDN P F       +    + N   G   ++ T   DKD  + N+ + Y   N      N+L  FK++  TG +++ +      + +D+ Q   + V A D  N  +     + I V + N + P F  +  S  +P++ S  + +  ++A D D +      I Y +   +      E ++  N  TG + + K  +  L  + H  T+ A D G+   +    + +NV ++ND  PVF    +  +  EN   G  +  +NATD D  TN  +AY     T+ + +S            +L  ++   G++  Q  LD E   +      +  KA   P   + +FAT+ I++   N+  P F + L+ F + E   PK  I       +    D+   G + YL F  S    F ++  +GQI++   LDRE    ++  V   +     G  +   TV++TVLD ND  P F   I  + ISE   +GT      A DSD+  +     YF  + +     S++   G +T+   L    +  Y L +  +D+  GT     S  + + + D+N+N P+ +    E   + E    GT++  + +TD D   N G  +Y +L     T  F L    +    +  D+ QI          A F   V   D+GVP++S+  TV +T+ID NDN
Sbjct: 2620 QVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENL-SPRKILTVSAMDKDSGPNGQLDYEIVNGNMENS-FSINHATGEIRSVRPLDREK------VSHYVLTIKSSDKG-SPSQSTSVKVMINILDENDNAPRFSQ-IFSAHVPENSPLGYTV---TRVTTSDEDIGINAISRYSIM---DASLPFTINPSTG---DIVISRPLNREDTDRYRIR-VSAHDSGWTVS----------TDVTIFVTDINDNAPRFSRTSY----YLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNI-NRHSF-----IVTSSDRGKPSLISETTVTINIVDSNDNAPQF---LKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGL-NSEVEYFISN-----DNHLGKFKLDNDTGWISVAS-----SLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAM--NGLIKYSISSGNE-----EGIFAINSSTGILTLAKALDYEL-CQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAY-----TVQSSDS------------DLFVIDPNTGVITTQGFLDFETKQSY----HLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISE-AAPKGTI---VGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDS--GTPSATGSASLLVTLEDINDNGPMLTVSEGE---VMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQI----------ADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDN 3610          

HSP 10 Score: 199.904 bits (507), Expect = 2.471e-50
Identity = 306/1126 (27.18%), Postives = 480/1126 (42.63%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRS-PVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQ---AWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPN------DILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNF--TVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPK--SNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVSNLNFTVSC---SDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIF----YYKLIIEIMDNPRGTIHFKKSKEV--GIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKD-FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLN-GEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            E  PV + V T+T      SLR  P+ Y +  GN     F I++ +G++ I+  +D         F      V+  E     F   SS   + I +LD+NDN+  F +  +   + EN      + + +     DKD   N Q +   V  N  +S        ++N A   IR      LD E++    ++IK        +  + +   V I ILD NDN P F +  ++  + ENSP    +  VT +D+D GI     YS+ D    F I+ STG I  +         L+RE  +R  +   A D G  ++ T V I + D+NDN P F    Y      L E     T    +V ATD D + +N ++ Y   + S       + F+INA+TG++     +  + +        +    +V + D    S+     + I + D NDNAP F  + +   V +N+   T ++ + A D D+     S++ Y  I  D  N + +   +  TG I     ++ +     NF  TV A D+G PPLS++  + I VTE N   P F+QS  S +  E+  IG  +  V+A D D   +    +I+ +I++ N  G+             +N + GI+ +   LD E        I  ID         +T + ++ + ++DVNDN P+F        L +D+ P    N  +G T  ++ ATD D  GT   + +    S    F +D  +G I     LD ET  + + TV      D      +TV+I +   N+  P FV  +    ISE    GTI  +  A+D D G +  V +    NS    G  ++     I    + GI       ++ ++++    G+I      EV   + V+D N+  PIF+   Y    I+E   IGT +  V A D D        SY I    +   F +           GQI V + L +     +   V AVD+G P  + + ++ VT+ DINDN P  T  VS       +  + EN    TL+  + +TD D   N G   + L S      +F +S  +G LS  R  DRE    +   V+  D G P ++S
Sbjct: 2578 ENQPVSSLVTTITG----SSLRGEPMSYYIASGN-LGNTFQIDQLTGQVSISQPLD---------FEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAM----DKDSGPNGQLDYEIVNGNMENSF-------SINHATGEIRSVRP--LDREKVSHYVLTIKSSDKG---SPSQSTSVKVMINILDENDNAPRF-SQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVIS-------RPLNREDTDRYRIRVSAHDSGWTVS-TDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVT----QVFATDPD-EGSNGQVFYFIKSQS-------EYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAID-DKDFGLNSEVEY-FISND--NHLGKFKLDNDTGWI--SVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMN---GLIKYSISSGNEEGI-----------FAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVA----RTGYCSVTVNVIDVNDNSPVF--------LSDDYFPTVLENAPSGTTVIHLNATDAD-SGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKK-GFQINKKTGQIY---VSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDP-PIFTLNIYSVQ-ISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSIN-------PQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLT--VS-------EGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLS-TAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSS 3596          

HSP 11 Score: 164.851 bits (416), Expect = 1.220e-39
Identity = 210/795 (26.42%), Postives = 347/795 (43.65%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAID-GDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTDYTLLDREAYE--RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD---TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVF 3271
            I ++D  D  P F  S Y + + + + V T +I VTAID  D  L S V+Y + + N   + F ++  +G I +A      S  I+++   F +TV A +   P L  SS+  V I + + N ++  F Q     ++ E+   G  +     +   D+D   N     S    N+         I A+N +  ++ +     LDYE  +   ++I  +    V       Y  V++ ++DVNDN+P+F +  Y   + EN+P+ T +  + ATD DSG    I Y++       FVID +TG I T          LD E  +   L V A         +  TV I LK  N+  P F  + Y    FE S     G +   V A+D+D+   +  + Y  +  S         F+IN  TG + +   +DREK     L++L   +     +  D   + + V D ND  P+F LN +SV + + +   T + F++A D+D S    S  +Y  IG  + N       NP+TG I       R  + ++N +V A D G P  +    +L+ + +IND  P+ T S       EN   G  +  + +TDPD         Y+++        S+G P  S F+++       T G++     +DRE+ +     + V+ K  ++ +P  ++  T+ I ++D NDNP   +T      +F ++    N+  G     VK  D D++ +          S +  SI G    + +  R T    + TV  +DGV 
Sbjct: 2971 INIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGK-FKLDNDTGWISVA------SSLISDLNQNFFITVTAKDKGNPPL--SSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIV---RTVSARDRDAAMNGLIKYSISSGNEEG-------IFAINSSTGILTLAKA--LDYELCQKHEMTISAIDGGWVART---GYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQ-------GFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLY---YFEISEAAPKGTIVGEVFASDRDLGT-DGEVHYLIFGNSRK-----KGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDAND-PPIFTLNIYSVQISEGVPIGTHVTFVSAFDSD-SIPSWSRFSY-FIGSGNENGAFS--INPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVS--EGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLL--------STG-PATSYFSLS-------TAGVLSTTREIDREQIADF--YLSVVTK--DSGVPQMSSTGTVHITVIDQNDNPSQSRT----VEIFVNY--YGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLF--SIPGGTCDLNSQPRSTDGTFDLTVLSNDGVH 3690          
BLAST of Cadherin-23 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 209.92 bits (533), Expect = 6.070e-54
Identity = 236/864 (27.31%), Postives = 370/864 (42.82%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE-DSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDRE-KIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD----------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSN-LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNN 3457
            + V+DV+D  PIF+  SY   + E+ P+ T V++V A D D      ++YSL +GN  N   AIN  SG I  A  +DRE+           L VIA++       S+   V I ++D+NDN+  F    Y  ++ EN      I   + +   D+D   N + + S   ++                  L I    G     E+I + N  I  +  A     P   S   ++I ++D+ND+ P    +     + EN      +G V A D+DSG  G I YS+    + F+ID  +G I T         LLDRE   R  +   A D G   L   TT+ ++LKD+NDN P F+ + Y   + E     +   + +KA D D D    +I Y+         + LD        GD   +  V  E K  +  +++ + A D     +   C++ + + DVN +AP F  + FSV +P++      ++ L A D D  +  +  I Y    +DS  F      +P +G I       R      +  V ASD   PPL+T   I + + +IND  P FT S ++ +  E++ +G +  QV+A D D   N  + YF+ +       SS  P   LF       L++T G + V S LDRE+++ +   I   D+      P  +A + + + + DVNDN P F+   +   + E      N   G+T   + A D D          I G      FD       + +  +I      D E  +N   F +  S G       V I V DVNDN+P   D++ ++N  +  Q+        A D D  +NA + ++   N
Sbjct:  258 VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKN-LLAINAKSGVIQTAAPLDRET------LSLIRLDVIASDKGTPKREST-AMVEITVVDVNDNAPVFASDSYNVTILENITIPAVI---ATVKATDEDFGTNGKVHYSMASSSGIGG--------------LTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS-EDFIIDEDSGLIKTT-------KLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGS-QIITLKAVDNDED---QKITYRIEEADREVFSILD-------IGDQGAILSVSGELKRQDHKVRVEISATD--QGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNAR--IVY---SIDSSQFF---RIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE-------SSSSPSIQLFR------LDRTSGTLRVSSKLDREQFAVIVLPIFARDRGT----PSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAE------NSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVV-RILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEEN 1040          

HSP 2 Score: 202.986 bits (515), Expect = 8.974e-52
Identity = 250/930 (26.88%), Postives = 394/930 (42.37%), Query Frame = 2
Query:  953 FQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL---KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNG-----SFLDYEQIKSINVSIKGLQIAPVFNIPE-DSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAI--ATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY-FPNNSSSPFGLSLDGYLTLITPLTIYGIFYY-----KLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFP 3640
            FQ   Y   + E+ P++T + +V A     +   P+ YS+   +D    N  F ++  SGEI +A  +DRE      V     L V A E      ++S T V + +LD+ DNS  F++  Y G + E++  G  ++    +   D D   N +   S    N               K +L I  K+G     + LD E +  I + +    IA     P+ +S A V I ++DVNDN P+F + SY   I EN     +I  V ATD+D G  GK+ YS+  +       ID STG +          TL +R   +   + A+  A DG    L +   + I + D+ND+ P          L EN +     G  RV A D+  D   N I+   Y+M        ++F I+  +G +     +DRE        L V A D    S+  +  I ++++D+NDNAP F    ++V + + +   + I+ L A D DE       ITYR+   D   F +  + +   GAI+    +  L+ + H   VE S      L  R ++ + + ++N   P F    FS    E+  IG  +  + A D D   N  + Y I                   + +    ++ + G + V S LDRE  +T +    VI  A++   PP      + + + D+NDN P F +S +  ++ ED      I  G +   V A D DI   G + Y   + S S     F +D  SG + +   LDRE  + +   +   D         S +++T+ DVNDN P F      L I+E + VG+     VA D+D G+NA + F  F    +  F +  D     +  +     F Y     K   E+  +   +     +  V I+V DVN+N P
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKA---SHASSQPLYYSMVAPQDSRSQN-LFTLDTMSGEIRLAKSMDRE------VLDKHILKVTAYERVDPTISASTTVV-VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVL---SVFARDLDSGENGEIEYSLGEGN--------------GKNLLAINAKSGVIQTAAPLDRETLSLIRLDV----IASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEV----------TLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG--RVYAIDE--DSGPNGIIK--YSMEGS-----EDFIIDEDSGLIKTTKLLDRETTAR--YSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQK----ITYRIEEADREVFSILDIGD--QGAILSV--SGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-------------------DSSQFFRIDPSSGDISVSSDLDREDRATFS----VIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED------IPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQAS---SGQLSSTVPVRIHVSDVNDNKP 998          

HSP 3 Score: 176.792 bits (447), Expect = 7.762e-44
Identity = 231/827 (27.93%), Postives = 377/827 (45.59%), Query Frame = 2
Query: 2141 FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITVL--DVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY---YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFS-PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYEN--TITLITIISATDKDSGLNGEIRF--NLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTG-DTVMFYLDPFSGH-----LFGIKEFDRETK 4552
            F ++  +G++ +   +DRE +   IL+  V AY+  + ++  +  + + V DV DN+P+F  +++   + ++    TT+L + A D D       +I Y L   +  N +     N K+G I    P  R  + +    V ASD+G P   +  ++ I V ++ND  PVF    ++ +  EN+ I   I  V ATD D  TN  + Y       +  +SSG+           + ++ + G V ++  +D  K S +T  I+  D A     P  ++   L I ++D+ND+ P    +    +L E      N++ G     V A D D    G ++Y   + S  F +D  SG I   K LDRET +  +  V+  D G   +N++ +I V+  D+NDN P F      + ISE    G+      A D+D  E+  + +         F +   G    I  L++ G      +K+ +EI    +G +  +    V +++ DVN+  P F+   + FS  I E++ IG  +  + A D D G+N  + Y I    D+     Q FRI   +  G I V+S L +   A F+ IV A D+  P L+ +  + V + DINDN P FT+       SS   +I E+    T    +SA D D G NG + +  N  S +   + F +   SG L      DRE   +    + A D GTPSL++A  I + + D++DN P F      +++ +Y        I+ +S  G  +G +  A D D G NA I + IF G D  +F ++  +       +    EFD E K
Sbjct:  213 FTLDTMSGEIRLAKSMDREVLDKHILK--VTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGE--NGEIEYSLGEGNGKNLLA---INAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHY-------SMASSSGI---------GGLTIDYSTGEVTLRERID-AKNSPITAVIRAKDGAQ----PALSSTVPLTINVIDINDHAPTLIAAQKMITLEE------NVAIGEEVGRVYAIDEDSGPNGIIKY-SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAI--LSVSGELKRQDHKVRVEISATDQGGLQGRCV--VNVFIDDVNSA-PYFND--HPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI----DSS----QFFRIDPSS--GDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS-------SSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQ----LSYDLY--------IAENSPVGSTVGTI-VARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAK 965          

HSP 4 Score: 158.688 bits (400), Expect = 2.718e-38
Identity = 214/823 (26.00%), Postives = 359/823 (43.62%), Query Frame = 2
Query: 2306 NAPVFGLNTFSVNVPQNISTNTTILFLNATDADESN------TPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVF-LVNSTVSIT--VLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPL-TIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQIL-VNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS-IYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-----MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            NA  F    +   +P++    T I  + A+ A           PQ   +  L  +D++           +G I       R  +  H   V A +R  P +S    ++++V ++ D  P+F +  +     E+  IG  +  V A D D+  N ++ Y + +                 N  NL+ +N   G++   + LDRE  S +  ++ VI  A++   P + + A + I ++DVNDN P+F +  +  ++ E      NI+  A    VKATD D  GT   +++  + S       +D  +G++ L + +D +  S +   +   DG    ++STV +T  V+D+ND+ P  +   +++ + E   +G    +  A D D+G N ++ +      S  F +  D  L   T L        Y L +   D   GT     S  + + + D+N+N P F +  Y  + I+E    G+ I  + A D D  E+  ++Y+I   ++ D    ++F I  + D+G IL V+  LK    +    ++A D G   L   C V V I D+N + P F +   P +   P+ S I    ITL     A D D G N  I +++DS     +FF I P SG++S     DRE +  +   V A+D  +P L ++  IEV++ D++DN P F S       S Y       +IS     G     V +A+D DIG N ++ Y     +      +F LD  SG L    + DRE        V  +P+     G        +P   + + + + + D+NDN P F
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTM-----------SGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEG----------------NGKNLLAINAKSGVIQTAAPLDRETLSLI--RLDVI--ASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILE------NITIPAVIATVKATDEDF-GTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM--EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARD--MGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVT-ISEEMPRGSQIITLKAVDND--EDQKITYRI---EEAD---REVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVN-SAPYFND--HPFSVKIPEHSPIGYPVITL----KAEDHDRGDNARIVYSIDS----SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTS-------SSYAA-----TISEDIPVGTSFLQV-SAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-----QFAVIVLPIFARDRG--------TPSLSAASEITLTLSDVNDNAPTF 892          

HSP 5 Score: 130.183 bits (326), Expect = 1.131e-29
Identity = 185/651 (28.42%), Postives = 272/651 (41.78%), Query Frame = 2
Query: 2828 NLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDK------AAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNST--VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLI-------TPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDL-YKFRVL--ANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            NL  L+   G + +   +DRE          V+DK      A E   P  +A  T+ + +LDV DN PIF+      S F + +  + I T     + +  D    G ++Y   + +      +++ SG I     LDRET+S +   V  SD G     ST  V ITV+DVNDN P F      + I E   +  + A   A D D G N  V  Y   +SS   GL++D   G +TL        +P+T         +I   D  +  +    +  + I VID+N++ P       +   + E   IG  +G V A D+D G NG + Y +   +D   FI+         D G I     L +   AR++  V A D G P L+ + T+AV + DINDN P+F       +      +I E       II+    D+  + +I + ++    D E F I  I G+   I S   E K   +K RV   A D G       VN+ +  ++        P       FS+         I   S  G+ +  +  A D D G NA IVY     +  F +DP SG +    + DRE + T+S  V A   +              P N S  ++ VI+ DINDN P FT
Sbjct:  211 NLFTLDTMSGEIRLAKSMDRE----------VLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKD----SYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKV-HYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITA--------VIRAKDGAQPAL--SSTVPLTINVIDINDHAPTLIAA-QKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIID-------EDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF-------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE--EADREVFSILDI-GDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNSAPYFNDHP-------FSV--------KIPEHSPIGYPVITLK-AEDHDRGDNARIVYSIDS-SQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHAS------------PPLNTS-TQIEVILDDINDNSPQFT 785          
BLAST of Cadherin-23 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 200.29 bits (508), Expect = 5.802e-51
Identity = 296/1131 (26.17%), Postives = 468/1131 (41.38%), Query Frame = 2
Query:  656 NLAIVDYDEINSICNLTITSVTSGSISDFNITKISINQN------KIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSIN--FTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGN-PFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLY----QGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIG--VVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANN-RILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY--LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GV--FLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFP----IFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL---KNLGARFTFIVNAVDNGVPRLSNNCTVAVTI 3952
             L I ++ ++ +  +  + +VT G    F++ +  I Q       K+ S  +       L +   LD E     +L ++AQD      I      I++ID  D  P+F  S Y+++++  + + +H+ITV A D D    S + Y +K  + P N  FAI+++      A ++   + D+        + V +   +PSL  SS   V I +L    +S   D           + ENS  G +I+    I  + +D         SA+   +T     VY ++     IL     +   L +   K   + I+  Q+               + I D+NDN P + +S     +     N T  G   +TA D D G  G I YS+ D  +   ID  TG I+     NT    +D      +     A DGG   L     V+  L D    PP FE   +Q  + E++     G   VK    +    N+ RI Y   N         ++  ++  +G V I    D EK      Q  V+A + ++ +   T +I I ++DVNDN P+F  N + + V +       +L ++A+D D       +++Y ++  +S +F +    NP TG +  + P AR   R H   V A D G         I I V + + + P F++S +   T E++  GI IG V A        + Y I                   +  +   +++  G +YV   LD + + T+   IQ    + E+    QT      I I D NDNPP F +SL + S+ ED K           + V+A+D D    G ++Y  +   P  S  +D  +GQ+     LD E   N    V  +D G+     N T+ I VLDVNDN P F      + + E +   TI  K VA D D+ EN  +++   N S   FG+  +    + T  +I       + I I+   +G      +    I V+DVN+N P    I   V    SP++      T IG ++A D D G NG+V Y+  LQ  + +F+        V   G + +   L        R + IV+  D GVPR S  C V V I
Sbjct:  128 KLEISEFAQLGT--SFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHDV--------IVVASDHGSPSL--SSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLG-SIVARVSIAQQYRDTKLRL-IGSSALCPQQTDQAH-VYLLLLC--GILDRETASEHHLKFLLEKDGQIIIEHPQL---------------LTIGDINDNAPQWHSSQIHISL-----NRTQGGSRTLTAKDPDLGQNGWIRYSVLD-TELVSIDKETGRIFV---PNT----IDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDT---PIGTCLVKVVANNSQCGNSKRIRYSLQNQD-------EHLTVDTMSGTVCIQKTFDFEK--QKSYQTTVIATNANSET--STSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTF--GEVSYHILS-ESSSFSI----NPVTGEVFAQKPLAR--GRFH-LVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-----SKVKYSIYSG----------------DQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESN---QTQVV---IFIEDHNDNPPQFSSSLVEISIREDLKLHEPF------YVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY-FGID-EKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLS------TAIGTIVAMDPDKGLNGSVLYRAQLQ--SSLFV--------VKSNGDVYLRRQLNASDERHQRLSVIVS--DQGVPRKSVVCHVPVRI 1136          

HSP 2 Score: 157.532 bits (397), Expect = 6.577e-38
Identity = 260/1088 (23.90%), Postives = 439/1088 (40.35%), Query Frame = 2
Query: 1091 NEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVII---ILKDLNDNPP---IFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM---GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEA--VYNPKT-----GAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV---NSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIE--IMDNPRGTIHFKKSK--EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR-FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVN 4270
            +++  ++E SGEI     +D E +        FD+  +  E +    +     + +++ D NDN+ +F   + +  + E +Q G +  + +   V D D       +   +     +++F++     +N+ +    V NG  LD E      + I+         I +      SI I+D NDN P+F  S YT  +  N    + +  V ATD D G   +I Y +    K     +S  AI  +    T  +LL    ++   V+ +A+D G     ++ ++   +L     +PP   I+ V    A L ENS   T G +          VA   I  Q+ +  +   G           A    + +   +DRE      L+ L+      +  +       + + D+NDNAP +  +   +++ +    + T   L A D D        I Y ++  + V+   E   ++ P T     G+ IK             F V A D G P LST + ++ ++ +   +PP F ++L+     E+  IG  + +V               + N     NS  +   SL N    + ++   G V +Q   D EK  +   Q  VI   A +    +T+ + + I + DVNDN PIF  + +  ++ E  KP+  +        V A+D+D    G + Y     S SF ++ ++G++F  K L R      +  VS  DG       ++ + ITV+D +   P F      +  +E    G      +A  S    + V    +  +    F +  D          IY   Y    +   ++ N + T+   +S   +V I++ D N+N P FS    E S I E   +      V A+DKD  +NG V Y I+         +  F        GQ+   S L     R +   V A D G+P  S+N T+ + ++D+NDN P F         S     + EN+   T++  + A DKDS  NG+I + +   NG  E+F I    GN+   RS DRE        ++A D G P  +S  +
Sbjct:   66 SKFLKVDERSGEISTIAHLDYEKR------SKFDIVAVKVEESGETID-----ILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPT---VTDGD-GPKFDVHRFVILQGNVNNVFKLAS-RKVNEQLQADLVVNGQ-LDREFRDKYELLIEAQDGGKPAKIGQ---LRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIK---KTSAPSNSNFAISQSGVITTTASLLPASTHD---VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENS---TLGSI----------VARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLL----EKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNRTQGGSRT---LTAKDPDLGQNGW--IRYSVLDTELVSIDKETGRIFVPNTIDCNIGSEIK-------------FRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKV---------------VANNSQCGNSKRIRY-SLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSY--QTTVIATNANS----ETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPL------LVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPG------IAIGSVGAMSKVKYSIYSGDQDHNFSIDEDTG-------KIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEIS-IREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQF-------TGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEK-------SWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRI--TNGS-EYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTAS 1030          

HSP 3 Score: 143.665 bits (361), Expect = 1.028e-33
Identity = 208/863 (24.10%), Postives = 362/863 (41.95%), Query Frame = 2
Query:  806 VFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATET-APSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGL--MNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSY-NFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPK--TGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG-------VFLVNSTVSITVLDVNDNEPYFVDYIQV 3349
            V+ L L   LD E      L+   +     +  +   + + D+ D  P + +S    ++N          T+TA D D      ++YS+ D     E  +I++ +G I +   ID       N+       V A +  +P+L  S+   V   +LD       F++ L+Q  + E++  G  ++         K +  N+Q   S        +  E   +  M+  + + +       D+E+ KS   ++    IA   N  E S + +SI + DVNDN PIF  + Y   + E       + VV+A+D DSG FG++ Y +      F I+  TG ++               A  R  +V  A DGGG    N   + I + D +   P F    Y+    E+       G V           A +++ Y  Y+   G  ++  NF I+  TG + +   +D +   +D + L + A  PS  S  +   + I ++D NDN P F  +   +++ +++  +     + A+D D+      ++ Y +I     + I    +  +  TG+++        ++R     V+A+D G PP S+ + + I+V ++ND  P F +S ++    EN      +G+V A D D+        ++N        G  V  + N +   G+++  G VY +  +DRE  S +   I   DK     +PP+++ A+ RI +LDVNDNPP         S+     P  +  + A G  V A D D  + G++ Y     S  F V S +G ++L + L+     +   +V  SD        V  V   +S    D+   EP F  YI++
Sbjct:  392 VYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNAPQWHSSQIHISLNR---TQGGSRTLTAKDPDLGQNGWIRYSVLD----TELVSIDKETGRIFVPNTID------CNIGSEIKFRVRAEDGGSPAL--STDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLV---------KVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKT-----FDFEKQKSYQTTV----IATNAN-SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPL----------ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVG----------AMSKVKYSIYS---GDQDH--NFSIDEDTGKIYVTRYLDADV--HDTVLLNIQATLPSGES--NQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKN--GEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLR-----VKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDS--------LEN--------GQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKG----VPPRSSTASARISVLDVNDNPPSC------LSITPIVVPAGSPLSTAIGTIV-AMDPDKGLNGSVLYRAQLQSSLFVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEP-FQKYIEI 1155          

HSP 4 Score: 135.576 bits (340), Expect = 2.964e-31
Identity = 257/1094 (23.49%), Postives = 425/1094 (38.85%), Query Frame = 2
Query: 1646 PIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFV-IDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFE-NSYNFTFG-PVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAS-TGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDT--CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDS---VNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN-DEPP---VFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGL--NQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIF-------YYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTS--ISNSSLSGFKIGN---VATAVDRDIGYNALIVY--IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIEN 4831
            P F      F + E++   T IG ++   ++S      +   ++   KF+ +D  +G I T  +       LD E   +  +VA+  +  G      +++ + D NDN P F  +  +  + E      +F  P          DV    IL    N        L + K+N     D+ +   +DRE    D  +LL+ A D    +      C I+II  D NDNAPVF  + ++ +V  NIS  + ++ + ATDAD      S I+Y +    +    NF +      ++G I      + L    H+  V ASD G P LS+  ++ I V       PP   ++     S    EN  +G  + +V+      +  L   I  + +    +    V  L     L G+   +T    +++ +L+++      GQI +I+        PQ       + I D+NDN P + +S    SL       +    G+     K  D+   G ++Y   D  L   +D  +G+IF+   +D    S + F V   DG     ST   V   +LD     P F   +  + I E T +GT   K VAN+S  G +  + +   N       L++D   T+   + I   F       Y   +I    N   +        + I + DVN+N+PIF    Y  + + E       +  V A+D D G  G VSY IL +  +       F I  V   G++     L     RF  +V+A D G     N+  + +T+ID +   P F+        S  +    E+ +  I I S      G   ++++++ S + DH F              S D +T  +Y  R L  D+     T  +NI+  +   + N     +  ++      + P  F+S  +  S     K+     V  A D+D   N  + Y  I +       +D F+G L      D E    Y   V+A  +            G  P   S   + + +LD+NDN P F        +++ + P + +  +     DKD +    + Y I N
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAH-------LDYEKRSKFDIVAVKVEESG--ETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVF----KLASRKVNEQLQADLVVNGQLDREF--RDKYELLIEAQDGGKPAKIGQLRCSIEII--DANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGEN--SRISYDIKKTSAPSNSNFAIS-----QSGVITTTA--SLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKL-RLIGSSALCPQQTDQAHVYLLL----LCGILDRETASEHHLKFLLEKD------GQI-IIEH-------PQL------LTIGDINDNAPQWHSSQIHISL-------NRTQGGSRTLTAKDPDLGQNGWIRYSVLDTEL-VSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEH---LTVD---TMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSL-----ISIRLKDVNDNWPIFYPNEYHLT-VREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-------FSINPVT--GEVFAQKPLAR--GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSR-------SKYEIRTTEDILPGIAIGSV-----GAMSKVKYSIYSGDQDHNF--------------SIDEDTGKIYVTRYLDADVHD---TVLLNIQATLPSGESNQ----TQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDL------------GIPP-RSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKV--VARDKDSLENGQIVYRITN 983          

HSP 5 Score: 132.494 bits (332), Expect = 2.291e-30
Identity = 268/1066 (25.14%), Postives = 428/1066 (40.15%), Query Frame = 2
Query: 1607 DVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTL---------LDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQ-SDITYRLIGVDSV---NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVII----LINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQ-----VNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG-VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLIT---IISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPP 4696
            D+ + + D NDN P F +      I E +   T   + T TD D   F        D  +  ++  +   ++   +   +  L         LDRE  ++  ++  A DGG     G +  +  II   D NDN P+F    Y A +   S N + G   + V+ATD D+   N+RI Y     S  P N   NF I+ S G +T    +    +P     ++VVA D  + S+  + ++ I V     ++P   +     +   ++  N+T   L +  A  S   Q  D   RLIG  ++         VY      I+ +   +   ++   F +E   +        +II    L+ + +IND  P +  S         + I +N  Q     + A DPD   N  + Y ++                    T L+ +++  G ++V + +D      +  +I+   +A +   P  +    +  ++LD    PP F+ +L+Q  + ED    + I T         +       ++Y   +      VD++SG + + K  D E   +   TV  ++       S +SI + DVNDN P F      L + E  +         A+D D+G    V ++  + SSS F ++ + G +    PL   G F+  L++   D   G    + S  + I VID +   P FS+  YE    TE    G  IG V A  K       V Y I    D D      F I +  D G+I V   L +     T ++N         SN   V + I D NDN P F++       S  + SI E+ + L     ++ A+DKD   NGE+R+++ S +       I   +G LS     D E    YK RV A DLG P  +S + + + VLD++DN P F  ++  M       P T             +G V  A D+D   N  IVY  T  +  F +D   G+++  +  DRE       ++ A      G  P S          S A   + +LD+NDNPP
Sbjct:  107 DILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKF--------DVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEII---DANDNAPVFSRSRYTASV---SANISIGSHLITVQATDADIG-ENSRISYDIKKTS-APSN--SNFAISQS-GVITTTASL----LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENST---LGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLK---FLLEKDGQ--------IIIEHPQLLTIGDINDNAPQWHSS--------QIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLD-------------------TELVSIDKETGRIFVPNTID----CNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPED----TPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS-FSINPVTGEVFAQKPLA-RGRFH--LVVSAKDG--GGQSSENSANIHITVIDKDTKTPQFSRSKYEIR-TTEDILPGIAIGSVGAMSK-------VKYSIY-SGDQD----HNFSIDE--DTGKIYVTRYL-DADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSS-------SLVEISIRED-LKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIE-IDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTI------------VGKVV-ARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVA---EDKGVPPRS----------STASARISVLDVNDNPP 1043          

HSP 6 Score: 114.39 bits (285), Expect = 8.196e-25
Identity = 234/937 (24.97%), Postives = 388/937 (41.41%), Query Frame = 2
Query: 1100 FAINETSGEIIIAMIIDRE-SQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPL-YQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEV---RFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCI-IQIIVQDVNDNAPVFGLNTFSVNV-PQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTR--VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDP------SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-----VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMD-NPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFS-PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ---LFRIQK 3820
            F+IN T+G I + + +DRE SQ+         L +I T+      N S T VR+ + D NDN    D     +  + E+S+ G  +         D D+  N +++   + ++  S   ++ P        LV+R +  S   ++ +++ ++  + GL +     I   +    + A L+       F   +Y   I E  P    I  +    + +G+   I+    D    F +DS  G I TN+        LDRE  ER  +  I T G G    T V + + +LNDN P F +   R     L   SY  T G        KDVD   N    +++ +S        +F I+  TG + +  P+D E +P     L + A D S    FDT   + I V D+NDNAP F    +   V P   S       + A D D        +TY L    S  F V     P++GA+ +K  P A  +  V   TV A+D G P  ST   V ++I   E  D+P  F ++ F F   EN  IG+ IG ++  +        ++ IQ+            + +F++          G ++V   +DRE+ +T   Q+++ ++     +  Q       + +LD NDN P+F +  +  SL      K +++ G     + A+D D    G + Y           +L+    SI    +    LD    +     V   D      +      VS+ +   + + P+FV  +  +++ E T VGT+  K  A++     N  +++    +     G+ +  G LTL T L         + + + D N R  +       + I V  V+   P+F++  Y    PI+  T  G  +G++ A D+D G +G V Y I  ++ T V I +   + R+QK
Sbjct: 1673 FSINSTTGSISV-LPLDREASQEHL-------LIIILTDGGSR--NDSCT-VRVTVADQNDNKPQLDASTPSELEIAESSRVGDVL---HRFRASDMDIGQNGKFSFELLEDSSGS--LDLVP----ETGDLVLR-RLSSLQSWKIKLRVVDHGVPGLYVEKNLEISNRNPQTEAKAPLE-------FLKQTYLSTIDEGLPRGQFIAKLQP--ELAGLTYSIVEGNID--SAFSVDSE-GVIRTNLE-------LDREILERYSLKVIGT-GSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPENLRVGSYVATVGA-------KDVD---NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHT--LTIKATDGS----FDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGA----LTYSLGQGSSSIFRVA----PESGALFMKVLPPAGERYLV---TVTATDNGVPSFSTSVPVSVIIGEAEPTDKPG-FEKAEFRFEVMENSKIGLQIGNLSGEE----SREFHYRIQDP---------EASKIFSIDKF-------GRLFVAGPIDREQRATHEFQVEIDNEM----MTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSL------KDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGK-LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAV-----VPLKIVVEPVDEFAPVFTKSSYTLQIPIS--TPAGESVGQMQAIDEDGGVHGVVKYSISDRQST-VKIEEHTGIIRLQK 2501          

HSP 7 Score: 109.768 bits (273), Expect = 1.765e-23
Identity = 267/1195 (22.34%), Postives = 484/1195 (40.50%), Query Frame = 2
Query:  833 LDYERFPMIQL-QLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEY----FAINET-SGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAII--------IG--SEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTP----IFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLL-----DRE-AYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANN-RILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNC--DLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF--DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-----GYLTLITPLTIYGIFYYKLIIEIMD---NPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTN--PVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEI--RFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNI 4273
            LDYE+     +  ++ ++S   + I    ++V D  D  P F +      ++E   + T     T  DGD       ++ +  GN  N +      +NE    ++++   +DRE +D       ++L + A +   P+     R    I+I+D NDN+  F +  Y  SV  N   G  +I        IG  S I  + K  +A +  N +   +   ++   + P  A    ++V+   +GS                    P  +    S A V+I +L    ++P    I+   S +  + ENS   +++  V+           I     D   K  +  S+       +    Y LL     DRE A E      +  DG  ++    ++ I  D+NDN P      + +     S N T G  R   T KD D+  N  I Y   +  +          I+  TG + +   +D   I ++I +  V A D  + ++     +   + D     P F    + V +P++    T ++ + A ++   N+ +  I Y L   D  +  V+ +    +G + I+K  +   Q + +  TV A++      ++  +I I + ++ND  P+F  + +  +  E       +  V+A+D D+    +++Y I+  +            S F++      N   G V+ Q  L R       G+  ++  A +         A + I ++D +   P F  S ++    ED  P   I+ G+ G   K         ++Y  +  D   +F +D  +G+I++ + LD +    +   +  +      N T V I + D NDN P F   +  ++I E  ++   F    A+D D  +N  V +     SS P G S++     G L+  + L       YKL ++  D    PR +     +  + I+V+DVN+N P F + +Y    + E +   TI+G+V+A DKD  ENG + Y+I     ++ F         +++K G +    S+ + + +     + A D GVP  S+  +  ++++D+NDN PS  +  P+    GS           T I  I A D D GLNG +  R  L S        F+   +G++   R  +   +   +  V+ +D G P  +   ++
Sbjct:   84 LDYEKRSKFDIVAVKVEESGETIDI---LVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRD------KYELLIEAQDGGKPAKIGQLR--CSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLP--ASTHDVIVVASDHGS--------------------PSLS----SSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVS-----------IAQQYRD--TKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTI-GDINDNAP-----QWHSSQIHISLNRTQGGSRT-LTAKDPDLGQNGWIRYSVLDTEL--------VSIDKETGRIFVPNTIDC-NIGSEI-KFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKR--IRYSLQNQDE-HLTVDTM----SGTVCIQKTFDFEKQ-KSYQTTVIATNANSE--TSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSES------------SSFSI------NPVTGEVFAQKPLAR-------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILP--GIAIGSVGAMSK---------VKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSI--ISSHP-GSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSS-----NMTLFIHVLDVNDNAPEFEKSWYTME-VLENSPPKTIVGKVVARDKDSLENGQIVYRIT--NGSEYF--------GIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSP--------LSTAIGTIVAMDPDKGLNGSVLYRAQLQSS------LFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHV 1132          

HSP 8 Score: 105.916 bits (263), Expect = 3.004e-22
Identity = 173/743 (23.28%), Postives = 295/743 (39.70%), Query Frame = 2
Query: 2138 NFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ-VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSF--STY-ENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDRE---KYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPK---SNISTGATGFYVKATDVDIVGTLQYLYFDPS-----LSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVT-QVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVN-NNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPV-------SPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLS----NIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIE 4276
             F IN++TG ++++ P+DRE     +L +++        S  D+C +++ V D NDN P    +T S + + ++      +    A+D D     +           S++ +      P+TG ++ +    RL  ++     +   D G P L     +  N+   N  P    ++   F   TY   +D G+  GQ  A        L Y I++  I+          S F+V        + G++     LDRE   +YS     ++VI   +      Q     + + + ++NDN P F  S          KP+    N+  G+    V A DVD +  L+Y     S       F +D  +G I L   LD E +     T+  +DG F   + ++I V D+NDN P F   +    +S  T   G  FAK  A+D DA     + +     SSS F ++ +     +  L   G  Y  + +   DN  G   F  S  V + + +    + P F +  + F  + E + IG  IG +        E+    Y+I   + + +F +  F        G++ V   + +   A   F V   +  +      C   V ++D NDN P FT+         S ++G              I  I A+D+DSG NG + + + S N D     ++P +G++     N    D      ++  V A D G P+  +   ++
Sbjct: 1672 KFSINSTTGSISVL-PLDREASQEHLLIIILT----DGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLV------PETGDLVLR----RLSSLQSWKIKLRVVDHGVPGL----YVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNID----------SAFSV-------DSEGVIRTNLELDREILERYS-----LKVIGTGSG-----QQIGTRVDVRVNNLNDNVPSFPMS----------KPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGERYL-VTVTATDN--GVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFE-VMENSKIGLQIGNLSGE-----ESREFHYRIQDPEASKIFSIDKF--------GRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQK------------IGQIMASDQDSGENGRVSYRILSGN-DLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQ 2326          

HSP 9 Score: 84.3445 bits (207), Expect = 1.041e-15
Identity = 124/543 (22.84%), Postives = 236/543 (43.46%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEE-LPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ-YNLSAVYN-NKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL---NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDAD 2404
            + LT PLD+E  P   L ++A D ++    N T I V D+ D  P F    Y +T++            + A D D   R  + YSL  G+  +  F +   SG + + ++     +        + +TV AT+   PS   S    V I   +  D    F++  ++  V ENS+ G+ I  G+    E ++ +   Q    S +++ +K   +F   PI    +A    +V+    +D E + S  V  K                   + +LD NDN P+F + +Y   + ++  +   IG + A+D+DSG  G++ Y +   ND      ++  TG+I  N     +   LD        ++  A D G      +    V + +   + + P F +  Y+  + E++   + G V  +++A+++ + + N+ +LY           +     I+  TG++T+ T +D E  P  I+ + +   D +  S      ++I+V+ V++ APVF  +++++ +P +     ++  + A D D
Sbjct: 1984 IHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLT-IFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGS--SSIFRVAPESGALFMKVLPPAGER--------YLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPG-FEKAEFRFEVMENSKIGLQI--GNLSGEESREFHYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVE----IDNEMMTSQKVQCK-----------------CHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGND-LNIVTLNPDTGSIQLN---EWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDT---SVGTVLQKIRASNR-LGMRNDGLLYSLK-------EHQGKLGIDVKTGELTLKTHLDWESEP--IISMYLSVSDGNGRSAV--VPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDED 2470          

HSP 10 Score: 51.9878 bits (123), Expect = 6.332e-6
Identity = 89/378 (23.54%), Postives = 148/378 (39.15%), Query Frame = 2
Query: 1010 VITVTAIDGDRSLRSPVQYSLK--DGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSAN-----FDQPLYQGSVYENSQAGVAII-IGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMG 2119
            V  V AID D+     ++YSLK        E+F I+E SGEI +       S  ++  FG   L    T  A  L + ++ F   ++L    N++      FD+     ++   S  G  I+ +  +  V+ + + ++  + L      K+S I +    VA       I  +    LDY  +K        + + PVF  P    +  S  ++ + +N  I               +F  I     T++      +  +  N P  KF I+S+TG+I            LDREA +   ++ I TDGG   +  TV + + D NDN P  +           S        R +A+D D+   N +  ++    S G
Sbjct: 1448 VHRVVAIDLDKDPE--IRYSLKYAGSEVAKEFFKIDEKSGEIFVV----ESSSALSTSFGGAGLPETLTIRATDLQDLTK-FDEQKVLLKASNASRSTWHFFDEQHKDVTILSTSPQGSQILQLKFQEGVDLQLIPSSPHFEL------KSSKIVQKSASVATGTQRFTIVAQKDDELDYSTLK--------IHVEPVFTEPP-KISSTSCGVVTIEENVGI--------------EDFKRILATGMTEE-----SRFRFQGNAP--KFSINSTTGSI--------SVLPLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIG-QNGKFSFELLEDSSG 1773          
BLAST of Cadherin-23 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 197.593 bits (501), Expect = 4.165e-50
Identity = 277/1035 (26.76%), Postives = 433/1035 (41.84%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL--------KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGS--------VYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVY--NNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTL-------IGVVTATDKDS-GIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVN---ANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGP-PNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILF-LNATDADESNTPQSDITYRL--IGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDI---GINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGT---LQYLYFDPSLSFYV-------DSISGQIFLIKALDRETVSN---LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFP-----IFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENG 3748
             D E  P   + ++A D      I F    ++V+D+ D  P F+  SY ++++    V T VITV A D D +  + + YSL        +  N  + +  +N  SGEI +   I  ++Q        F   VIA +   P    SS   V + +LD    +     P +Q S        V EN +    I+    +   D   N++  Y L+A     NK  S F  +         + + +  G  LDYEQ+ +  +++    +         S     + + DVND  P F    +T  I E  +PN  L       I  V A D DS G   ++ Y +      +  K F ID  TG I+ N        D  +L  EA +R  V A+    G   +   V I++ D+NDN P FE + Y   + E S       + +KA D D    ++ + Y       G  P     F +   +G + +  P+D E   +D   L+++A D  +++   T  + I ++DVNDNAP F    ++  V +       +LF ++ATDAD+ +   S I YRL   G D V  I +     +    + + P A   V   NF V+A D     L     + +NV +IND  P+F + LF +       I   G+    V A D         F    T NA    G+  N L N  ++  ++Q  G ++    LDRE  S     I+V  +A +  +P +  FA + I++ D+NDN P F+ + ++ S+ E+  P      GA      A D D         Y   + S  FYV        S  G + + + LD E V+     +  +  SDG     + V + ++D ND+ P+     +   + E    GT   ++ A D DAG+ A       ++    F +  DG L +   L    I  Y LIIE  DN          + V +Y+ DVN+N P         +F E +P+ +   +GT   E+ ATD+D  E G
Sbjct:  937 FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-------FIFNVIADDNGIPEALQSSAQ-VTLNVLDKQQKA-----PKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDS-RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEG--LDYEQVNNYTLTLTATDMTSRVA----STKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR-SVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKE-SEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEA--SDQYHLVLIASDGRHNA---TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ-DEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPA--GVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARD---------FDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV--RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSV-EETAP-----IGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNI----GRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQ---LGTC--EIRATDRDTAEFG 1906          

HSP 2 Score: 175.252 bits (443), Expect = 2.436e-43
Identity = 279/1139 (24.50%), Postives = 476/1139 (41.79%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFPMI-QLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANF-DQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNG-SFLDYEQIKS-INVSIKGLQIAPVFNIPED---SYADVSIAILDVNDNTPIFGNS---SYTFMIFENS--PNFTLIGVVTATDKDSGIFGKIIYSL----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWL--FENSYNFTFGPVRVKATDKDVDVANN-RILYQFY-NMSMGPP--NYLDNFK-INASTGDVTIVTPVDREKIPNDILQLL--VVAYDPS-NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRV-------------HNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNA----------TDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP----PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPS---LSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLN-ISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGY---LTLITPLTI---YGIFYYKLIIE-IMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEF-----SPITEYTNIGTIIGEVLATDKD--FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFI--VNAVDNGVPRLSNNCTVAVTIIDINDNYPSF 3982
             +  LT     D    P + +L++ A++      ++ T I++ DV D  P F    Y++ + E++P++  ++ VTA+D D    S + YS+ + N     F+IN ++GEI   + +D +  +  +    F++T  A +    +  SS   + I+  + ND SA F     Y   V E++Q G  +I   +I   D D +      ++  + +K     +   + ++++   ++++++G S  D  + ++ IN+++           P     SYA + I I DVN+N P F +    S    I E +   +   I  V ATD DS   G I+YSL    ++  K FVID  TG +       + + + DRE   R  V   ATD G   L+      + + D+NDN P FE   Y+  +  FE       G   +     D D A+N  I Y    + + G    N LD F+ +N  +G++T++ P     IP    + +  V+A D     ++  +  + + V D    AP +  +      + V +N+  N  IL   A  + +S    SD+ Y+L          E+ +         K+ N    V V             +  T+ A+D      ST+  + + V ++ND  P FT  LF+ +  E +    ++ + N           TD D   +  ++ I    N   +    ++ L             G ++     DREK       ++  D++  + LP    P      ++I I DVNDN P F+   +   +      K +   G     +KA D+D    L+Y         + F V + SG IF+ + LD E     +  +  SDG     + V I + DVNDN P F         I E   +  +     A D+D  E +  I Y      +     +  Y   + L+  L      G+  +  +++ I D+  G + +    +V + V D+N+N PIF +  + +      PI    + G    +V A D D    EN N+ Y I+  K   +    +FRI +  + G+I    SL + + +   FI  V A D GVP       V + + D+NDN P F
Sbjct:  592 GIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLT-IRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSIN-SNGEISAKVRLDADQLNERHFVYRFNVT--ARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI---QIQARDADRD-----EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVL-----TPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE-----AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKP-----IPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRN--SDVIYKLTASGGPGNKAESKFRQ-----FNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELT------------GEIFPNEKFDREKIDMYILTVEASDRSV-SALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRV------KESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY---ADVQVNVRDINDNSPIFPERLFGYIEENREPI---HSDGVYFMDVQARDFDDPTTENANIEYGIVRNK--LINGESVFRIDQ--NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF 1661          

HSP 3 Score: 159.073 bits (401), Expect = 1.923e-38
Identity = 295/1233 (23.93%), Postives = 493/1233 (39.98%), Query Frame = 2
Query:  842 ERFPMIQLQLQAQDSAYHVSIN---FTFIQVIDVEDVPPIF-QNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFN----EYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-----PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSF-------LDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDY-TLLDREAYE------------RLFVVAIATDGG---GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDN-------FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTN--------TTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPL---------STRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD-------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRE---TVSNLNFTVSC--SDGVFLVN-STVSITVLDVNDNEPYFVD----YIQVLNISEVTQVGTIFAKFVANDSD--AGENAVV--------------IFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL--KNLGARFTFIVN-AVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND 4237
            ER  + +  + A+D    VS++      I+  +  D   +F   S Y++ + E+    T VI + A D DR     V YS  D N  +      F+I+E +G + +   +   + D+       +LTVI  +       PS  ++S   + I I D+N+N   F        + +  +        + + VE  D +++A  ++          ++ +Y   + ++   VI  + G          D E     +V++K        + P   +   S+ ++D+NDN+P F   SY   +       T +  V A D D+    +I YSL        ID++ G  + N   + D+  L++R + E            +     IA D G    L +   V + + D     P ++             N     V  R +A     D  N+ ++Y+    S GP N  ++       F+      +V I+  +D E++ N  L L         S +  T    + V+DVND  P F ++ F+  + + ++ N          I+ + A D D S+ PQ+++ YR++G  +         +  TG I       R ++ ++  TVEASDR    L         + +V I+IN  ++ND  P F +  +     E+   G ++  + A D D + +L Y +I           +P           G+    G ++V+  LD E     + Q  ++  A++       A   + I I DVNDN P F+   +  ++ E+     ++      F V ATD D       IV  L+    D    F +   SG I L+KALDR+    V + NF V     DG  LV  + V + V D+NDN P F +    YI+  N   +   G  F    A D D    ENA +              +F    N+   F + SLD  ++             + IIE+  N RG    +    V I V D+N+N P F +  YE S + E   IG  +    A D D     NV +   L +++D F +   +  K +  G + V   L  +++  R  F +   V +G  R      V V ++D ND+ P         +G++ +  + E+    T I   +ATD+D+G     R N  S   D +  F     G L    + DRE   +Y   + A D
Sbjct:  707 ERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGV--SAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDI----------VYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG---DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLE-------IDTTAGEEHQN---DLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSG-DSRNSDVIYKL-TASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM---TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTD-SDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVIN--DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLI-----GAGGGRIP----------FGVRTDSGTIFVKEPLDFE----ASDQYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEE-----DVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV--FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEE-NREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREIS----------SEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGS-VEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG--RHDAEAAVHVALVDRNDHAPHI-------HGAT-EHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS---DPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 4 Score: 143.28 bits (360), Expect = 1.287e-33
Identity = 277/1144 (24.21%), Postives = 451/1144 (39.42%), Query Frame = 2
Query:  884 SAYHVSINFTFIQVIDVEDVPPIFQN----SSYSSTMNEELPVDT-HVITVTAIDGDRSLRSPVQYSLK-DGNPFNEYFAINETSGEIIIA--MIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLS--AVYNNKTSSIFEVYPIVAMNKA----ILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE--DSYADVSIAILDVNDNTPIFGNS---SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL---NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERL---FVVAIATDGGGLMNMT-TVIIILKDLNDNPPIFEVRFYQAWLFEN-----SYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSM-------FDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDS--VNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFST-YENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQ---IQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD---------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-----VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD--------GYLTLITPLTIYGIFY---YKLIIEIMDNPRGTIHFKKSKEVGIYV--IDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKD-TDVFILQ---LFRIQKVNDKGQILVNSSL-------KNLGARFT--FIVNAVDNG-----VPRLS-----------NNCTVAVTIIDINDNYPSFTNPVSPS 4003
            S  H S     I + DV +  P F +    S  +  M      D   ++ V A D D S    + YSL    +   + F I+  +G +  +  ++ DRE++         D+TV AT+           F  ++++DINDNS  F++P Y+ SV      G ++I    +   D D   NA+  Y+L        +  +  + + +V         I  I +K   F+        NV      IA    IPE   S A V++ +LD     P +  S        + EN     +I    A          +IY L     P  K          + N N   +  +++   YE++    +   ATD    +  T T ++ ++D+ND  P F V  +   + E          T G   V VKA D D D   N + Y+    + G      +F+I+  TG++      DREKI  D+  L V A D S S++        D   +QI++ DVNDNAP F    +   V ++      ++ + A D D+     S++ Y LIG     + F V       +G I  K P        ++  + ASD G    +T V   I++ ++ND  P F Q  ++ +   E++DI   +  V+ATD D +   +  + +         G   + +F +       +  G + +   LDR+  + +      +Q ID      +     +A +++ + D+NDN PIF   LF + + E+ +P    S G     V+A D D           G ++    +    F +D  +G+IF +++LDRE  S   F +        V S      V+I V D+NDN P+F       ++ E   +G     F A D+D      V  Y  +  S  F ++ D        G L +  PL    +     + L I + D        +   E  ++V  +D N++ P           + E    GT IG   ATD+D G+     ++I  Q D    F +      R+    D+  I V + +        N+G +    ++ +  DNG     VPR               C +  T  D  +  P FT  VSPS
Sbjct:  842 SKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRE------DVTVKATDRGDRPLIGFCQF-SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVIT---VFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-------FNV------IADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANG--EETKHFRIDELTGEIFPNEKFDREKI--DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK----HSNLRYHLIGAGGGRIPFGVRT----DSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNV--YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYR-------LEGQGADEVFRI------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLV----GYADVQVNVRDINDNSPIFPERLFGY-IEENREPIH--SDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-------RHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPS 1916          

HSP 5 Score: 115.546 bits (288), Expect = 3.149e-25
Identity = 288/1241 (23.21%), Postives = 493/1241 (39.73%), Query Frame = 2
Query: 1592 EDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVV---AIATDGGGLMNMTTVIII---LKDLNDNPPIF-EVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI---VTPVDREKIPNDILQLLVVAYDPSNSSMFDT------CIIQIIVQDVNDNAPVFG------------LNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN---FIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFI-IQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSM-LDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKP----KSNISTGATGFYVKA------TDVDIV---------GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFV---------------DYIQVLNISEVTQVGTIFAKFVANDSDAGENAV---VIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI---ISATDKDSG-LNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK---DLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSN---YLLMNFS-IYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYS------ATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQD--NVDGFIQMSIGVSDGKY 5002
             +S+ D++I I DVNDN P F    YT  + E+ P    I  VTA DKD+G   +I YS+++    F I+S+ G I   V  + D      +  ER FV      A D G  +++++  +I    ++ ND   +F     Y A++ E++   T  PV +++A D D D     + Y F + +      ++ F I+  TG V +   V+  D  +  N I  L V+  D  +  ++ +        + I ++DVN+N P F               T+  + P       TI+ + ATD D S     DI Y L    S +   F+++    V  P    +  +    R  V     TV+A+DRG  PL       + V +IND  P F +  +  S      +G ++  V A D D   N ++ Y + I  T    + + +    L N        ++G I  ++ + +  +K+        VI      P   Q++ A + + +LD     P +QTS        D KP      N+         +A       + D++         G      F     F   +   ++ +++ LD E V+N   T++ +D    V ST +  + V DVND  P F                ++++  N   +  V     K +  DSD  +N V   ++       +  F +  L G +          I  Y L +E  D      P      K + +V I + DVN+N P F +  Y    + E    G  +  + A D D  ++ N+ Y ++      +     F ++   D G I V   L      ++  ++ A D    R +    V + I D+NDN P F      +       ++ E  + +  +   + ATD D    +  I + L+    D E F I   SG +  +++ DR+       + F V A D     L    +++V V D++DN P+FP     Y+  N   I+   + F  +           +  T  + +I Y  +   +  G++V F +D  +G +F ++  DRE            A  R VP  +          G+       A V + + D+NDN P F      G + + A   + ++  S +  D++    N  TY +      +SD      + +     +   + G+L     + ++D    DGF  + I VSDG++
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN--HNFSINSN-GEISAKVRLDAD------QLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGT--PVIQIQARDADRD----EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPI-NLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP-------TIVKVEATDDDSS--ANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDV-----TVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVN-------RRSGEITLIKPIPMKTQKFI-----FNVIADDNGIPEALQSS-AQVTLNVLDKQQKAPKWQTS-------PDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTV-----KAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKY-IGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRI----PFGVR--TDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYAT-------TVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD-EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDF------DDPTTENANIEYGIVRNKLINGESV-FRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSRE----------GF-------ANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEE-AKDNVFTYQLSE----ESDYFYVTTDKD-----SKQSSVGVLRVKQPLDYEDVTQRDGF-HLGIRVSDGRH 1752          

HSP 6 Score: 95.1301 bits (235), Expect = 5.038e-19
Identity = 118/438 (26.94%), Postives = 196/438 (44.75%), Query Frame = 2
Query: 1100 FAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTF--VRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIV-AMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTP-IFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKI-IYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPP------------NYLDN-FKINASTGDVTI-VTPV---DREK-IPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVN 2344
            F I++ +G+I     +DRE   I++   F    +I          S   F  V I++ D+NDN+  F++  Y+GSV E +  G A++  S       D +  A+ N+     ++ S  F V     +   ++ V+RVK    LDYE +   +    G++++   +   D+ A V +A++D ND+ P I G + +   + E+ P  T IG  TATD+D+G   +  I   +DP ++F ID   G +     A+T    LDRE      ++  A D    +    V + L+D+NDN P            EN+     G   ++ATD+D                 GPP             YL+  F  N   G+ ++ +TP+   DRE  +P  IL++ ++  D   +   +   + +I+ D+NDN    G  T  VN
Sbjct: 1602 FRIDQNTGKIFAMRSLDRE---ISSEREF----IIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAF-----DADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQP--LDYEDVTQRDGFHLGIRVS---DGRHDAEAAVHVALVDRNDHAPHIHGATEH--RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQD-GTLRV---AHT----LDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDT-------------AEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILAD--RAGRRNEASVHVIIGDLNDNTMHDGRMTIHVN 1997          

HSP 7 Score: 92.4337 bits (228), Expect = 3.396e-18
Identity = 291/1278 (22.77%), Postives = 503/1278 (39.36%), Query Frame = 2
Query: 1196 TVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFE-NSPNFTLIGVVTATDK---DSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPND--ILQLLVVAYDPSNS-SMFDTCIIQIIVQDVNDNAPVF-GLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY--NPKTGAIIKKYPNARLQVRVH----NFTVEASDRG----YPP--LSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGI------NIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIG-LNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSL--FEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY-----------FDPSLSFY--VDSISGQIFLIKALDRETVSNLNFTVSCSDGV---FLVNSTVSITVLDVNDNEPYFV---DYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP------NNSSSPFGL--SLDGYLTLITPLTIYGIFY-----YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFY------EFSP--ITEYTNIGTIIGEVLATDKDF-GENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRL-------SNNCTVAVTIIDINDNYPSFTNP-----VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIG-NV-ATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETK---DTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVK 4735
            ++IAT     L ++    +RI + DI++  +  + PL   +V   +     I+       E  D ++N  Y        KT  +      +   K+ +V       +  YE+  +  +S + + ++P  N      ++V+I  +  ++  P F    Y   + E N  +++++ V   + +   D    G I YSL      D  K F ID STG I+      T     D  A  +L  + +        +   + I + D+NDN P F    Y A + E+   N T   ++V A DKD    N+RI Y   N          NF IN S G+++    +D +++     + +  V A D     S+  + +I I  ++ ND + VF   + ++  V ++    T ++ + A DAD     + ++TY  +  +  +     ++  +  TG +  ++  +   +       N TV   D G    YP    ++   +LI + ++N+  P F      +S    +  G        I +V ATD D+  N D+ Y +      +  +        F +    G L  +  +V+ +    RE  +          KA +    P   F    +E++D+NDN P F+   ++ S+  FE        + G +   V A D D     +  Y               L F+  V+  SG+I LIK +  +T   +   ++  +G+      ++ V++ VLD     P +    D    + + E  ++  +  +  A  S    N+ VI+         N + S F      +     +  + + G+ Y     Y L +   D    T     +K   + V DVN+  P F+   +      E +P    E TN G  I  V A D D  G    V Y+I+ + + +    + FRI ++   G+I  N    +     +   V A D  V  L        +N  V + I D+NDN PSF        V  S G         + IT    I A D D   N  +R++L    G    F +   SG +      D E  D Y   ++A+D G  + T+ V I +  ++               N   +E     T++    +   K+  NV AT  D+D   ++ IVY   G     +F +  +SG +  +K  DR+      +++  V+A+     G+G    L GY       A V V + DINDN P+F  P  L G ++
Sbjct:  391 SIIATVPINGLQSTRTQTIRIHVADIDEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLY--------KTIDVIPAGSFIVDPKSGVV----RTGWSKYERGDTYRISAQAMDLSPSDNTTS-QLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHL-----TRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTI--LKVTAVDKDTG-DNSRITYSVDNH---------NFSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD-----RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKA--------FVIDRQTGVLTPSPHVVFDRETRPREDVTV---------KATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE--------AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM---TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTN-GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEE--TKHFRIDELT--GEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG------HDVIT----IKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVND--------------NAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQD-EKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAI--DDDGNG----LVGY-------ADVQVNVRDINDNSPIF--PERLFGYIE 1555          
BLAST of Cadherin-23 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 197.593 bits (501), Expect = 4.165e-50
Identity = 277/1035 (26.76%), Postives = 433/1035 (41.84%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL--------KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGS--------VYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVY--NNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTL-------IGVVTATDKDS-GIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVN---ANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGP-PNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILF-LNATDADESNTPQSDITYRL--IGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDI---GINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGT---LQYLYFDPSLSFYV-------DSISGQIFLIKALDRETVSN---LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFP-----IFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENG 3748
             D E  P   + ++A D      I F    ++V+D+ D  P F+  SY ++++    V T VITV A D D +  + + YSL        +  N  + +  +N  SGEI +   I  ++Q        F   VIA +   P    SS   V + +LD    +     P +Q S        V EN +    I+    +   D   N++  Y L+A     NK  S F  +         + + +  G  LDYEQ+ +  +++    +         S     + + DVND  P F    +T  I E  +PN  L       I  V A D DS G   ++ Y +      +  K F ID  TG I+ N        D  +L  EA +R  V A+    G   +   V I++ D+NDN P FE + Y   + E S       + +KA D D    ++ + Y       G  P     F +   +G + +  P+D E   +D   L+++A D  +++   T  + I ++DVNDNAP F    ++  V +       +LF ++ATDAD+ +   S I YRL   G D V  I +     +    + + P A   V   NF V+A D     L     + +NV +IND  P+F + LF +       I   G+    V A D         F    T NA    G+  N L N  ++  ++Q  G ++    LDRE  S     I+V  +A +  +P +  FA + I++ D+NDN P F+ + ++ S+ E+  P      GA      A D D         Y   + S  FYV        S  G + + + LD E V+     +  +  SDG     + V + ++D ND+ P+     +   + E    GT   ++ A D DAG+ A       ++    F +  DG L +   L    I  Y LIIE  DN          + V +Y+ DVN+N P         +F E +P+ +   +GT   E+ ATD+D  E G
Sbjct:  937 FDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-------FIFNVIADDNGIPEALQSSAQ-VTLNVLDKQQKA-----PKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDS-RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEG--LDYEQVNNYTLTLTATDMTSRVA----STKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDR-SVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKE-SEGEGHDVITIKAHDLD---KHSNLRYHLIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEA--SDQYHLVLIASDGRHNA---TTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQ-DEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPA--GVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARD---------FDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEV--RANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSV-EETAP-----IGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATE-HRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNI----GRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQ---LGTC--EIRATDRDTAEFG 1906          

HSP 2 Score: 175.252 bits (443), Expect = 2.436e-43
Identity = 279/1139 (24.50%), Postives = 476/1139 (41.79%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFPMI-QLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANF-DQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNG-SFLDYEQIKS-INVSIKGLQIAPVFNIPED---SYADVSIAILDVNDNTPIFGNS---SYTFMIFENS--PNFTLIGVVTATDKDSGIFGKIIYSL----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWL--FENSYNFTFGPVRVKATDKDVDVANN-RILYQFY-NMSMGPP--NYLDNFK-INASTGDVTIVTPVDREKIPNDILQLL--VVAYDPS-NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRV-------------HNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNA----------TDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP----PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPS---LSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLN-ISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGY---LTLITPLTI---YGIFYYKLIIE-IMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEF-----SPITEYTNIGTIIGEVLATDKD--FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFI--VNAVDNGVPRLSNNCTVAVTIIDINDNYPSF 3982
             +  LT     D    P + +L++ A++      ++ T I++ DV D  P F    Y++ + E++P++  ++ VTA+D D    S + YS+ + N     F+IN ++GEI   + +D +  +  +    F++T  A +    +  SS   + I+  + ND SA F     Y   V E++Q G  +I   +I   D D +      ++  + +K     +   + ++++   ++++++G S  D  + ++ IN+++           P     SYA + I I DVN+N P F +    S    I E +   +   I  V ATD DS   G I+YSL    ++  K FVID  TG +       + + + DRE   R  V   ATD G   L+      + + D+NDN P FE   Y+  +  FE       G   +     D D A+N  I Y    + + G    N LD F+ +N  +G++T++ P     IP    + +  V+A D     ++  +  + + V D    AP +  +      + V +N+  N  IL   A  + +S    SD+ Y+L          E+ +         K+ N    V V             +  T+ A+D      ST+  + + V ++ND  P FT  LF+ +  E +    ++ + N           TD D   +  ++ I    N   +    ++ L             G ++     DREK       ++  D++  + LP    P      ++I I DVNDN P F+   +   +      K +   G     +KA D+D    L+Y         + F V + SG IF+ + LD E     +  +  SDG     + V I + DVNDN P F         I E   +  +     A D+D  E +  I Y      +     +  Y   + L+  L      G+  +  +++ I D+  G + +    +V + V D+N+N PIF +  + +      PI    + G    +V A D D    EN N+ Y I+  K   +    +FRI +  + G+I    SL + + +   FI  V A D GVP       V + + D+NDN P F
Sbjct:  592 GIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLT-IRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSIN-SNGEISAKVRLDADQLNERHFVYRFNVT--ARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVI---QIQARDADRD-----EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVL-----TPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE-----AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKP-----IPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRN--SDVIYKLTASGGPGNKAESKFRQ-----FNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV-VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELT------------GEIFPNEKFDREKIDMYILTVEASDRSV-SALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRV------KESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGY---ADVQVNVRDINDNSPIFPERLFGYIEENREPI---HSDGVYFMDVQARDFDDPTTENANIEYGIVRNK--LINGESVFRIDQ--NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF 1661          

HSP 3 Score: 159.073 bits (401), Expect = 1.923e-38
Identity = 295/1233 (23.93%), Postives = 493/1233 (39.98%), Query Frame = 2
Query:  842 ERFPMIQLQLQAQDSAYHVSIN---FTFIQVIDVEDVPPIF-QNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFN----EYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-----PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSF-------LDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDY-TLLDREAYE------------RLFVVAIATDGG---GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDN-------FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTN--------TTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPL---------STRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD-------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRE---TVSNLNFTVSC--SDGVFLVN-STVSITVLDVNDNEPYFVD----YIQVLNISEVTQVGTIFAKFVANDSD--AGENAVV--------------IFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL--KNLGARFTFIVN-AVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND 4237
            ER  + +  + A+D    VS++      I+  +  D   +F   S Y++ + E+    T VI + A D DR     V YS  D N  +      F+I+E +G + +   +   + D+       +LTVI  +       PS  ++S   + I I D+N+N   F        + +  +        + + VE  D +++A  ++          ++ +Y   + ++   VI  + G          D E     +V++K        + P   +   S+ ++D+NDN+P F   SY   +       T +  V A D D+    +I YSL        ID++ G  + N   + D+  L++R + E            +     IA D G    L +   V + + D     P ++             N     V  R +A     D  N+ ++Y+    S GP N  ++       F+      +V I+  +D E++ N  L L         S +  T    + V+DVND  P F ++ F+  + + ++ N          I+ + A D D S+ PQ+++ YR++G  +         +  TG I       R ++ ++  TVEASDR    L         + +V I+IN  ++ND  P F +  +     E+   G ++  + A D D + +L Y +I           +P           G+    G ++V+  LD E     + Q  ++  A++       A   + I I DVNDN P F+   +  ++ E+     ++      F V ATD D       IV  L+    D    F +   SG I L+KALDR+    V + NF V     DG  LV  + V + V D+NDN P F +    YI+  N   +   G  F    A D D    ENA +              +F    N+   F + SLD  ++             + IIE+  N RG    +    V I V D+N+N P F +  YE S + E   IG  +    A D D     NV +   L +++D F +   +  K +  G + V   L  +++  R  F +   V +G  R      V V ++D ND+ P         +G++ +  + E+    T I   +ATD+D+G     R N  S   D +  F     G L    + DRE   +Y   + A D
Sbjct:  707 ERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRD---EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGV--SAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDI----------VYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG---DRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLE-------IDTTAGEEHQN---DLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSG-DSRNSDVIYKL-TASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM---TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTD-SDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVIN--DVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLI-----GAGGGRIP----------FGVRTDSGTIFVKEPLDFE----ASDQYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEE-----DVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEV--FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEE-NREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREIS----------SEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGS-VEETAPIGAAVMSFSAFDADEEAKDNV-FTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG--RHDAEAAVHVALVDRNDHAPHI-------HGAT-EHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS---DPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 4 Score: 143.28 bits (360), Expect = 1.287e-33
Identity = 277/1144 (24.21%), Postives = 451/1144 (39.42%), Query Frame = 2
Query:  884 SAYHVSINFTFIQVIDVEDVPPIFQN----SSYSSTMNEELPVDT-HVITVTAIDGDRSLRSPVQYSLK-DGNPFNEYFAINETSGEIIIA--MIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLS--AVYNNKTSSIFEVYPIVAMNKA----ILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE--DSYADVSIAILDVNDNTPIFGNS---SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL---NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERL---FVVAIATDGGGLMNMT-TVIIILKDLNDNPPIFEVRFYQAWLFEN-----SYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSM-------FDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDS--VNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFST-YENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQ---IQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD---------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-----VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD--------GYLTLITPLTIYGIFY---YKLIIEIMDNPRGTIHFKKSKEVGIYV--IDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKD-TDVFILQ---LFRIQKVNDKGQILVNSSL-------KNLGARFT--FIVNAVDNG-----VPRLS-----------NNCTVAVTIIDINDNYPSFTNPVSPS 4003
            S  H S     I + DV +  P F +    S  +  M      D   ++ V A D D S    + YSL    +   + F I+  +G +  +  ++ DRE++         D+TV AT+           F  ++++DINDNS  F++P Y+ SV      G ++I    +   D D   NA+  Y+L        +  +  + + +V         I  I +K   F+        NV      IA    IPE   S A V++ +LD     P +  S        + EN     +I    A          +IY L     P  K          + N N   +  +++   YE++    +   ATD    +  T T ++ ++D+ND  P F V  +   + E          T G   V VKA D D D   N + Y+    + G      +F+I+  TG++      DREKI  D+  L V A D S S++        D   +QI++ DVNDNAP F    +   V ++      ++ + A D D+     S++ Y LIG     + F V       +G I  K P        ++  + ASD G    +T V   I++ ++ND  P F Q  ++ +   E++DI   +  V+ATD D +   +  + +         G   + +F +       +  G + +   LDR+  + +      +Q ID      +     +A +++ + D+NDN PIF   LF + + E+ +P    S G     V+A D D           G ++    +    F +D  +G+IF +++LDRE  S   F +        V S      V+I V D+NDN P+F       ++ E   +G     F A D+D      V  Y  +  S  F ++ D        G L +  PL    +     + L I + D        +   E  ++V  +D N++ P           + E    GT IG   ATD+D G+     ++I  Q D    F +      R+    D+  I V + +        N+G +    ++ +  DNG     VPR               C +  T  D  +  P FT  VSPS
Sbjct:  842 SKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPRE------DVTVKATDRGDRPLIGFCQF-SVEVVDINDNSPQFERPSYETSVSRFEAVGTSVIT---VFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-------FNV------IADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANG--EETKHFRIDELTGEIFPNEKFDREKI--DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK----HSNLRYHLIGAGGGRIPFGVRT----DSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNV--YIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYR-------LEGQGADEVFRI------GKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLV----GYADVQVNVRDINDNSPIFPERLFGY-IEENREPIH--SDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-------RHDAEAAVHVALVDRNDHAPHIHGATEHR--VREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPS 1916          

HSP 5 Score: 115.546 bits (288), Expect = 3.149e-25
Identity = 288/1241 (23.21%), Postives = 493/1241 (39.73%), Query Frame = 2
Query: 1592 EDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVV---AIATDGGGLMNMTTVIII---LKDLNDNPPIF-EVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI---VTPVDREKIPNDILQLLVVAYDPSNSSMFDT------CIIQIIVQDVNDNAPVFG------------LNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN---FIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFI-IQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSM-LDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKP----KSNISTGATGFYVKA------TDVDIV---------GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFV---------------DYIQVLNISEVTQVGTIFAKFVANDSDAGENAV---VIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI---ISATDKDSG-LNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK---DLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSN---YLLMNFS-IYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYS------ATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQD--NVDGFIQMSIGVSDGKY 5002
             +S+ D++I I DVNDN P F    YT  + E+ P    I  VTA DKD+G   +I YS+++    F I+S+ G I   V  + D      +  ER FV      A D G  +++++  +I    ++ ND   +F     Y A++ E++   T  PV +++A D D D     + Y F + +      ++ F I+  TG V +   V+  D  +  N I  L V+  D  +  ++ +        + I ++DVN+N P F               T+  + P       TI+ + ATD D S     DI Y L    S +   F+++    V  P    +  +    R  V     TV+A+DRG  PL       + V +IND  P F +  +  S      +G ++  V A D D   N ++ Y + I  T    + + +    L N        ++G I  ++ + +  +K+        VI      P   Q++ A + + +LD     P +QTS        D KP      N+         +A       + D++         G      F     F   +   ++ +++ LD E V+N   T++ +D    V ST +  + V DVND  P F                ++++  N   +  V     K +  DSD  +N V   ++       +  F +  L G +          I  Y L +E  D      P      K + +V I + DVN+N P F +  Y    + E    G  +  + A D D  ++ N+ Y ++      +     F ++   D G I V   L      ++  ++ A D    R +    V + I D+NDN P F      +       ++ E  + +  +   + ATD D    +  I + L+    D E F I   SG +  +++ DR+       + F V A D     L    +++V V D++DN P+FP     Y+  N   I+   + F  +           +  T  + +I Y  +   +  G++V F +D  +G +F ++  DRE            A  R VP  +          G+       A V + + D+NDN P F      G + + A   + ++  S +  D++    N  TY +      +SD      + +     +   + G+L     + ++D    DGF  + I VSDG++
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN--HNFSINSN-GEISAKVRLDAD------QLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGT--PVIQIQARDADRD----EVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPI-NLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP-------TIVKVEATDDDSS--ANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDV-----TVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVN-------RRSGEITLIKPIPMKTQKFI-----FNVIADDNGIPEALQSS-AQVTLNVLDKQQKAPKWQTS-------PDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTV-----KAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKY-IGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRI----PFGVR--TDSGTIFVKEPLDFEASDQYHLVLIASDG---RHNATTNVYIHIEDVNDNAPQFEQQKYAT-------TVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGAD-EVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDF------DDPTTENANIEYGIVRNKLINGESV-FRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSRE----------GF-------ANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEE-AKDNVFTYQLSE----ESDYFYVTTDKD-----SKQSSVGVLRVKQPLDYEDVTQRDGF-HLGIRVSDGRH 1752          

HSP 6 Score: 95.1301 bits (235), Expect = 5.038e-19
Identity = 118/438 (26.94%), Postives = 196/438 (44.75%), Query Frame = 2
Query: 1100 FAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTF--VRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIV-AMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTP-IFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKI-IYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPP------------NYLDN-FKINASTGDVTI-VTPV---DREK-IPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVN 2344
            F I++ +G+I     +DRE   I++   F    +I          S   F  V I++ D+NDN+  F++  Y+GSV E +  G A++  S       D +  A+ N+     ++ S  F V     +   ++ V+RVK    LDYE +   +    G++++   +   D+ A V +A++D ND+ P I G + +   + E+ P  T IG  TATD+D+G   +  I   +DP ++F ID   G +     A+T    LDRE      ++  A D    +    V + L+D+NDN P            EN+     G   ++ATD+D                 GPP             YL+  F  N   G+ ++ +TP+   DRE  +P  IL++ ++  D   +   +   + +I+ D+NDN    G  T  VN
Sbjct: 1602 FRIDQNTGKIFAMRSLDRE---ISSEREF----IIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAF-----DADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQP--LDYEDVTQRDGFHLGIRVS---DGRHDAEAAVHVALVDRNDHAPHIHGATEH--RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQD-GTLRV---AHT----LDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRDT-------------AEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILEIPLILAD--RAGRRNEASVHVIIGDLNDNTMHDGRMTIHVN 1997          

HSP 7 Score: 92.4337 bits (228), Expect = 3.396e-18
Identity = 291/1278 (22.77%), Postives = 503/1278 (39.36%), Query Frame = 2
Query: 1196 TVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFE-NSPNFTLIGVVTATDK---DSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPND--ILQLLVVAYDPSNS-SMFDTCIIQIIVQDVNDNAPVF-GLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY--NPKTGAIIKKYPNARLQVRVH----NFTVEASDRG----YPP--LSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGI------NIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIG-LNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSL--FEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY-----------FDPSLSFY--VDSISGQIFLIKALDRETVSNLNFTVSCSDGV---FLVNSTVSITVLDVNDNEPYFV---DYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP------NNSSSPFGL--SLDGYLTLITPLTIYGIFY-----YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFY------EFSP--ITEYTNIGTIIGEVLATDKDF-GENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRL-------SNNCTVAVTIIDINDNYPSFTNP-----VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIG-NV-ATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETK---DTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVK 4735
            ++IAT     L ++    +RI + DI++  +  + PL   +V   +     I+       E  D ++N  Y        KT  +      +   K+ +V       +  YE+  +  +S + + ++P  N      ++V+I  +  ++  P F    Y   + E N  +++++ V   + +   D    G I YSL      D  K F ID STG I+      T     D  A  +L  + +        +   + I + D+NDN P F    Y A + E+   N T   ++V A DKD    N+RI Y   N          NF IN S G+++    +D +++     + +  V A D     S+  + +I I  ++ ND + VF   + ++  V ++    T ++ + A DAD     + ++TY  +  +  +     ++  +  TG +  ++  +   +       N TV   D G    YP    ++   +LI + ++N+  P F      +S    +  G        I +V ATD D+  N D+ Y +      +  +        F +    G L  +  +V+ +    RE  +          KA +    P   F    +E++D+NDN P F+   ++ S+  FE        + G +   V A D D     +  Y               L F+  V+  SG+I LIK +  +T   +   ++  +G+      ++ V++ VLD     P +    D    + + E  ++  +  +  A  S    N+ VI+         N + S F      +     +  + + G+ Y     Y L +   D    T     +K   + V DVN+  P F+   +      E +P    E TN G  I  V A D D  G    V Y+I+ + + +    + FRI ++   G+I  N    +     +   V A D  V  L        +N  V + I D+NDN PSF        V  S G         + IT    I A D D   N  +R++L    G    F +   SG +      D E  D Y   ++A+D G  + T+ V I +  ++               N   +E     T++    +   K+  NV AT  D+D   ++ IVY   G     +F +  +SG +  +K  DR+      +++  V+A+     G+G    L GY       A V V + DINDN P+F  P  L G ++
Sbjct:  391 SIIATVPINGLQSTRTQTIRIHVADIDEPPSFVNSPLPMLAVVPLNPTIGRIVYQFVARDEHGDGDSNVLY--------KTIDVIPAGSFIVDPKSGVV----RTGWSKYERGDTYRISAQAMDLSPSDNTTS-QLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHL-----TRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTI--LKVTAVDKDTG-DNSRITYSVDNH---------NFSIN-SNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD-----RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCA-KYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKA--------FVIDRQTGVLTPSPHVVFDRETRPREDVTV---------KATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFE--------AVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM---TSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTN-GKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEE--TKHFRIDELT--GEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEG------HDVIT----IKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIEDVND--------------NAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQD-EKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAI--DDDGNG----LVGY-------ADVQVNVRDINDNSPIF--PERLFGYIE 1555          
BLAST of Cadherin-23 vs. Ensembl Celegans
Match: cdh-8 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:U4PRG1])

HSP 1 Score: 174.481 bits (441), Expect = 2.980e-43
Identity = 259/1052 (24.62%), Postives = 431/1052 (40.97%), Query Frame = 2
Query: 1646 PIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYS-LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPN-DILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPK-----TGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY---LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVS-----ITVLDVNDNEPYFVDYIQ-VLNISEVTQVGTI--FAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIY---ENTITLITIISATDKDSGLNGEIRFNLDSM-NGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLA---NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F  S Y F + EN     L  V   +D      G + Y  L +  +KF I S+ G I        +   +DRE YE+  ++  ATD  G    + +II +KD NDN PIF+   Y   + E         +++ ATD D    N +I+Y            +DN  I+ S   +  +  +DRE + N + + L V A D        +  + I V+D+NDN+PVF  + +S+ +  NIS    I  L ATDAD S +P + +TY                +PK     +G I+   P    +     F V A D G P  S   +++IN  E      +  +     ++ +       I  +NA  P       Y II+ + +  + S         V   I ++   G +Y    +D  +   +   I +     E P+        L I ++D +D  PI+ T   + S+ E      + + G T   +    +     ++Y   +   P     +D   G I +IK+LD ET   +   V   +G+ + N   +     +T+LD NDN P F +     +++ E + +GT+      +A D D+ + + + +       YF  + S       +  + L+ PL       + L I+ +DN     H +    V + VIDVN+N P+          I E   +G ++  ++ +D D G          +QK        LFR    +DK  +++ S   + G R    V A D G  R ++   V V        YP+     +P   +  Q SI+   EN +    +     ++ G  G + F LD M   D + F I  I+G+L   ++FD E K +++ ++LA   N+  +  L  +VN      D +DN P+FP   + +            ++  +     ++G +  A+D D   +   V   T   + F+ DP    LF    FDRE K  +  ++ A         PH  ++G           ++ +LDINDN P F+
Sbjct:  451 PKFEKSEYQFQVVENREPTVLGEVKVISD------GPVTYEILGENGEKFQI-SNDGEIQ-------NLEPIDRETYEKFELIVKATDLNGSSGKSQLIIHVKDENDNSPIFDKEHYFITVDEGKSE----KLKITATDADSG-KNGQIVYSI-------DQKIDNLPIDISPDGMLFIGAIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPLDANISPGGIIGRLEATDAD-STSPNNYVTY-------------TSGDPKFTVSDSGEILFTGPGTLEKSASLEFNVTAQDGGDPMNSANALVVIN--EHRSMKSIENELTTQINSNDTGGEKSEIKWLNAGMP----GYTYEIIRASADGFSDS--------EVATWISIDSKSGRIYTLKKVDPSRVKQIKLHISMRKGKREVPV-------ELIINVMDTDDVTPIYSTPTRKLSVTE------SATLGTTVVDMPVEGIKEQNEIKYSLKITSGPRGKLQIDRY-GTIKIIKSLDFETEQIIKGIV---EGMVVKNGKAAKSSFILTILDANDNRPIFKNSSNFAVSLLESSVLGTVLDLPYPLATDRDSSKFSTLKYSMTGDEGYFKIDES-------NSTIRLVAPLDFETQRVHSLSIKCVDNQGREPHHEVFASVTVTVIDVNDNAPVIHNTDLTHLSIEEDAQVGQVVTVLVISDSDEGG---------VQKTEIDVNSTLFRAD--SDKKLVVIASLKGHAGQRICSTVTATDVGGLRATSPYCVTV--------YPAKNTHHNPLVITPKQNSIHYFDENIVYDELLKVKVLEEDGDIGNVTFRLDEMFKKDWQMFTIGEINGSLHARQAFDFEKKTVHEIKILACRINNCTSTHLFISVN------DRNDNCPMFPKQDVRL------------TVLENEKGKRQVGRIPAALDSDFHSDNTKVCYTTDTPLFFFSDPTLPILFTNSSFDREHKKQHQISITAYDCHLSCRDPHKPINGT-------IVALIDVLDINDNFPKFS 1380          

HSP 2 Score: 97.0561 bits (240), Expect = 1.155e-19
Identity = 257/1137 (22.60%), Postives = 460/1137 (40.46%), Query Frame = 2
Query:  980 MNEELPVDTHV-ITVTAIDGDRSLRSPVQYSLKDGNPFNEYF---AINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ--IKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIF-GNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG---------LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDIL---QLLVVAYDPS-----NSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---FPNNSSSPFGLSLDGY-----LTLITPLTIYGIFY--YKLIIEIMDNPRGTIHFKKSK-----EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVA-----VTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIIS-----ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND 4237
            + E+ PV TH+ +T+           P    +  G+P + YF    INET   + + + +D + ++   + G     VIA    P     SR  + +QI+D+NDNS  F        + EN++ G  I    ++   D D   +     S   +   SS        +  K    +R+     LD+E+  I + N++ K     P  N        V+I + + ND  P F  + S  F IF+++    +I  + A D ++G   +     N+  K   IDS +G +       TD  L+  E Y      A ++  G          LMN    +  + +  + P + E   Y+A L + +  F+  P+++K T K +     R++    +  +   N +D+F +            ++ EK+ + +L   QLLV +          S+   T     I Q +    P F  + +   V +N     T+L      +D        +TY ++G +   F +        G I    P  R         V+A+D      S +  ++I+V + ND  P+F +  +  +  E     + I    ATD D+  N  + Y I Q   N      +P++               G++++   +DRE     + ++ +   A+++  P ++A AT+ I + D+NDN P+F  S +   L       +NIS G     ++ATD D      Y+ +      +  S SG+I        E  ++L F V+  DG   +NS  ++ V+    NE   +  I+    +E+T       +  +ND+  GE + + +     P  +      S DG+      T I+  +  G  Y   K+    +   +  I  +K K     E+ I V+D ++  PI+S    + S +TE   +GT + ++    +   E   + Y + +        LQ+ R       G I +   +K+L      I+  +  G+  +  N   A     +TI+D NDN P F       N S+   S+ E+++ L T++      ATD+DS     +++   SM GD  +F I   +  +  +   D ET+ ++   +   D
Sbjct:   34 VEEDWPVGTHLPVTIC----------PKNVKILSGDPAS-YFTVVKINETCSTLQLNLALDADKENADGLRGQSFSLVIA---GP---KKSRATLEVQIVDVNDNSPQFSNTPSSFEISENAEIGTDIF---KVTTLDPDTGISGISRFSVEGD---SSFTLAKRKCSSGKCSTQLRL--AKKLDFEEKPIHTFNITAKDGD--PHSNRTHTVAHTVTIHVKNENDEPPKFLTDFSQVFPIFKSTKPGDIIAKLEAIDVENGAEIQFGMKENEHLK---IDSKSGNVLLK-KLPTDDALITVELY------ATSSKNGKSKTVEMKLRLMNDEATLPKIAENQEKPELCEFPIYEAHLIQGTGTFS-TPLKIK-TLKSMAEEKPRLIGGSESFDL---NVIDDFHVELKV--------LNAEKVASQVLDSAQLLVKSQSGQCRIVLRSAAQMTPKASPIAQKLK-IIPKFEKSEYQFQVVEN--REPTVLGEVKVISD------GPVTYEILGENGEKFQIS-----NDGEIQNLEPIDRETYEKFELIVKATDLNGS--SGKSQLIIHVKDENDNSPIFDKEHYFITVDEGKSEKLKI---TATDADSGKNGQIVYSIDQKIDN------LPIDI-----------SPDGMLFI-GAIDRENMGN-SNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPL------DANISPGGIIGRLEATDADSTSPNNYVTYTSGDPKFTVSDSGEILFTGPGTLEKSASLEFNVTAQDGGDPMNSANALVVI----NEHRSMKSIE----NELT------TQINSNDT-GGEKSEIKWLNAGMPGYTYEIIRASADGFSDSEVATWISIDSKSGRIYTLKKVDPSRVKQIKLHISMRKGKREVPVELIINVMDTDDVTPIYSTPTRKLS-VTESATLGTTVVDMPV--EGIKEQNEIKYSLKITSGPR-GKLQIDRY------GTIKI---IKSLDFETEQIIKGIVEGM--VVKNGKAAKSSFILTILDANDNRPIF------KNSSNFAVSLLESSV-LGTVLDLPYPLATDRDSSKFSTLKY---SMTGDEGYFKIDESNSTIRLVAPLDFETQRVHSLSIKCVD 1036          

HSP 3 Score: 71.633 bits (174), Expect = 5.933e-12
Identity = 153/714 (21.43%), Postives = 293/714 (41.04%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPL-YQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQ---IAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFM-IFENSPNFTLIGVVTATDKDSGIFGKIIYSLN------DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIIL---KDLNDNPPIFEVRFYQAWLFENSYNFTFGP-VRVKATDKDVDVAN-----NRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNAT-DADESNTPQSDITYRLIGVDSVNFIVEAVYNPK--TGAIIKKYPNARLQVRVHNFTVEASDRG-YPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYE-NLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYS 2899
            +D  R   I+L +  +     V +    I V+D +DV PI+   +   ++ E   + T V+ +  ++G +  ++ ++YSLK  +       I+   G I I   +D E++ I  + G  +  V+    A     +  +F+ + ILD NDN   F     +  S+ E+S  G  + +   +   D+D +  +    S   +         + I   N  I ++     + LD+E  +  ++SIK +      P   +    +A V++ ++DVNDN P+  N+  T + I E++    ++ V+  +D D G   K    +N      D  KK V+ +S                L   A +R+     ATD GGL   +   + +   K+ + NP +   +      F+   N  +   ++VK  ++D D+ N     + +  + + M          F I    G +      D EK     +++L    +   S+      + I V D NDN P+F      + V +N      +  + A  D+D      SD T      D+  F       P   T +   +    + Q+ +  +    S R  + P++  ++ LI+V +IND  P F++ +++ +  + ++  G +I  V ATD D   +   + I+  + +      P +S     + I ++++ G +    +L    YS
Sbjct:  815 VDPSRVKQIKLHISMRKGKREVPVEL-IINVMDTDDVTPIYSTPTRKLSVTESATLGTTVVDM-PVEGIKE-QNEIKYSLKITSGPRGKLQIDRY-GTIKIIKSLDFETEQI--IKGIVEGMVVKNGKA-----AKSSFI-LTILDANDNRPIFKNSSNFAVSLLESSVLGTVLDLPYPLAT-DRDSSKFSTLKYSMTGDEG------YFKIDESNSTIRLV-----APLDFETQRVHSLSIKCVDNQGREPHHEV----FASVTVTVIDVNDNAPVIHNTDLTHLSIEEDAQVGQVVTVLVISDSDEGGVQKTEIDVNSTLFRADSDKKLVVIAS----------------LKGHAGQRICSTVTATDVGGLRATSPYCVTVYPAKNTHHNPLVITPKQNSIHYFDE--NIVYDELLKVKVLEEDGDIGNVTFRLDEMFKKDWQM----------FTIGEINGSLHARQAFDFEKKTVHEIKILACRINNCTSTH-----LFISVNDRNDNCPMFPKQDVRLTVLENEKGKRQVGRIPAALDSDF----HSDNTKVCYTTDTPLFFFSDPTLPILFTNSSFDREHKKQHQISITAYDCHLSCRDPHKPINGTIVALIDVLDINDNFPKFSEKIYTSTVVQGHVTTGSHILTVQATDLDEEPEGLKYSIRGFVRS------PSHSFVAAESPISIDKSTGELSATEILKDSSYS 1457          

HSP 4 Score: 69.3218 bits (168), Expect = 2.939e-11
Identity = 171/792 (21.59%), Postives = 305/792 (38.51%), Query Frame = 2
Query: 1055 PVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGK-IIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQ-------------AWLFENSYNFTFGPVRVKA---TDKDV------DVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPP-------LSTRVIILINVTEINDEPPVFTQSL-FSFSTYENLDIG--INIGQVNATDPDTN--CDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNIS----TGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITV 3301
            PV Y +   N   E F I+   GEI     IDRE+      +  F+L V AT+   S   S ++ + I + D NDNS  FD+  Y  +V E     +      +I   D D   N Q  Y++    +N         PI      +L I       +D E + + N     +  +        + A V+I + D+NDN+P+F NS Y+  +  N     +IG + ATD DS      + Y+  DP  KF +  S   ++T          L++ A     V   A DGG  MN    ++++ +      I      Q              WL      +T+  +R  A   +D +V      D  + RI    Y +    P+ +   K++ S           + ++P +++                     I V D +D  P++   T  ++V ++ +  TT++ +      E    Q++I Y L          +    P+    I +Y   ++ ++  +F  E   +G           + +   ++ + + ND  P+F  S  F+ S  E+  +G  +++    ATD D++    L Y                  S+        ++++   + + + LD E     +  I+ +D       P    FA++ + ++DVNDN P+   T L   S+ ED +    ++    + +    V+ T++D+  TL          F  DS   ++ +I +L       +  TV+ +D G     S   +TV
Sbjct:  481 PVTYEILGEN--GEKFQIS-NDGEIQNLEPIDRET------YEKFELIVKATDLNGS---SGKSQLIIHVKDENDNSPIFDKEHYFITVDEGKSEKL------KITATDADSGKNGQIVYSIDQKIDN--------LPIDISPDGMLFI-----GAIDRENMGNSNEVNLTVTASDSGEPKRSASATVTIRVKDINDNSPVFSNSRYSIPLDANISPGGIIGRLEATDADSTSPNNYVTYTSGDP--KFTVSDSGEILFTGPGT------LEKSASLEFNVT--AQDGGDPMNSANALVVINEHRSMKSIENELTTQINSNDTGGEKSEIKWLNAGMPGYTYEIIRASADGFSDSEVATWISIDSKSGRI----YTLKKVDPSRVKQIKLHISMRK-------GKREVPVELI---------------------INVMDTDDVTPIYSTPTRKLSVTESATLGTTVVDMPVEGIKE----QNEIKYSL----------KITSGPRGKLQIDRYGTIKI-IKSLDFETEQIIKGIVEGMVVKNGKAAKSSFILTILDANDNRPIFKNSSNFAVSLLESSVLGTVLDLPYPLATDRDSSKFSTLKY------------------SMTGDEGYFKIDESNSTIRLVAPLDFETQRVHSLSIKCVDNQGRE--PHHEVFASVTVTVIDVNDNAPVIHNTDLTHLSIEEDAQVGQVVTVLVISDSDEGGVQKTEIDVNSTL----------FRADS-DKKLVVIASLKGHAGQRICSTVTATDVGGLRATSPYCVTV 1153          
BLAST of Cadherin-23 vs. Ensembl Fly
Match: Cad88C (gene:FBgn0038247 transcript:FBtr0344279)

HSP 1 Score: 389.808 bits (1000), Expect = 2.014e-109
Identity = 446/1646 (27.10%), Postives = 725/1646 (44.05%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSIN----FTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQIL----DINDNSANFDQPLYQGSVYENSQAGVAI-IIGSEI--MVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGK--IIYS-LNDPFKKFV-IDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVD-VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDI----------------LQLLVVAYDPSNSSMFDTCI-IQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKY-----PNARLQVR-VHNFTVEASDRGY--PPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPV-NSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLS--FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKS----KEVGIYVIDVNNNFPIFSQVFYEFSP--ITEYTNIGTIIGEVLATDKD--FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDI--------GYNALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRET------------------------------------------------KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEA------------------RVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSG--ILSTAPGVFFQDNVDGFIQMSIGVSD-GKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLD 5329
            L L   LDYER  + QL++ A D A    IN       ++V D+ED PP F      + + E+ PV T V+ V AIDGDR + +P+ YSL+     N+ F IN  +G +     +DRE Q    V G   L + ATE + S    + T VR ++     D+ND    F + +Y+  V EN+Q    +  I  E+  +V D D   N  + L   + +  + +FE+ P +A+N+A  ++RVKN   LD+EQ   +N +I   ++         S A V I I D NDN P F  + Y   + ENS   T+I  V A D DSG +G   I Y+ L       + ++  TG I       T +   DRE   R ++   A D  G  N  T  II+   D+NDN P F  R Y+  L EN   F   P++++A D D++   N+++ Y+          Y  NF I+  +G +  V   D E++ +                  + LLV A D S   M  T + + I VQDVNDNAP+F  + ++  VP+++   +++L + A D D S  P + + YR+       FI+    N +TG I   +     P+     R ++  +V A D G     L T   + I++ ++N++PPV  + + +    EN  +G  + ++ ATD D    L Y +           G  V +S ++      ++   G + V  +LDRE+   +   I V D AA      Q A   L I++LD NDN P F+   ++ S+ E      N   GA    V A+DVD   T+ Y L  +P+     ++D  +G+I +   +D E    LNF+V  +D      S+   V ITVLD NDN PYFV   +   ISE    GT  A   A D+D+G+   + F     +S   F +  D G LT+   L       Y L+IE  DN +      +S    K+V I ++D N+N P   +V    S   ITEY  +   +  ++  D D     NG + + I       +F  +L +I   N   QI  + SL+N    ++  +   D G+P    + T+ + + D ND+ P F  P+  +    P+ +      TLI    A+D D G N  +R+ L  D + G ++ F +   +G L      +RE + +++ R+ A D G P SL+S +++ + V +++D  P F  N + +NF+ +  P            G +   +   +D+D           + +  +I  G+    F LDP +  L   +E DRE                                                 +  +S  +R+   ++YG      LS Y  ++ S+                   +V V +LDINDNPP F      GGI   A    + + +    TD D      + Y+   +   +  L+  L+N+     F L+  +G   L+  P    Q  + G+    +  +D    K++    +  +   Q+V  V +  P  + +  ++F + LSN+    + +D +++ ++  G++    T+L+ H V    N++   S +L L++    +   L  +  +LD
Sbjct:  231 LRLQKELDYERKSLYQLRVLAIDRANQGPINTGTAAILVKVKDLEDQPPEFVEVQAVARIAEDAPVGTKVLRVRAIDGDRGINNPIAYSLE----ANDLFDINPHTGIVHTLTKLDREEQS-DQVNGAHILRISATELSKSNTQMAPTTVRTEVTVIVSDVNDEIPTFGETVYRCEVNENAQTNTPLNFIDEEVQNVVFDHDEGNNGTFRL---FLDPPNDLFEIVPELAVNEANFMLRVKNSKSLDFEQFTEVNFTIFAREVDEPSRW---SSAHVQIFIRDQNDNFPEFSQTIYNASVLENSEQDTIITHVQAVDVDSGDYGTMGIRYTNLRGGIAHLLNLNPITGVITIKQAGGTAF---DREIISRHYLTVEAIDNAGQGNRNTAQIIVDILDVNDNAPTFPQRQYETKLLENQAEFET-PLQLEARDADLNGTENSQVTYEIVEGL-----YRSNFTIDPQSGLLRPVHSFDFEELVDGSSRRSDPYTGGSFSIREIDLLVRARD-SGIPMLSTVVPVLIYVQDVNDNAPIFQQSFYAKTVPEDLPGGSSVLQVTAIDRDGS-APNNVVVYRIQTGAGDKFII----NSETGVISVAHGANLDPDLTESKRSLYTLSVIALDGGLGNSQLMTTCTVNISIQDVNNKPPVLKE-MPALQILENTPVGTLVYRIQATDLDHKAILRYKLNPEHCEGRTEEGALVKSSEYDFLGAFEVDSIEGTLKVVKLLDRERVEHIKLAITVEDLAAAKGR--QIAEGFLSIQVLDENDNNPKFRLPFYRQSITE------NSINGAMIVNVLASDVDKNRTITYALEGNPTYRSLMHLDPQTGEIVVASKIDHEQHQWLNFSVRATDSGIPARSSLVDVYITVLDENDNNPYFVGGSKNYTISENAAPGTRVATLQAGDADSGDFGKITFLMDRISSQGKFTIDADTGVLTVADRLDRESKDSYNLVIEAWDNYQFGFLAGESRNAFKQVFISILDENDNPP---EVDLPMSCVLITEYHELHERVASIVGKDADDPTTPNGRLDFAITRGNKDGMF--ELRQIDAWN--AQIFASKSLRNRYGNYSLTITTRDMGLPANIVHNTLDICVSDFNDHAPVFVRPLHNTTVRIPENATVG---TLILQAYASDGDMGQNALVRYRLKPDPL-GSYKMFEVDGSTGELFLKEQLNREKQKIHEIRIEAYDQGLPTSLSSDLDLTIYVRNVNDYEPQFMVNEISVNFTEHSDP------------GSERIKLPDTIDKDQLELDDPNDTPSQVCYFIVNGNEAGYFRLDPETHILTVDRELDREVIANFTLYVRATENCRNDSISGGEKRRRMGIEINNRLGGIVHNQQFGYDRFKHSRQLRSTESNEYGPEDAELLS-YEAYDSSQEDPTGGLATTHPELDSTVIKVKVRVLDINDNPPRFRSKIFTGGITTNADFGLKFMRVE--ATDADEGDNGRIGYY--QVGEIRQTLSEGLENVR-KAPFLLDQETGEVQLNFDP----QKGMKGYFDFVVLANDTSGMKDVAHVFIYLLREDQKVRFVFRLQPDELRSRVDSFRDTLSNITESIVNIDEIKVHENKDGSVDKTKTDLYMHLVEREDNSIYEVSEVLKLIDSHIESLNGLFKELNVLD 1808          

HSP 2 Score: 188.734 bits (478), Expect = 1.846e-47
Identity = 336/1429 (23.51%), Postives = 562/1429 (39.33%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAY--HVSINFTFIQVI-DVEDVPPIFQNSSYSSTMNEELPVDTH---VITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMI--IDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYP-------IVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTAT------DKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTL-LDREAYERL--FVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDV-DVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIV----TPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAII------------------KKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNC--DLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY-------------------FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---------KILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKD--SGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIY------EGPLTFTSISNSSLSGFKIGNVAT------AVDRDIGYNALIVYIFTGDTV----MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKD 4792
            L   LD E      + L   DS Y  H  +  +F+ ++ D+ D  P F    Y + +  E+P  +    V T+ A D D      V Y L++ +  N+ F+I    G+ I+ +   +D E + +      + L V+A + A     N+    + +++ D+ D    F +      + E++  G  ++    I   D+ +N    Y+L A      + +F++ P       +  +++     +V     L   +I +  +S    Q+AP          +V++ + DVND  P FG + Y   + EN+   T +  +         D D G  G     L+ P   F I         N       +  LD E +  +   + A   D     +   V I ++D NDN P F    Y A + ENS   T     V+A D D  D     I Y   N+  G  + L+   +N  TG +TI     T  DRE I    L   V A D +     +T  I + + DVNDNAP F    +   + +N +   T L L A DAD + T  S +TY ++ G+   NF ++    P++G +                     Y      +R  +  V A D G P LST V +LI V ++ND  P+F QS ++ +  E+L  G ++ QV A D D +   ++  + IQ                F + +  G+        +   L   K S  T  +  +D          T   T+ I I DVN+ PP+ +  +    + E      N   G   + ++ATD+D    L+Y                     +D   +F VDSI G + ++K LDRE V ++   ++  D     G  +    +SI VLD NDN P F       +I+E +  G +    +A+D D  +N  + +    N +    + LD   G + + + +      +    +   D+  G        +V I V+D N+N P F      ++ I+E    GT +  + A D D G+ G +++         K  +  DT V  +   R+ + +     LV  +  N   +F F+     N   +      V ++I+D NDN P    P+     S    + Y      +  I   D D  +  NG + F +   N D  F            +R  D     ++  + L N  G  SLT           +       P+N +     I         P+    + N+++   +   V T      A D D+G NAL+ Y    D +    MF +D  +G LF  ++ +RE +  +   + A     Y  G  + LS       S+  + + + ++ND  P F +  I     + + P S+ + +   + DKD
Sbjct:  125 LAKELDRELQDEYAIVLTLTDSHYSDHNYVTQSFLLLVEDINDNVPTFL--PYQNAI--EIPEGSAPGVVSTLEATDADEGAYGQVVYYLQELDGDNDVFSIATHQGKGILRLQKELDYERKSL------YQLRVLAIDRANQGPINTGTAAILVKVKDLEDQPPEFVEVQAVARIAEDAPVGTKVLRVRAID-GDRGINNPIAYSLEA------NDLFDINPHTGIVHTLTKLDREEQSDQVNGAHIL---RISATELSKSNTQMAPTT-----VRTEVTVIVSDVNDEIPTFGETVYRCEVNENAQTNTPLNFIDEEVQNVVFDHDEGNNGTFRLFLDPPNDLFEIVPELAVNEANFMLRVKNSKSLDFEQFTEVNFTIFAREVDEPSRWSSAHVQIFIRDQNDNFPEFSQTIYNASVLENSEQDTI-ITHVQAVDVDSGDYGTMGIRYT--NLRGGIAHLLN---LNPITGVITIKQAGGTAFDREIISRHYL--TVEAIDNAGQGNRNTAQIIVDILDVNDNAPTFPQRQYETKLLENQAEFETPLQLEARDADLNGTENSQVTYEIVEGLYRSNFTID----PQSGLLRPVHSFDFEELVDGSSRRSDPYTGGSFSIREIDLLVRARDSGIPMLSTVVPVLIYVQDVNDNAPIFQQSFYAKTVPEDLPGGSSVLQVTAIDRDGSAPNNVVVYRIQ----------TGAGDKFIINSETGVISVAHGANLDPDLTESKRSLYTLSVIALDGGLGNSQLMTT--CTVNISIQDVNNKPPVLK-EMPALQILE------NTPVGTLVYRIQATDLDHKAILRYKLNPEHCEGRTEEGALVKSSEYDFLGAFEVDSIEGTLKVVKLLDRERVEHIKLAITVEDLAAAKGRQIAEGFLSIQVLDENDNNPKFRLPFYRQSITENSINGAMIVNVLASDVD--KNRTITYALEGNPTYRSLMHLDPQTGEIVVASKIDHEQHQWLNFSVRATDS--GIPARSSLVDVYITVLDENDNNPYFVGGSKNYT-ISENAAPGTRVATLQAGDADSGDFGKITFLMDRISSQGKFTIDADTGVLTV-ADRLDRESKDSYNLVIEAWDNY--QFGFLAGESRNAFKQ------VFISILDENDNPPEVDLPM-----SCVLITEYHELHERVASIVGKDADDPTTPNGRLDFAITRGNKDGMF-----------ELRQIDAWNAQIFASKSLRNRYGNYSLT-----------ITTRDMGLPANIVHNTLDICVSDFNDHAPVFVRPLHNTTVRIPENATVGTLILQAYASDGDMGQNALVRYRLKPDPLGSYKMFEVDGSTGELFLKEQLNREKQKIHEIRIEA-----YDQGLPTSLS-------SDLDLTIYVRNVNDYEPQFMVNEISVNFTEHSDPGSERIKLPDTI-DKD 1443          
BLAST of Cadherin-23 vs. Ensembl Fly
Match: Cad74A (gene:FBgn0036715 transcript:FBtr0075240)

HSP 1 Score: 339.347 bits (869), Expect = 8.146e-94
Identity = 412/1530 (26.93%), Postives = 672/1530 (43.92%), Query Frame = 2
Query:  659 LAIVDYDE-INSICNLTITSVTSGSISD-FNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYH---VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAI---NETSGEIIIAMI---IDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQIL--DINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIK--------SINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT---FGPVRVKATDKD-VDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIV--------------QDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFT-----VEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPV--NSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSL-FEDFKPKSNISTGATGFYVKATD-VDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSN------LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAV--------VIFYFPNNSSSPFGL-SLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKS-KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNG-----VPRLSNNCTVAVTIIDI--NDNYPSFTNPVSPSNGSSPQFSIYENTIT----LITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGI----KEFDRETKDTYSATVRAVPMSQYGDGPHSFLSG-YSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENI--YPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSI 4981
            + +VD DE INS   + +  +    I D F +  + I        S G Y+  ++ L   LD+E  P   L + A DSA      S+    I VID++D PPIF N+ YS+T+ E  P    ++TV A+DGD  +   +  SL+D  PF  +  +   +   G  ++      +DRE+ +I    G +  ++ ATE       +  +  R+ I+  D++D+   F  P +  S+ EN   G+ +  G  I V+D+D+  N++Y LS       + +FEV P  +  +  +V++V N S LDY+ +          +  S+KG+         E +   V I +LD NDN P+F   +Y F   EN P   +IG V ATD DSG FG + Y L       F ++  TG +Y           LD E      +  +A DGG       + + + D+NDN P FE + Y   + E +  F    F    V+A D D     N R+ Y   + +    N    F+I   TG++ I              +L+V A D     + +T  + + V              Q++ +N P+ G  ++ V++P+N +  + +  ++A D D  +   S + YR++G +  NF ++ +       +I   P AR+  R  N       V A D G P P +    + +NV +INDE P F Q+ ++    E   +G ++ +V A D D N  L Y ++   + A   +GV +   S + +     ++   G ++V   L  +  + +   + V D  AE     Q     + + +    D  P+F+ + +  S    D K K  +   +  F ++A D V       +   +P     F V   +G++ L K LD E + +      L    + +D      S V+ITV +VNDN P F        I E         +  A D DA  NA         +I+      +  F + +  G + + +  TI        +L I+  D+P      K+S  E+ I V+DVN+N P F+Q  Y  + I E   I + + ++ A D D G  G V Y+++ + + +     LF+I   +       N + K     +  IV A DNG      P LS +  V + I D+  ND  P F   +SP  G     ++ EN +T       I S  D +S  +G I + +     D E F I   SG ++  +S DRETKD+Y+  +  +D G P  ++   +++ +LD+DD+ P F             GPL+  S+     +G  +GN  +A+D D+G NA I Y I  G+    +    +     I    K  DRE  ++++ T++ + + + G   + F+   Y   + S  R+ V +LDI+DN P F  P    GI +   P   +V   K  +D D      +   IEN+   P     +  L   N+  +F LN  +G L T  G  F D VDG+  M +
Sbjct:  153 IVVVDRDEGINS--EVQMKCLEENDICDIFEVRAVKI--------SDGNYTA-RVALKQQLDFESRPSYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLED-EPFGHFELVPFGDPRDGTAVLQTTSEPLDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLP-GLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDLVASVKGV---------EKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRYVLKGFGADNFYVNPETGGVYL-------LKPLDYEKQSSYSLTVVAIDGGQREANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFF----VRAHDADGPSQGNGRVKYSIVSENSIAGNV---FRIEPDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNM-ENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLD---SLLRYRIVGAND-NFEIDEI-----SGLITVSPQARID-RDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMV-GPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEVDPEGQVDTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALFILQAEDPVTRQPITSFELIEPKQVDYFQVAERTGEVILKKRLDYEALGDTGPEFELQVRANSADRQRSTVSRVNITVENVNDNSPRFERNSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEFTQKKYS-TVIPENAQIDSFVLQLEAVDADEGLGGEVRYELVNEGEAN----GLFKIDTKSGLISTRRNLTGKGRAHPYVLIVRAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYF---LSPRVGQ--MANVTENAVTGAPVFQVIASDPDDESTPSGTITYRILPDTPDAEAFVIDAHSGLITTRQSMDRETKDMYRILLEVSDNGQPKQSATRILQIAILDVDDHEPRFAR-------EADAGPLSM-SVREEEPAGTIVGNF-SALDEDLGENAAIDYVIIDGNNEQLFTIERNNESLAILKTKKPIDREQVESFTLTIKCLKLGEPG---YKFIGDPYDRQDLSHLRINVRVLDIDDNLPKFEQPDPTVGI-RINVPIDTVVTTLK-ASDAD-AEAPPVGLSIENVTFVPQFYKRSRSLAVGNLHNLFTLNNRTGELRT--GGSFADYVDGYFLMRV 1607          

HSP 2 Score: 148.288 bits (373), Expect = 4.471e-35
Identity = 281/1185 (23.71%), Postives = 470/1185 (39.66%), Query Frame = 2
Query:  977 TMNEELPVDTHVITVTAID--GDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVF-GFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVI----DSSTGAIYTNVNANTDYTLLDREAYERL-----FVVAIAT----DGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP-VRVKATDKDVDVANNRI---LYQFYNMS----MGPPNYLDNFKI-----NASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD----TNCDLAYFII-QNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKS-------NISTGATGFYVKATDVDIVGT-LQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLN-FTV---SCSDGVFL---VNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSL-----------------------DGYLTL-ITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFS------PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVN-----SSLKNLGARFTFIVNAVDNGVPRLSNNCT-VAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNG-EIRFNLD----SMNGDHEFFF-ISPISGNL--SNIRSFDRETKDLYKFRVLAND 4237
            +++E  PV + V  +   D  G R     ++YS+         F+++  +G + +   +DRE+QD   V     D  +  TE  P+  +  R    I + D NDN   F    Y  SV E+   G  + +   I+V D+D   N++  +  +  N    IFEV   V ++      RV     LD+E   S  ++I     A   +    S A +SI ++D+ D  PIF N+ Y+  + EN+P    I  V A D D GI  +I  SL D PF  F +    D   G       +      LDRE  E L     +V +I      DG      ++T V I++ D++D+ P F    +   + EN  N    P + +   D+D+   N+R    L   +N +    + P        +     NAS  D  +V P D  K   D++   V   + + +       ++I + D NDNAPVF   T+     +N+  +  I  + ATD D        + Y L G  + NF V    NP+TG +    P    +   ++ TV A D G         + + VT++ND  P F    +S +  E   +      V A D D     N  + Y I+ +N+I                 N+  +    G + +Q         T  G+ +++  A +  +PP +    + + +    +  PIF+             P S       N + G+    V A D D + + L+Y     + +F +D ISG I +      +  SN+N F +   +   G  +     +TV + V D+ND  P F        +SE T VG    +  A D D           P  +++  G+S+                       +G L   +  + I+ +    L  E+  +P G +    + EV +YV    +  P+F    +  S       I E   I + +  +L  +         S++++  K  D F       Q     G++++       +L + G  F   V A  N   R  +  + V +T+ ++NDN P F         +S Q +I EN      +  + A DKD+ LN  + R        S+ G+H   F I+  +G +  ++ ++ DRE     + ++ A D
Sbjct:   35 SLSENTPVGSPVFQLKGTDPEGGR-----LKYSIS-----GPVFSVDRETGVVRLRQELDRETQDTVEVIISITDEGIYGTE--PNTVSQRRV---IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVR-AVKISDGNYTARVALKQQLDFESRPSYILTISASDSA--LDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTTSEP----LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMG-ENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDP-DLRKFEFDLV-ASVKGVEKAKTR------VEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEF--GHVRYVLKGFGADNFYV----NPETGGVYLLKPLDYEKQSSYSLTVVAIDGGQ--REANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAG---------------NVFRIEPDTGEIVIQKAA--RSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRIVGANDNFEIDEISGLITVSPQARIDRDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEV--DPEGQV---DTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALF-ILQAEDPVTRQPITSFELIEPKQVDYF-------QVAERTGEVILKKRLDYEALGDTGPEFELQVRA--NSADRQRSTVSRVNITVENVNDNSPRFER-------NSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAED 1141          

HSP 3 Score: 146.747 bits (369), Expect = 1.141e-34
Identity = 216/854 (25.29%), Postives = 354/854 (41.45%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT---VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINET-------SGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSIN------VSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPN-FTLIGV-VTATDKDSGIFGKIIYSLNDPFKKFVI--------DSSTGAIYTNVNANT-DYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDV-DVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD----PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN---FIVEAVYNPKTGAII--KKYPNARLQVRVHNFTVEASDRGYPPLS--TRVIILINVTEINDEP------------PVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP-PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDP-------------------SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD 3262
            I V D  D  P F    Y+++++E LPV + +     +  +D D  + S VQ    + N   + F +          +  + +   +D ES+        + LT+ A+++A     SS   + I ++DI D    F    Y  +V EN+ AGV+I+    +   D D+    +  LS    ++    FE+ P         V++  +   LD E  + +        SI+  ++       E S   V+I + DV+D+ P F    +   I EN  N   L G+ +   D+D G   +   SL D F    +           T  +   +NA+  DY ++D +  +  F + +A+  G     T V I L D NDN P+F+   Y+    EN   +   G   VKATD D  +  + R + + +          DNF +N  TG V ++ P+D EK       L VVA D     +N+++F      + V DVNDN P F    +S  + +  +      F+ A DAD  +     + Y ++  +S+    F +E    P TG I+  K   +   +   +   V A+D G PPLS  TRV++ + ++  N  P            P+     +  S  EN   G N+  V+A DPD    L  + I           V  N  F +  + GL      V  Q+ +DR+   +     ++I  A ++  P P+TA  T+ + + D+ND  P F+ + +   + E        + G +   VKA D D+   L+Y    P                     +F VDS SG+IF+   L  +  + + FTV   D
Sbjct:  116 IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRAVKISDGNYTARVALKQQLDFESRP------SYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILT---VKAVDGDVGIPREIFLS--LEDEPFGHFELVPFGDPRDGTAVLQTTSEP-LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDL-VASVKGVEKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIG--HVKATDLDSGEFGHVRYVLKGFGA--------DNFYVNPETGGVYLLKPLDYEK--QSSYSLTVVAIDGGQREANANLF------VGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAGNVFRIE----PDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISG-NQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRI-----------VGANDNFEIDEISGLI----TVSPQARIDRD---SNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSE------RTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRD 909          
BLAST of Cadherin-23 vs. Ensembl Fly
Match: Cad74A (gene:FBgn0036715 transcript:FBtr0075239)

HSP 1 Score: 339.347 bits (869), Expect = 8.146e-94
Identity = 412/1530 (26.93%), Postives = 672/1530 (43.92%), Query Frame = 2
Query:  659 LAIVDYDE-INSICNLTITSVTSGSISD-FNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYH---VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAI---NETSGEIIIAMI---IDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQIL--DINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIK--------SINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT---FGPVRVKATDKD-VDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIV--------------QDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFT-----VEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPV--NSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSL-FEDFKPKSNISTGATGFYVKATD-VDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSN------LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAV--------VIFYFPNNSSSPFGL-SLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKS-KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNG-----VPRLSNNCTVAVTIIDI--NDNYPSFTNPVSPSNGSSPQFSIYENTIT----LITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGI----KEFDRETKDTYSATVRAVPMSQYGDGPHSFLSG-YSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENI--YPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSI 4981
            + +VD DE INS   + +  +    I D F +  + I        S G Y+  ++ L   LD+E  P   L + A DSA      S+    I VID++D PPIF N+ YS+T+ E  P    ++TV A+DGD  +   +  SL+D  PF  +  +   +   G  ++      +DRE+ +I    G +  ++ ATE       +  +  R+ I+  D++D+   F  P +  S+ EN   G+ +  G  I V+D+D+  N++Y LS       + +FEV P  +  +  +V++V N S LDY+ +          +  S+KG+         E +   V I +LD NDN P+F   +Y F   EN P   +IG V ATD DSG FG + Y L       F ++  TG +Y           LD E      +  +A DGG       + + + D+NDN P FE + Y   + E +  F    F    V+A D D     N R+ Y   + +    N    F+I   TG++ I              +L+V A D     + +T  + + V              Q++ +N P+ G  ++ V++P+N +  + +  ++A D D  +   S + YR++G +  NF ++ +       +I   P AR+  R  N       V A D G P P +    + +NV +INDE P F Q+ ++    E   +G ++ +V A D D N  L Y ++   + A   +GV +   S + +     ++   G ++V   L  +  + +   + V D  AE     Q     + + +    D  P+F+ + +  S    D K K  +   +  F ++A D V       +   +P     F V   +G++ L K LD E + +      L    + +D      S V+ITV +VNDN P F        I E         +  A D DA  NA         +I+      +  F + +  G + + +  TI        +L I+  D+P      K+S  E+ I V+DVN+N P F+Q  Y  + I E   I + + ++ A D D G  G V Y+++ + + +     LF+I   +       N + K     +  IV A DNG      P LS +  V + I D+  ND  P F   +SP  G     ++ EN +T       I S  D +S  +G I + +     D E F I   SG ++  +S DRETKD+Y+  +  +D G P  ++   +++ +LD+DD+ P F             GPL+  S+     +G  +GN  +A+D D+G NA I Y I  G+    +    +     I    K  DRE  ++++ T++ + + + G   + F+   Y   + S  R+ V +LDI+DN P F  P    GI +   P   +V   K  +D D      +   IEN+   P     +  L   N+  +F LN  +G L T  G  F D VDG+  M +
Sbjct:  153 IVVVDRDEGINS--EVQMKCLEENDICDIFEVRAVKI--------SDGNYTA-RVALKQQLDFESRPSYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLED-EPFGHFELVPFGDPRDGTAVLQTTSEPLDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLP-GLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDLVASVKGV---------EKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRYVLKGFGADNFYVNPETGGVYL-------LKPLDYEKQSSYSLTVVAIDGGQREANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFF----VRAHDADGPSQGNGRVKYSIVSENSIAGNV---FRIEPDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNM-ENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLD---SLLRYRIVGAND-NFEIDEI-----SGLITVSPQARID-RDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMV-GPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEVDPEGQVDTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALFILQAEDPVTRQPITSFELIEPKQVDYFQVAERTGEVILKKRLDYEALGDTGPEFELQVRANSADRQRSTVSRVNITVENVNDNSPRFERNSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEFTQKKYS-TVIPENAQIDSFVLQLEAVDADEGLGGEVRYELVNEGEAN----GLFKIDTKSGLISTRRNLTGKGRAHPYVLIVRAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYF---LSPRVGQ--MANVTENAVTGAPVFQVIASDPDDESTPSGTITYRILPDTPDAEAFVIDAHSGLITTRQSMDRETKDMYRILLEVSDNGQPKQSATRILQIAILDVDDHEPRFAR-------EADAGPLSM-SVREEEPAGTIVGNF-SALDEDLGENAAIDYVIIDGNNEQLFTIERNNESLAILKTKKPIDREQVESFTLTIKCLKLGEPG---YKFIGDPYDRQDLSHLRINVRVLDIDDNLPKFEQPDPTVGI-RINVPIDTVVTTLK-ASDAD-AEAPPVGLSIENVTFVPQFYKRSRSLAVGNLHNLFTLNNRTGELRT--GGSFADYVDGYFLMRV 1607          

HSP 2 Score: 148.288 bits (373), Expect = 4.471e-35
Identity = 281/1185 (23.71%), Postives = 470/1185 (39.66%), Query Frame = 2
Query:  977 TMNEELPVDTHVITVTAID--GDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVF-GFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVI----DSSTGAIYTNVNANTDYTLLDREAYERL-----FVVAIAT----DGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP-VRVKATDKDVDVANNRI---LYQFYNMS----MGPPNYLDNFKI-----NASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD----TNCDLAYFII-QNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKS-------NISTGATGFYVKATDVDIVGT-LQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLN-FTV---SCSDGVFL---VNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSL-----------------------DGYLTL-ITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFS------PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVN-----SSLKNLGARFTFIVNAVDNGVPRLSNNCT-VAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNG-EIRFNLD----SMNGDHEFFF-ISPISGNL--SNIRSFDRETKDLYKFRVLAND 4237
            +++E  PV + V  +   D  G R     ++YS+         F+++  +G + +   +DRE+QD   V     D  +  TE  P+  +  R    I + D NDN   F    Y  SV E+   G  + +   I+V D+D   N++  +  +  N    IFEV   V ++      RV     LD+E   S  ++I     A   +    S A +SI ++D+ D  PIF N+ Y+  + EN+P    I  V A D D GI  +I  SL D PF  F +    D   G       +      LDRE  E L     +V +I      DG      ++T V I++ D++D+ P F    +   + EN  N    P + +   D+D+   N+R    L   +N +    + P        +     NAS  D  +V P D  K   D++   V   + + +       ++I + D NDNAPVF   T+     +N+  +  I  + ATD D        + Y L G  + NF V    NP+TG +    P    +   ++ TV A D G         + + VT++ND  P F    +S +  E   +      V A D D     N  + Y I+ +N+I                 N+  +    G + +Q         T  G+ +++  A +  +PP +    + + +    +  PIF+             P S       N + G+    V A D D + + L+Y     + +F +D ISG I +      +  SN+N F +   +   G  +     +TV + V D+ND  P F        +SE T VG    +  A D D           P  +++  G+S+                       +G L   +  + I+ +    L  E+  +P G +    + EV +YV    +  P+F    +  S       I E   I + +  +L  +         S++++  K  D F       Q     G++++       +L + G  F   V A  N   R  +  + V +T+ ++NDN P F         +S Q +I EN      +  + A DKD+ LN  + R        S+ G+H   F I+  +G +  ++ ++ DRE     + ++ A D
Sbjct:   35 SLSENTPVGSPVFQLKGTDPEGGR-----LKYSIS-----GPVFSVDRETGVVRLRQELDRETQDTVEVIISITDEGIYGTE--PNTVSQRRV---IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVR-AVKISDGNYTARVALKQQLDFESRPSYILTISASDSA--LDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTTSEP----LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMG-ENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDP-DLRKFEFDLV-ASVKGVEKAKTR------VEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEF--GHVRYVLKGFGADNFYV----NPETGGVYLLKPLDYEKQSSYSLTVVAIDGGQ--REANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAG---------------NVFRIEPDTGEIVIQKAA--RSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRIVGANDNFEIDEISGLITVSPQARIDRDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEV--DPEGQV---DTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALF-ILQAEDPVTRQPITSFELIEPKQVDYF-------QVAERTGEVILKKRLDYEALGDTGPEFELQVRA--NSADRQRSTVSRVNITVENVNDNSPRFER-------NSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAED 1141          

HSP 3 Score: 146.747 bits (369), Expect = 1.141e-34
Identity = 216/854 (25.29%), Postives = 354/854 (41.45%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT---VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINET-------SGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSIN------VSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPN-FTLIGV-VTATDKDSGIFGKIIYSLNDPFKKFVI--------DSSTGAIYTNVNANT-DYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDV-DVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD----PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN---FIVEAVYNPKTGAII--KKYPNARLQVRVHNFTVEASDRGYPPLS--TRVIILINVTEINDEP------------PVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP-PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDP-------------------SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD 3262
            I V D  D  P F    Y+++++E LPV + +     +  +D D  + S VQ    + N   + F +          +  + +   +D ES+        + LT+ A+++A     SS   + I ++DI D    F    Y  +V EN+ AGV+I+    +   D D+    +  LS    ++    FE+ P         V++  +   LD E  + +        SI+  ++       E S   V+I + DV+D+ P F    +   I EN  N   L G+ +   D+D G   +   SL D F    +           T  +   +NA+  DY ++D +  +  F + +A+  G     T V I L D NDN P+F+   Y+    EN   +   G   VKATD D  +  + R + + +          DNF +N  TG V ++ P+D EK       L VVA D     +N+++F      + V DVNDN P F    +S  + +  +      F+ A DAD  +     + Y ++  +S+    F +E    P TG I+  K   +   +   +   V A+D G PPLS  TRV++ + ++  N  P            P+     +  S  EN   G N+  V+A DPD    L  + I           V  N  F +  + GL      V  Q+ +DR+   +     ++I  A ++  P P+TA  T+ + + D+ND  P F+ + +   + E        + G +   VKA D D+   L+Y    P                     +F VDS SG+IF+   L  +  + + FTV   D
Sbjct:  116 IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRAVKISDGNYTARVALKQQLDFESRP------SYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILT---VKAVDGDVGIPREIFLS--LEDEPFGHFELVPFGDPRDGTAVLQTTSEP-LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDL-VASVKGVEKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIG--HVKATDLDSGEFGHVRYVLKGFGA--------DNFYVNPETGGVYLLKPLDYEK--QSSYSLTVVAIDGGQREANANLF------VGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAGNVFRIE----PDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISG-NQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRI-----------VGANDNFEIDEISGLI----TVSPQARIDRD---SNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSE------RTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRD 909          
BLAST of Cadherin-23 vs. Ensembl Fly
Match: Cad74A (gene:FBgn0036715 transcript:FBtr0309231)

HSP 1 Score: 339.347 bits (869), Expect = 8.146e-94
Identity = 412/1530 (26.93%), Postives = 672/1530 (43.92%), Query Frame = 2
Query:  659 LAIVDYDE-INSICNLTITSVTSGSISD-FNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYH---VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAI---NETSGEIIIAMI---IDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQIL--DINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIK--------SINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT---FGPVRVKATDKD-VDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIV--------------QDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFT-----VEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPV--NSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSL-FEDFKPKSNISTGATGFYVKATD-VDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSN------LNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAV--------VIFYFPNNSSSPFGL-SLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKS-KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNG-----VPRLSNNCTVAVTIIDI--NDNYPSFTNPVSPSNGSSPQFSIYENTIT----LITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGI----KEFDRETKDTYSATVRAVPMSQYGDGPHSFLSG-YSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENI--YPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSI 4981
            + +VD DE INS   + +  +    I D F +  + I        S G Y+  ++ L   LD+E  P   L + A DSA      S+    I VID++D PPIF N+ YS+T+ E  P    ++TV A+DGD  +   +  SL+D  PF  +  +   +   G  ++      +DRE+ +I    G +  ++ ATE       +  +  R+ I+  D++D+   F  P +  S+ EN   G+ +  G  I V+D+D+  N++Y LS       + +FEV P  +  +  +V++V N S LDY+ +          +  S+KG+         E +   V I +LD NDN P+F   +Y F   EN P   +IG V ATD DSG FG + Y L       F ++  TG +Y           LD E      +  +A DGG       + + + D+NDN P FE + Y   + E +  F    F    V+A D D     N R+ Y   + +    N    F+I   TG++ I              +L+V A D     + +T  + + V              Q++ +N P+ G  ++ V++P+N +  + +  ++A D D  +   S + YR++G +  NF ++ +       +I   P AR+  R  N       V A D G P P +    + +NV +INDE P F Q+ ++    E   +G ++ +V A D D N  L Y ++   + A   +GV +   S + +     ++   G ++V   L  +  + +   + V D  AE     Q     + + +    D  P+F+ + +  S    D K K  +   +  F ++A D V       +   +P     F V   +G++ L K LD E + +      L    + +D      S V+ITV +VNDN P F        I E         +  A D DA  NA         +I+      +  F + +  G + + +  TI        +L I+  D+P      K+S  E+ I V+DVN+N P F+Q  Y  + I E   I + + ++ A D D G  G V Y+++ + + +     LF+I   +       N + K     +  IV A DNG      P LS +  V + I D+  ND  P F   +SP  G     ++ EN +T       I S  D +S  +G I + +     D E F I   SG ++  +S DRETKD+Y+  +  +D G P  ++   +++ +LD+DD+ P F             GPL+  S+     +G  +GN  +A+D D+G NA I Y I  G+    +    +     I    K  DRE  ++++ T++ + + + G   + F+   Y   + S  R+ V +LDI+DN P F  P    GI +   P   +V   K  +D D      +   IEN+   P     +  L   N+  +F LN  +G L T  G  F D VDG+  M +
Sbjct:  153 IVVVDRDEGINS--EVQMKCLEENDICDIFEVRAVKI--------SDGNYTA-RVALKQQLDFESRPSYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLED-EPFGHFELVPFGDPRDGTAVLQTTSEPLDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLP-GLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDLVASVKGV---------EKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEFGHVRYVLKGFGADNFYVNPETGGVYL-------LKPLDYEKQSSYSLTVVAIDGGQREANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFF----VRAHDADGPSQGNGRVKYSIVSENSIAGNV---FRIEPDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNM-ENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLD---SLLRYRIVGAND-NFEIDEI-----SGLITVSPQARID-RDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMV-GPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEVDPEGQVDTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALFILQAEDPVTRQPITSFELIEPKQVDYFQVAERTGEVILKKRLDYEALGDTGPEFELQVRANSADRQRSTVSRVNITVENVNDNSPRFERNSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAEDSPGRPTDAKQSVVELQIEVLDVNDNAPEFTQKKYS-TVIPENAQIDSFVLQLEAVDADEGLGGEVRYELVNEGEAN----GLFKIDTKSGLISTRRNLTGKGRAHPYVLIVRAQDNGNQMPKQPTLSTDTDVRIYIGDVSANDGVPYF---LSPRVGQ--MANVTENAVTGAPVFQVIASDPDDESTPSGTITYRILPDTPDAEAFVIDAHSGLITTRQSMDRETKDMYRILLEVSDNGQPKQSATRILQIAILDVDDHEPRFAR-------EADAGPLSM-SVREEEPAGTIVGNF-SALDEDLGENAAIDYVIIDGNNEQLFTIERNNESLAILKTKKPIDREQVESFTLTIKCLKLGEPG---YKFIGDPYDRQDLSHLRINVRVLDIDDNLPKFEQPDPTVGI-RINVPIDTVVTTLK-ASDAD-AEAPPVGLSIENVTFVPQFYKRSRSLAVGNLHNLFTLNNRTGELRT--GGSFADYVDGYFLMRV 1607          

HSP 2 Score: 148.288 bits (373), Expect = 4.471e-35
Identity = 281/1185 (23.71%), Postives = 470/1185 (39.66%), Query Frame = 2
Query:  977 TMNEELPVDTHVITVTAID--GDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVF-GFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND-PFKKFVI----DSSTGAIYTNVNANTDYTLLDREAYERL-----FVVAIAT----DGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP-VRVKATDKDVDVANNRI---LYQFYNMS----MGPPNYLDNFKI-----NASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD----TNCDLAYFII-QNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKS-------NISTGATGFYVKATDVDIVGT-LQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLN-FTV---SCSDGVFL---VNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSL-----------------------DGYLTL-ITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFS------PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVN-----SSLKNLGARFTFIVNAVDNGVPRLSNNCT-VAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNG-EIRFNLD----SMNGDHEFFF-ISPISGNL--SNIRSFDRETKDLYKFRVLAND 4237
            +++E  PV + V  +   D  G R     ++YS+         F+++  +G + +   +DRE+QD   V     D  +  TE  P+  +  R    I + D NDN   F    Y  SV E+   G  + +   I+V D+D   N++  +  +  N    IFEV   V ++      RV     LD+E   S  ++I     A   +    S A +SI ++D+ D  PIF N+ Y+  + EN+P    I  V A D D GI  +I  SL D PF  F +    D   G       +      LDRE  E L     +V +I      DG      ++T V I++ D++D+ P F    +   + EN  N    P + +   D+D+   N+R    L   +N +    + P        +     NAS  D  +V P D  K   D++   V   + + +       ++I + D NDNAPVF   T+     +N+  +  I  + ATD D        + Y L G  + NF V    NP+TG +    P    +   ++ TV A D G         + + VT++ND  P F    +S +  E   +      V A D D     N  + Y I+ +N+I                 N+  +    G + +Q         T  G+ +++  A +  +PP +    + + +    +  PIF+             P S       N + G+    V A D D + + L+Y     + +F +D ISG I +      +  SN+N F +   +   G  +     +TV + V D+ND  P F        +SE T VG    +  A D D           P  +++  G+S+                       +G L   +  + I+ +    L  E+  +P G +    + EV +YV    +  P+F    +  S       I E   I + +  +L  +         S++++  K  D F       Q     G++++       +L + G  F   V A  N   R  +  + V +T+ ++NDN P F         +S Q +I EN      +  + A DKD+ LN  + R        S+ G+H   F I+  +G +  ++ ++ DRE     + ++ A D
Sbjct:   35 SLSENTPVGSPVFQLKGTDPEGGR-----LKYSIS-----GPVFSVDRETGVVRLRQELDRETQDTVEVIISITDEGIYGTE--PNTVSQRRV---IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVR-AVKISDGNYTARVALKQQLDFESRPSYILTISASDSA--LDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILTVKAVDGDVGIPREIFLSLEDEPFGHFELVPFGDPRDGTAVLQTTSEP----LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMG-ENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDP-DLRKFEFDLV-ASVKGVEKAKTR------VEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIGHVKATDLDSGEF--GHVRYVLKGFGADNFYV----NPETGGVYLLKPLDYEKQSSYSLTVVAIDGGQ--REANANLFVGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAG---------------NVFRIEPDTGEIVIQKAA--RSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISGNQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRIVGANDNFEIDEISGLITVSPQARIDRDSNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSERTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRDLNAEV--DPEGQV---DTTEVTVYVQSFQDTNPVFKNTGWTSSRPVIDVKIKEEMPIDSALF-ILQAEDPVTRQPITSFELIEPKQVDYF-------QVAERTGEVILKKRLDYEALGDTGPEFELQVRA--NSADRQRSTVSRVNITVENVNDNSPRFER-------NSYQATIIENRPHPERVIRVRALDKDAVLNARDERLGYHKIIYSLQGEHAMLFDINNTTGEIIVASGQTIDRERTPRIQLQIKAED 1141          

HSP 3 Score: 146.747 bits (369), Expect = 1.141e-34
Identity = 216/854 (25.29%), Postives = 354/854 (41.45%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT---VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINET-------SGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSIN------VSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPN-FTLIGV-VTATDKDSGIFGKIIYSLNDPFKKFVI--------DSSTGAIYTNVNANT-DYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN-SYNFTFGPVRVKATDKDV-DVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD----PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN---FIVEAVYNPKTGAII--KKYPNARLQVRVHNFTVEASDRGYPPLS--TRVIILINVTEINDEP------------PVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP-PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDP-------------------SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD 3262
            I V D  D  P F    Y+++++E LPV + +     +  +D D  + S VQ    + N   + F +          +  + +   +D ES+        + LT+ A+++A     SS   + I ++DI D    F    Y  +V EN+ AGV+I+    +   D D+    +  LS    ++    FE+ P         V++  +   LD E  + +        SI+  ++       E S   V+I + DV+D+ P F    +   I EN  N   L G+ +   D+D G   +   SL D F    +           T  +   +NA+  DY ++D +  +  F + +A+  G     T V I L D NDN P+F+   Y+    EN   +   G   VKATD D  +  + R + + +          DNF +N  TG V ++ P+D EK       L VVA D     +N+++F      + V DVNDN P F    +S  + +  +      F+ A DAD  +     + Y ++  +S+    F +E    P TG I+  K   +   +   +   V A+D G PPLS  TRV++ + ++  N  P            P+     +  S  EN   G N+  V+A DPD    L  + I           V  N  F +  + GL      V  Q+ +DR+   +     ++I  A ++  P P+TA  T+ + + D+ND  P F+ + +   + E        + G +   VKA D D+   L+Y    P                     +F VDS SG+IF+   L  +  + + FTV   D
Sbjct:  116 IPVRDYNDNQPTFLGRPYTASVSESLPVGSELSVEPPIVVVDRDEGINSEVQMKCLEENDICDIFEVRAVKISDGNYTARVALKQQLDFESRP------SYILTISASDSALDNRLSSLATISINVIDIQDQPPIFTNAPYSATVPENTPAGVSILT---VKAVDGDVGIPREIFLS--LEDEPFGHFELVPFGDPRDGTAVLQTTSEP-LDRENAEILQNGGVYVFSIRATELIDGAIPAEHSLTRVTIVVTDVDDHQPTFSGPHFNVSITENLANGMPLPGLSIFVDDRDMGENSRYELSLRDVFNAARVFEVSPTESQGRTPVVVKVLNASRLDYDVVDPDLRKFEFDL-VASVKGVEKAKTRVEIHLLDANDNAPVFDQGTYRFTAAENLPVDAIIG--HVKATDLDSGEFGHVRYVLKGFGA--------DNFYVNPETGGVYLLKPLDYEK--QSSYSLTVVAIDGGQREANANLF------VGVTDVNDNHPNFESKEYSRTIREGAALFEPQFFVRAHDADGPSQGNGRVKYSIVSENSIAGNVFRIE----PDTGEIVIQKAARSMDTERGEYELVVSATDFGIPPLSNTTRVLVRVGISG-NQRPIFRGHFQNMENLPIIGPPSYRVSIPENAAAGSNVTSVSAHDPDGLDSLLRYRI-----------VGANDNFEIDEISGLI----TVSPQARIDRD---SNMNSFEIIVNAVDSGTPIPETATTTVYVNVKDINDERPKFEQNSYATYVSE------RTAVGESVLRVKAIDKDLNSKLEYSMVGPVAATTKAGVSIANRSNYRLQEAFRVDSQSGEIFVNGTLRHDVAAIIIFTVGVRD 909          
BLAST of Cadherin-23 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 308.531 bits (789), Expect = 8.846e-84
Identity = 385/1441 (26.72%), Postives = 619/1441 (42.96%), Query Frame = 2
Query:  851 PMIQLQLQAQDSAYHVS--INFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSF-----LDYEQIKSINVSIKGLQIAPVFNIPEDSY-ADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIY--------------SLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAP-VFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFN--VTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYL---YFDPSLS---------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS------TVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGL-SLDGYLTLITPLT-----IYGIFYYKLIIEIMDNPRGTIHFKKSK-EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSS--------LKNLGARFTFIVNAV-----DNGVPRLSNN-----CTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT-ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTA 4930
            PM  L + A D     S      F+ +ID    PPIF+ + Y+  + E++P  T V +V A  GD + RSPV+YS+  G+P + YF+I   SG I IA  +D E++  + V     L + AT   P ++    T V I++ D+NDN+  F+  + + SV E+++ G  +         DKD  ++ Q   S V  +               K +  I  ++G       LDYE  +   + +     A    +P  S    + + + DVNDN P+F    Y+  + E+      I  V A+D D+G   +I Y              S +D  + F I  ++G IY           LDRE  +R  +  +ATD G       T VI+ + D NDN P F+   Y+   F    N   G V    T  D+D+  N  +      S+ P N   +F+++  TG+++   P+DRE    ++  L+V A D           ++I V DVNDNAP +       V+V +     T ++ + A D D      + ITY ++ G DS    + ++ +P +G I  +      +  ++   V ASD G PP  T  ++ + V ++ND  P FT S   F   E+  +G  +G ++  +     D+    ++ +   +  +   +N L    +     +++  G + V  +LDRE  S    +I+ +D  A     PQ++  T++IE+ DVNDN P +        + E     + + T    F     D    G LQY    YF P L+         F +DS++G + L   LD E V      V   D    V        TV + +LD ND+ P+FV           L IS+ T++G + A  VA D D+G+N  + +     N    F + S  G + L+  L      +     + LII   D+  G    KKS   + + V   +NN P F Q  Y  + I E    G+ + +V A      EN N+SY+I      D+F +   R   +  +GQ    S         +++   + T   +AV      + +   SN       T+ +T+ D+NDN P F        GS    S+ EN+   +I  + A+D D G N ++ +++   N  ++F  I   SG LS  R  DRE    Y  ++ A+D G P S     NI + V D +DN P F         S Y G     S+   +  G  +  + +AVD D+G NA +VY    +T   F +D  SG +  + + DRE + +Y+  V A       DG      G      +   V + +LDINDN P+F     +G +     P   ++ +     D D+ +   + Y +              +N  +   F +N ++G LS +
Sbjct:  791 PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP-DGYFSIETNSGNIRIAKPLDHEAK--SQVL----LNIQATLGEPPVYG--HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAA---HAHDKDSGSSGQVTYSLVKES--------------GKGLFAIDARSGHLILSQHLDYESSQRHTLIV----TATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP-------LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE---FRIEENLRRGSVVGVVTASDLDLGENAAI----RYSLLPIN--SSFQVHPVTGEISTREPLDREL--RELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQN--ASITYSIVKGRDSDGHGLFSI-DPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIE--RPADVVRNSVEESFEDLRVT-YTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN--PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSE----ATPVGTIIHNFTATDADTGTNGDLQYRLIRYF-PQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDH--GQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT-ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR-GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF------RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFS-IDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRF-------KLSKYTG-----SVQEDAPLGTSVVQI-SAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLAT------DG------GRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQ--ALDADLGANAEIVYSL------------NAENSAVSAKFRINPSTGALSAS 2119          

HSP 2 Score: 293.123 bits (749), Expect = 4.685e-79
Identity = 366/1343 (27.25%), Postives = 580/1343 (43.19%), Query Frame = 2
Query:  644 EFCTNLAIVDYDEINSICNLTITSVTSGSISDFNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSA---YHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDG-NPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF------TLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNR-ILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFI----IQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQ-VLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLD---GYLTLITPLTIYGIFYYKLIIEIMDN---PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFG----------ENGNVSYKI-LLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGV---PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--------DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLG---TPSLTSAVNIEXXXXXXXXXXXXF--PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG 4477
            EF   +++ D D      N+ +T   +G    F +T                 S++ + +  PLD E      L + A D      H S +  F+++ DV D PP F+   Y + + E     T V+ V A D D  L S + YSL +      ++F I+  +G I     ID E++ +        LTV+A +   P L  SS   V + I D+NDN   FDQ  Y  SV EN   G  I+   ++   D D   NA  N +     K  + FEV    + +  I +        LD+E+  S    +       +      + A + + + DVNDN P+F    Y   + E SP        T I  V ATD D G FG++ Y +   +    F ID STG I+       D   +  +    L + A  TDGG L +    ++ L   D    PPIFE   Y  ++ E+      G V         DVA+   + Y  Y  S  P  Y   F I  ++G++ I  P+D E     +L +     +P    ++    + I V+DVNDNAP F  +   ++VP++      +   +A D D  ++ Q  +TY L+       F ++A    ++G +I          + H   V A+D G P LST + IL++V ++ND PPVF +  +S +  E+  I   I QVNA+D DT  N  + Y I    + N  N+++SS        +V+   G+    G +Y+++ LDRE       Q+ V+  A +   P   A   + + +LD NDN P FQ S ++F + E      N+  G+    V A+D+D+     ++Y     + SF V  ++G+I   + LDRE     +  V   D    V S    V I V DVNDN P   D  + V+++ E    GT   +  A D D G+NA + +       S   GL S+D   G +     L       Y+L +   D    PR T+   +     + V+D+N+N P F+     F  + E   +G ++G +   ++             E+  V+Y +  L KD    I   F I +    G ++V   L + + + F   + A+D      P+ S+  TV + + D+NDN P +     P +    Q S      T+I   +ATD D+G NG++++ L        +S       F +  ++G LS     D E    Y   V A D     T  L ++V + + +LD +D+ P F  P++      S++        IS+++  G  + ++  AVD D G N  + Y  TG
Sbjct:  414 EFVARISVHDPDSKTEYANVNVT--LNGGDGHFALTTRD-------------NSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSI-FLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQ------LTVVARDGGVPPL--SSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCIL---KVSASDPDCGVNAMVNYTIGEGFKHLTEFEVR---SASGEICI-----AGELDFERRSSYEFPVLATDRGGL-----STTAMIKMQLTDVNDNRPVFYPREYKVSLRE-SPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFV---VRPDMLSVRTQPMHMLNISA--TDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKED---IPRGTVVGSVIAASGDVAHRSPVRYSIY--SGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP---VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQ--VTYSLVKESGKGLFAIDA----RSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSS--------DVSQHFGIFPNSGWIYLRAPLDRETRDRY--QLTVL--ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEE------NLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLR-----VEVLDLNDNRPTFTSSSLVFR-VREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKD---LIEAAFDIDR--HSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQ-SSAITVKIEVADVNDNAPEW-----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF--------ISDATRIGEVVAHI-VAVDEDSGDNGQLTYEITG 1649          

HSP 3 Score: 277.715 bits (709), Expect = 2.218e-74
Identity = 374/1430 (26.15%), Postives = 625/1430 (43.71%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFTFIQVI--DVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL-KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSAN----FDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQY-NLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND----PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPP-NYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQ-----NISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR---VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-------------PNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNL-DSMNGD-HEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDR--DIGYNAL--------IVYI---FTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTI-PTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILS 4924
            LD E  P   L ++A D        F  + +   DV D  PIF  S Y +T+ E   V T V+ V A D D      V+Y++ +  +   + F I+  +G I I   +D E++++       +L V+A +       ++  FV I++ D+NDN       F        + E++Q G  +   + I V D D  +  +Y N++   N         + +   + +I ++ V     LD E + +  +S+           P  +   + + I DVNDN P F    Y   + E +   T +  V A D+D G+   + YSL +      + F ID  TG I T  + + +      E   +L VV  A DGG   L +  TV++ + D+NDN PIF+  FY   + EN      G   +K +  D D   N ++    N ++G    +L  F++ +++G++ I   +D E+      +  V+A D     +  T +I++ + DVNDN PVF    + V++ +     + +++T I+ + ATD D  N  Q  ++YR++ G ++  F ++      TG I    P+  L VR   +H   + A+D G    +   ++ +++ +    PP+F ++ +++   E++  G  +G V A     + D+A+   ++ +     SG P +  F++          G + +   LD E  S +   IQ     A    PP      + IE+ DVNDN P F+ S+ + S+ E      +   GA  +   A D D   + Q  Y     S    F +D+ SG + L + LD E+       V+ +DG       N T+ + V DVNDN P F      +N+SE   +     +  A+D D G NA + +                ++ S  FG+    G++ L  PL       Y+L +   DN     H K    V + V+D N+N P F +  YEF  I E    G+++G V A+D D GEN  + Y +L        I   F++  V   G+I     L + L   +  +V A D G P  S    V + + D+NDN P   +P           S+ E     T +  + A D+D G N  I +++    + D H  F I P SG +      D E + +Y+  V A+D G P   +   + V VLDL+DN P F S+ L+  F + E         +++L G  +G++ + ++R  D+  N++        + Y     T D +   F +D  SG+L   +  DRE +  +   +RA+  +   + P S          S   V + + D+NDN P +   P  L   V  ATP   I+  +   TD D  +   L Y +   +P  ++   Q  +L     F ++  +G LS
Sbjct:  244 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL------HELVVVAKDHGEQPLETT-AFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFV---ARISVHDPD--SKTEYANVNVTLNGGDGH----FALTTRDNSIYLVIVH--LPLDREIVSNYTLSVVATDKG---TPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET-----EPVPQLTVV--ARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE---PVGRCILKVSASDPDCGVNAMV----NYTIGEGFKHLTEFEVRSASGEICIAGELDFER--RSSYEFPVLATD--RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ--VSYRIVAGNEAGIFRIDR----STGEIFVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIA----ASGDVAH---RSPVRYSIYSGDP-DGYFSIET------NSGNIRIAKPLDHEAKSQVLLNIQ-----ATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE------SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK--TRVIVRVLDANDNDPKFQKSKYEFR-IEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-------INSSFQVHPVT--GEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP------QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLV--FRVRE---------DAAL-GHVVGSI-SPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTA-SNNPQS----------SAITVKIEVADVNDNAPEWPQDPIDLQ--VSEATPVGTIIH-NFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL-----FRMDSLTGALS 1552          

HSP 4 Score: 265.774 bits (678), Expect = 9.780e-71
Identity = 345/1341 (25.73%), Postives = 563/1341 (41.98%), Query Frame = 2
Query: 1100 FAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNK--AILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN----DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFY----QAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI--VGTLQY--LYFDPSLSFYVDSISGQIFLIKA--LDRETVSNLNFTVSCSDGVFL---VNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLIT---PLTIYGIFYYKLIIEIMDNPRGTIHFKK---SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDH-----------EFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTI-LGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDG 4996
             AI+  +GEI   + +DRE++        + L  I         +     V + + D NDN+  F Q        EN+   V   +   +   D DL     YN +  YN  + ++ + + + +  +   +L + ++   FLD E     ++ I+ L        P   +  V+I I DVNDN PIF  S Y   + EN+   T +  V A+D D+   G + Y++N    D  + F ID  TGAIY N         LD E  E   +V +A D G     TT  + ++  D+NDN P   V F        + E++    F   R+   D D     ++  Y   N+++ G   +      + S   V +  P+DRE + N    L VVA D     +  +  I + + DVNDN P F  + +  NV +     T++L + A D DE     S +TY L      +     + +P+TG I  +         V   TV A D G PPLS+   +L+ + ++ND  P+F QS ++ S  EN  +G  I +V+A+DPD         +   +N     G    + F V +        G + +   LD E+ S+    +   D+         +  A +++++ DVNDN P+F    ++ SL E  K  S  S+      V ATD D    G + Y  +  + +  F +D  +G+IF+++   L   T       +S +DG  L    ++ V ++++D     P F        + E    GT+    +A   D    + V +       S +    DGY ++ T    + I     ++   +++ N + T+         +V I V DVN+N P F       S + E   +G  +    A DKD G +G V+Y ++ +    +F +           G ++++  L      R T IV A D GVP LS N T+ V + D+NDN P F       +  S   S   +    I  ++A+D D+G N  I + +     D+           + F I P SG +      DRET+D Y+  VLA D GTP+  +   + V VLD +DN P F  S Y    F I E      ++   S+ G     V TA D D+G NA I Y        F + P +G +   +  DRE ++ Y   V A                 +P   +   V + + D+NDN P    P   +  + +   P +++V +     D+D     ++TY I            + ++ +   +F+++ TSG++ T   V          ++ +  SDG
Sbjct:  123 LAIDRATGEIRTKVKLDRETR------ASYSLVAIP-------LSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL---LPARDLDLEP---YN-TQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGG---TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN-------KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEF-VARISVHDPD-----SKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSN--YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLN--SALTYSLAETPETHAQWFQI-DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-------VNAMVNYTIGEGFKHLTEFEVRS------ASGEICIAGELDFERRSSYEFPVLATDRGG------LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPI-VAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRY-------SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRIS-VPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDAR-------SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK-----DEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKY---EFRIEE------NLRRGSVVG-----VVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-------------TPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVR--AVDRDHGQNASITYSI-----------VKGRDSDGHGLFSIDPTSGVIRTR--VVLDHEERSIYRLGVAASDG 1340          

HSP 5 Score: 227.254 bits (578), Expect = 5.271e-59
Identity = 331/1248 (26.52%), Postives = 513/1248 (41.11%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAY-HVSINFT-FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFN-----------EYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFM-IFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDN----------FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGV-DSVNFIVEAVY-----NPKTGAIIKKYPNARLQVRVHNFTVEASDRGY---PPLSTRVIILINVTEINDEPPVF---------TQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP-PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVS-----------NLNFTVSCS---------------DGVFLVNSTVSITVLDVNDNEPYFV-DYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSK-EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRL-SNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGD-HEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIE 4276
             L L+  LDYE      L + A D     +S N T  + V DV D PP+F+   YS  ++E   ++  +I V A D D    + + Y + D    N           ++F I   SG I +   +DRE++D       + LTV+AT+   P+    +R  VR+  LD NDN   F +  Y+  + EN + G  + +   +   D DL  NA    S +  N   S F+V+P+           +     LD E  +  ++ ++   Q  PV      +   V I + DVNDN P   +     + + E  P  T +  V A D+D G    I YS+     +D    F ID ++G I T V       +LD E      +   A+DGG     T  ++ ++  DLNDN P F      + +F    +   G V   +   ++  DV  N +   F ++ +    Y  N          F I+  +G++ +   +DRE      L++  +    SN+       ++I V DVNDNAP +  +   + V +     T I    ATDAD       D+ YRLI     +N   E        +  TGA+  + P     V+ +   V+A D+       L T V + + + + ND  P F         T SLF     +   IG  +  + A D D+  N  L Y      I   N  G      F + +     QTG I  V+S+    +     G+  +I  A +   P P+ +   L + +   ++NPP F  ++++ ++ E      N+ +G+    V A  +         Y  P+      F+VD   G I      DRE+ +           N   T+S S               +G     +T+ ITV DVNDN P F       L++ E ++ G I    VA+D D G NA +I+     N  + F + S  G L+   PL       Y L I+  D  RG    ++    + I+V D N+N P F    Y  S + E   +GT + ++ A D D G N  + Y +  +      I            G I     L + L A + F+V A D G   + S    V + ++DINDN P F     P  G  P  ++ +   TL+ +  A D D G N EI ++L++ N      F I+P +G LS  +S   E+  L    V+A D G P  +S   IE
Sbjct:  987 HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD------RYQLTVLATDNGTPAAHAKTRVIVRV--LDANDNDPKFQKSKYEFRIEENLRRGSVVGV---VTASDLDLGENAAIRYSLLPIN---SSFQVHPVTG--------EISTREPLDRELRELYDLVVEARDQGTPV----RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV-------VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT---SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRV---TYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTN--GDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF---ISDATRIGEVVAHIVAVDEDSGDNGQLTY-----EITGGNGEG-----RFRINS-----QTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILE------NVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT-VVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASD--RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGS-VQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI--------DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVP--ALIQPGQTLLKV-QALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIE 2151          

HSP 6 Score: 167.162 bits (422), Expect = 8.603e-41
Identity = 319/1221 (26.13%), Postives = 498/1221 (40.79%), Query Frame = 2
Query:  830 PLDYERFPMIQLQLQAQDSAYHVS----INFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPI--FGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFV--IDSSTGAIYTNVNANTDY----------------------------------------------TLLDREAYE-RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKIN-ASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIG---VDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVF--TQSLFSFSTY-------ENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYV-QSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGAT-GFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRET--VSNLNFTVSCSDG-------VFLVNSTVSITVLDVNDNEPYFVDYIQV-LNISEVTQVGTIFAKFVANDSDAG--ENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIY--GIFYYKLIIEIMDNPRGTIHFKKS----KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTN-------IGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL---KNLGARFTFIVNAVDNGVPRLSNNCTVAVTI-IDINDNY-PSFTNP----VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISG 4165
            PLD E+     LQ+QA D     S     N T I V D  D  P F+ S Y+ ++ E+ P+ T V+ ++A+D D  + + + YSL   N     FAI+  SG I     +DRE Q        ++  V+AT+       S+   V+I +LDINDN   F++  Y G V    Q G  ++   ++   D DL ANA+  Y+L+A  N+  S+ F + P      A   +  ++G  L  E +       KG       N P+ S   + + I +    TP+  F N +Y  M+ ENSP+ T +  V A   D G   K+ +S     +  +  +DS +G I  N     DY                                               L + +  E R+ +VA   D   L +   ++I L+D NDN P F  + + A + E +   TF   +V A D D   +N R+ Y   +      N+ + F I  A +G V     +DRE    DI +L ++A D     M  T  I++ + DVNDN P F  N   V V +       I  ++A D D        +TYRL     VD  N  + A+       ++K+  +  LQ + +   V ASD  +     R ++ + V + ND  PVF   Q    F+         E+L +  ++  VNATD D+  N     +II+           P    F+V      + + G+V V  S L     S+    +++I K A  P    +    LR++    NDN     +   QF L   +  ++ IS  A  G  V     D +     +      S +    S  I L+K LDRE   +  L   +S   G             +V IT+LD NDN P F    +    ISE+  +    A+  A D+D     N+ V++     N    F + L   +  +     Y  G   Y+LII   D+     H ++     +   + + D N+N P F        P+TEY +       +G+ +    A+D D G  G ++Y I     +D    ++FR+    D    LV S+         R+   + A D G        +VAV + I+  D + P FT      V P+  + PQ  +       +  ++ATD DSG +G + + L   +  H  F ++  SG
Sbjct: 1908 PLDREQHSRYTLQIQASDRGQPKSRQGHCNIT-IFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSL--ANETQWQFAIDGQSGLITTVGKLDRELQ------ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL---KVQALDADLGANAEIVYSLNA-ENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVV----ARDKG-------NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTF-VAQVHAFDSDAG-SNARLRYHIVDG-----NHDNAFVIEPAFSGIVRTNIVLDREI--RDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE-----------PAQEGFSV------HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL--LRVQ---ANDN----GSGRSQF-LQNQY--RAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS-----HHQRPLCSLQPFRLELHDENDNEPKF--------PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRV----DSESGLVTSAFVFDYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYV-------VGQVTATDSDSGPDGRVVYQL---SAPHSHFKVNRSSG 3024          

HSP 7 Score: 152.525 bits (384), Expect = 2.641e-36
Identity = 229/945 (24.23%), Postives = 396/945 (41.90%), Query Frame = 2
Query: 2099 FYNMSMGPPNYL-------DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-----IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL-----SFYVDSISGQIFLI---KALDRETVSNLNFTVSCSD-GVFLVNSTVSI--TVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF---PNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSF-TNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS--FDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDT-VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVT---DKDIVSQNALTYWI 4825
            F  +  GPP  +        +  I+ +TG++     +DRE   +    L+ +     N  +       + V+D NDNAP F   +  +  P+N         L A D D    P +   Y ++  +  +    + +  + G +     I  + + R     ++  +EA D G PPL   + + I + ++ND  P+F QS +  +  EN  +G ++ QV A+D D + +    +++  IN   S         +   +  ++   G +Y+   LD E    L   + V     E PL   TAF ++R  + DVNDN P     +F   L +D  PK + S     F  + +  D     +Y   + +L      F + +    I+L+     LDRE VSN   +V  +D G   ++++ SI   + DVNDN P F   +   N+ EV   GT   + +A+D D G N+ + +     P   +  F +    G +T  + +        +L +   D   G      +  V + + DVN+N PIF Q FY  S + E   +G  I +V A+D D G N  V+Y I          L  F ++  +  G+I +   L     + + F V A D G   LS    + + + D+NDN P F       S   SP+ S   ++  ++ ++ ATD D G  G++ + + + N +   F I   +G +  +R       T+ ++   + A D G  +L S  N + +V     +    P  +    ++ Y        +      G  +G+V  A   D+ + + + Y I++GD    F ++  SG++   K  D E K      ++A      G+ P   + G++  N       + + D+NDN P F        +V+ + P S  +    Y     DKD  S   +TY +
Sbjct:  102 FGGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRAS--YSLVAIPLSGRNIRVL------VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLE--PYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLD-RETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADEN---GLVEYAINRRQS---------DKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPL-ETTAFVSIR--VTDVNDNQPTINV-IF---LSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDG--GVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSAS--GEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG--NLRS--NADAVVFLSIIDAMQRPPIFEKARYNYY--------VKEDIPRGTVVGSV-IAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT----LGEPP---VYGHTQVN-------IEVEDVNDNAPEFE-----ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL 970          

HSP 8 Score: 147.902 bits (372), Expect = 6.622e-35
Identity = 329/1392 (23.64%), Postives = 544/1392 (39.08%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNP-FNE-------YFAINETSGEIIIAMIIDRES-QDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIG---SEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMN-KAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNI-----------PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTN-----------------VNANTDYTLLDREAYERLFVVAIA-TDGGGLMNMTTVIIILKDLNDNPPIFEV-RFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRG-YPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPI--FQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF-------DPSLSFYVDSISGQIFLIK---------------ALDR--------------------ETVSNLNFTVSC-------------------SDGVFLVN-STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL--SLDGYLT--LITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSN-GSSPQFSIYENTITL---ITIISATDKDS-GLNGEIRFNLDSMNGDHEFFFISPISG----NLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            I+V DV D  P +        ++E  PV T +   TA D D      +QY L    P  NE        F ++  +G + +   +D E+ Q+   +    D +   TE       +S T VR++ILD ND++ +F  P   G    +     A  IG   + I+  D+D   N Q                 Y I   N +    I  + G     E +KS+  + + ++    FN+           P+ S  ++ + +   ++N P F  + Y   I EN P+ + +  VTA          + Y +     ND F    +D   G I T                   +AN   TL      ++    +I  T  G   ++ T+ I + D+NDN P F     Y   + ENS         V A+D D +  N  ++Y     ++G     + F I++S+G+++   P+DRE+     LQ+         S     C I I V+D NDNAP F L+ ++ +V ++    T+++ ++A DAD     +  + Y L       F ++     ++G I       R     +NF V A+D G Y   S  V + INV +IND  P+F +  +       +  G  + +V A D D   N ++ Y     ++NA NS+   V++ F +      N + G +     L  E    L  ++   DK      PPQ++   + + I +     P+  FQ   ++  L      K N  +G     V A   D  G  Q + F       D  LS   DS+SG+I + K               AL R                     T S    T S                    +D  FL + + + I + D NDN P F     V  +SE    GT  A+  A DSDAG NA + ++    N  + F +  +  G +   ++    I  I+  K+I        G      +  + + ++DVN+N P F         ++E T +G +I  + A D D      ++Y++  +   D+  + +F + + +  G++++   L   L   +   V A D           + V + D NDN P F     P+     P  S    ++++   +  ++ATD DS G N ++ + ++      E F + P +G    N+S ++     + D Y  R++A D G P+L S+  + V   D       F  N      S                    +G+V   + +D    +L +     ++    L   S  +  +K  DRE  D Y   +R V +S     PH      S  + S   V++ ILD NDN P+F
Sbjct: 1473 IEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTER----LQTSVT-VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQL---------------TYEITGGNGEGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFH---VDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIH--TVVASDLD-EGPNADLIYSITGGNLG-----NKFSIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQ-GHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNAR--LVYSLANETQWQFAIDG----QSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVY-----SLNAENSA---VSAKFRI------NPSTGALSASQSLASESGKLLHLEVVARDKGN----PPQSSLGLIELLIGEAPQGTPVLRFQNETYRVML------KENSPSGTRLLQVVALRSD--GRRQKVQFSFGAGNEDGILSL--DSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIA----TDEGVPQMTGTATIRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYS--GKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGVVSVNMSRLQPAVSSSGD-YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQIS----------------EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQ--SKAIVLVKPLDRERNDLYK--LRLV-LSH----PHGPPLISSLNSSSGISVIITILDANDNFPIF 2752          

HSP 9 Score: 104.76 bits (260), Expect = 8.622e-22
Identity = 208/884 (23.53%), Postives = 359/884 (40.61%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIAT-ETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNK--AILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIF--GNSSYTFMIFEN--------SPNFTLIGVVTATDKDS-GIFGKIIYSLNDPFKKFVIDSSTGAIYTN-------VNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSN------SSMFDTCIIQIIVQDVNDNAPVFGLNT-FSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQ----VRVHNFTVEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKS-NISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIK--ALDRETVSNL-------NFTVSCSDGVFLVNSTVSITVLDV 3310
            S F LT + P +      + L  +  D+ +  S     I++ D  D  P F    + +T++E     T V  V A D D    + ++Y + DGN  N +      SG +   +++DRE +DI      + L +IAT E  P +  ++   +R+QI+D+NDN   F  P    +V E ++ G  I   + I   D D      Y L A    +++   E   I A+++    LV++ +    LDYE  +   + +     A       ++   +++ + D NDN P+F        F I           S +F L+  V ATD DS G   K+IY +    + F +  S G +  N       V+++ DY           FV  IA D G   L + T + +   D       F    Y+A + E +     G V ++     +D           ++++   N    F++  S   + +V P+DRE+  ND+ +L +V   P         +      + I + D NDN P+F  +  +   + +      +I  L A DAD+ NTP S++ Y +  G D   F ++ V    TG +   + N RL      + +   + A D  +  PL +     + + + ND  P F  + +     EN  +G ++ + +A+D D          +     +N S  P  S  +   +  ++   G+V    + D E+      ++   D         + A   +R+EI   ++  P F    ++F L     P +  +  G     V ATD D    G + Y    P   F V+  SG + + +   LD +   NL       +  +S S G    NS  S+ V+++
Sbjct: 2276 SSFALTNSQPNEIR----VVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDI------YKLKIIATDEGVPQMTGTA--TIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVI---TSISANDVDTYPALTYRLGA----ESTVDIENMSIFALDRYSGKLVLKRR----LDYELQQEYELDVIASDAA------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLL-TVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDY-----------FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAA---PLGSVVLQLGQDALD----------QSLAIIAGNEESAFELLQSKA-IVLVKPLDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLV----TGVL---FVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLD----------KGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG------KKASVAVRVEIESRDEFTPQFTERTYRFVL-----PAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRH--NSLSSMAVVEI 3071          
BLAST of Cadherin-23 vs. Ensembl Zebrafish
Match: cdh23 (cadherin-related 23 [Source:ZFIN;Acc:ZDB-GENE-040513-7])

HSP 1 Score: 387.497 bits (994), Expect = 3.881e-108
Identity = 460/1658 (27.74%), Postives = 721/1658 (43.49%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAP--SLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIA-PVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIV--TPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAET-PLPPQTAFATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGA--RFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGS--------SPQFSIYENTITLITIISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAV-------PMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFV---WMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIYEKE-VNP 5572
            +T  +P D E+     L +  +D         T  ++++ID  D  P F    Y + + E    V   + TVTAID D  L   ++Y++  GN   + F IN  +G+I++   +D E   I+N  G + LTV AT+  P   L  +S T V + ++D+NDN   F +P          Q G  +     +   D D  +N +      Y+     +   + I ++   +   RV+    LD E I   N++I    +  P  N    +   V I +LD+NDN PI  N      + E +   T I  V A D DSG    + YS+   +    F I+ ++G +  N         LDRE      +     D          +   + + L D+NDN PIF    Y+  + ENS   T      GPV   A DKD+ V N  + Y      +      D F I++ TG V++     +DRE      ++L +V+ D     +  +  + I + DVNDN PVF  ++F+V +P+N  T   +  L+ATDAD  +     + YRL       FIV+A+    +GA++    NA   R +   +   V A+DRG P LS    + + + ++ND  P F Q + + S  E+   G+ +  + A DPD    L Y+II     +V +     N++  +    G++   G V+V++ L+RE  +T    + V D A++   +      A L I +LDVNDN P F+    + F  S+ E   P      G T   V A D D    G + Y   +     Y+   D  +G+I   + +D E V  LNFTV   D           V + ++DVNDN P F   +   +I E   +GTI     A D+D+G  +V I Y   +    FG++   G + +++ L       Y L     DNP G+ + ++  S +V + V+DVN+  P FS+  +  S + E   +GT +  + ATD D GEN  ++Y  L     D F L         D G I    SL+ L +  RF   V A D G P L    ++ +T+ID+NDN P F   V P+NG+         P   +YE        + ATD+D G+NGE+R++     + N D E F I  ++G ++     DRE + LY   V+A DLG P     V  E +         +  +  + +       P    S+   S  G  +GNV  AVD D G NA++ Y I  GDT   +    SG L   K+ DRE    YS  V+A        P  Q             P    E R+   + DIND  P FT      G+   A   S ++ +     D DI + + + Y I +I      S+ + ++ N     VF +  T GI+ T       APG F    V+   +   G SD     +    +  +   Q+V  VI   P  V      F N LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y +LD +    +  P    D    + +A+     +L +   +F+   W YR+ ++ KL+A    S       + + +P TN Y  E  NP
Sbjct: 1106 VTRPSPPDREKQQQYTLTVTVEDDGTPTLSTSTTVWVRIIDENDNAPEFPEEEYVTELREGPNTVGAIIATVTAIDPDEGLNGTIRYAISKGN-LAQTFQINSVTGQIVVVSALDYE---ISN--GHYVLTVTATDQCPIPLLRLTSSTTVLVNVIDVNDNPPIFPRPFEGPFEITEGQPGPRVWT---VKATDADSGSNGKVE----YSITAGDLKNEFVISSVEGEL---RVRKDIELDRETIAYYNITITAKDLGTPSLN----ATVVVGILVLDINDNDPILLNLPANTSVSEGAAVQTFIIQVRAQDSDSGRNALLTYSITAGNSDGAFYINETSGVVQVN-------RPLDRERVAEYSLTITVKDNPDNPRIARRDSELLTVTLLDVNDNRPIFSQSSYRGEISENSPTGTTVLILNGPV--LAEDKDIGV-NAVVSYGLLGTRV------DIFSIDSRTGVVSVRGGAVLDREAFSVPRVELFLVSVDVG--GLNSSVPLTITILDVNDNPPVFNPSSFTVRLPENSPTGVVVTQLSATDADAGSNGW--LQYRLDSGAQDRFIVDAL----SGAVLVG--NATLDREERSSYRLVVIATDRGTPSLSGTATLTVVLDDVNDSRPRFIQPVQTISVNESTPPGVVVATLAAEDPDLKPRLEYYII-----SVEAKDDGNNAVDGLQQSFGIDFHTGAVFVRNPLNRELVATFEIIVSVHDNASDVIEMSVSVPNAKLTINVLDVNDNAPRFRPFGVANFSESILEGAVP------GTTLLSVTAVDPDKGPNGQIIYQLLNLPRGNYIRLEDPSTGKIVANRTVDFEQVQWLNFTVRAQDHGSPPRFTELPVYLRIIDVNDNNPVFQQPLYQKSIFEDVALGTIIVSVRATDADSGLFSV-IEYGLVDGEGKFGITPTTGDIYILSALDRETKDRYTLTAYARDNPGGSPNNRRENSVQVQLTVLDVNDFRPRFSERVFTTS-VFENEPVGTSVITMKATDLDEGENALLTYS-LQGPGADAFSLD-------PDTGLI---RSLRLLQSFERFNLTVVATDQGRPPLWGTASLQITVIDVNDNRPIF---VRPANGTIMHILEEQPPGLVVYE--------VFATDEDEGVNGEVRYSFLQTGAGNRDWENFHIDAVTGVITTAVKLDREKQALYSLVVVAYDLGQP-----VPYETMQPLQVALSDIDDNEPVFLKPPRGSLPYQSLSVPEHSSPGTVVGNVTGAVDADEGSNAIVYYFIAGGDTGGNFALSVSGVLRVKKDLDREEIPVYSIIVKASSNRNWTPPKGQRSQRAQVLDPSRDP-TLQEVRI--FLEDINDQSPRFTKLEYTTGVAADAKVGSDLIRVQ--AIDNDIGNNSLVLYHILSIRYIKLHSNDSEEMGN-----VFIIGETDGIICTFDLFMAYAPGYFI---VEVLARDLAGHSD-----VALVSIYILRDDQRVKIVINEIPERVRLFQEEFINLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDVLIHVVNKQTNRILDVEKVIQMIDENKEQLRNLFRNYNILDVQPAVTARAP----DDLTTLQMAIIILAVLLFLAAMLFILMNWYYRTVHKRKLKAVVAGSTGNQGLMDILDMPNTNKYTFEGANP 2655          

HSP 2 Score: 277.33 bits (708), Expect = 3.036e-74
Identity = 384/1383 (27.77%), Postives = 617/1383 (44.61%), Query Frame = 2
Query:  773 KIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSA---YHVSINFTFIQVIDVEDVPPIFQN-SSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINV-SIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATD-GGGLMNMTTVI-IILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMF--DTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNAT--DADESNTPQSDITYRLIGVDSVNFIVEA---VYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL-------------SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD--------GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEV----TQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMD----NPRGTIHFKKSK--EVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDN--GVP--RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIIS--ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIR---SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF--PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF--TG----DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            KI +V+  Y  V+   L  PLD E      L+++A D+     +  ++ T + ++DV D PP+ Q+   Y+ +++E +   T V+ V A D D    + + Y +  GN  +  F ++  +GEI+      DRE Q        + LTV +  +  P+L  S+  +VRI  +D NDN+  F +  Y   + E      AII     +  D+ LN   +Y +S        ++ + + I ++   I+V+     S LDYE      V ++      P+  +   S   V + ++DVNDN PIF       F I E  P    +  V ATD DSG  GK+ YS+   D   +FVI S  G +    +       LDRE      +   A D G   +N T V+ I++ D+NDN PI         + E +   TF  ++V+A  +D D   N +L   Y+++ G  N    F IN ++G V +  P+DRE++    L +  V  +P N  +   D+ ++ + + DVNDN P+F  +++   + +N  T TT+L LN      D+     + ++Y L+G     F +++   V + + GA++ +   A    RV  F V     G   L++ V + I + ++ND PPVF  S F+    EN   G+ + Q++ATD D   +     +Q  +++       V++L           +G ++   + LDRE+ S+    +   D+      P  +  ATL + + DVND+ P F   +   S+ E   P   ++T      + A D D+   L+Y                    SF +D  +G +F+   L+RE V+     VS  D         V + N+ ++I VLDVNDN P F  +  V N SE        GT      A D D G N  +I+   N       L    Y+ L  P T   +    +  E +       R   H    +  E+ +Y  +IDVN+N P+F Q  Y+ S I E   +GTII  V ATD D G    + Y ++  +         F I      G I + S+L +    R+T    A DN  G P  R  N+  V +T++D+ND  P F+  V  +       S++EN     ++I+  ATD D G N  + ++L     D   F + P +G + ++R   SF+R     +   V+A D G P L    ++++ V+D++DN P+F  P+N  +M+    + P            G  +  V  A D D G N  + Y F  TG    D   F++D  +G +    + DRE +  YS  V A  + Q             P+   +  + V + DI+DN PVF  P
Sbjct:  988 KINTVNNTYGEVY---LNAPLDRESVDRYLLKVRAMDNGSPPRYTDVSLT-VNIVDVNDNPPVLQSPRGYNVSVSENVGGGTSVLRVVATDRDIGANAMLSYYITAGNQ-DLTFRMDRMTGEIVTRPSPPDREKQQ------QYTLTVTVEDDGTPTLSTSTTVWVRI--IDENDNAPEFPEEEYVTELREGPNTVGAIIATVTAIDPDEGLNGTIRYAISK------GNLAQTFQINSVTGQIVVV-----SALDYEISNGHYVLTVTATDQCPIPLLRLTSSTTVLVNVIDVNDNPPIFPRPFEGPFEITEGQPG-PRVWTVKATDADSGSNGKVEYSITAGDLKNEFVISSVEGELRVRKDIE-----LDRETIAYYNITITAKDLGTPSLNATVVVGILVLDINDNDPILLNLPANTSVSEGAAVQTF-IIQVRA--QDSDSGRNALLT--YSITAG--NSDGAFYINETSGVVQVNRPLDRERVAEYSLTI-TVKDNPDNPRIARRDSELLTVTLLDVNDNRPIFSQSSYRGEISENSPTGTTVLILNGPVLAEDKDIGVNAVVSYGLLGTRVDIFSIDSRTGVVSVRGGAVLDR--EAFSVPRVELFLVSVDVGG---LNSSVPLTITILDVNDNPPVFNPSSFTVRLPENSPTGVVVTQLSATDADAGSN---GWLQYRLDSGAQDRFIVDAL-----------SGAVLVGNATLDREERSSYRLVVIATDRGT----PSLSGTATLTVVLDDVNDSRPRFIQPVQTISVNESTPPGVVVAT------LAAEDPDLKPRLEYYIISVEAKDDGNNAVDGLQQSFGIDFHTGAVFVRNPLNRELVATFEIIVSVHDNASDVIEMSVSVPNAKLTINVLDVNDNAPRFRPF-GVANFSESILEGAVPGTTLLSVTAVDPDKGPNGQIIYQLLN-------LPRGNYIRLEDPSTGKIVANRTVDFEQVQWLNFTVRAQDHGSPPRFTELPVYLRIIDVNDNNPVFQQPLYQKS-IFEDVALGTIIVSVRATDADSGLFSVIEYGLVDGEGK-------FGITPTT--GDIYILSALDRETKDRYTLTAYARDNPGGSPNNRRENSVQVQLTVLDVNDFRPRFSERVFTT-------SVFENEPVGTSVITMKATDLDEGENALLTYSLQGPGADA--FSLDPDTGLIRSLRLLQSFER-----FNLTVVATDQGRPPLWGTASLQITVIDVNDNRPIFVRPANGTIMHILEEQPP------------GLVVYEVF-ATDEDEGVNGEVRYSFLQTGAGNRDWENFHIDAVTGVITTAVKLDREKQALYSLVVVAYDLGQP-----------VPYETMQP-LQVALSDIDDNEPVFLKP 2246          

HSP 3 Score: 272.707 bits (696), Expect = 8.332e-73
Identity = 361/1344 (26.86%), Postives = 581/1344 (43.23%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQY-NLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYE-------RLFVVAIATDGG----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-----GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLF-QFSLFEDFKPKSNISTGATGFYVKATDVDI--VGTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIF------YYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSLKNLGA-RFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRE-TKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            +TL   LDYE      L + A+D     +     I V+DV D  P+FQ  +Y+ ++ E       VI   A D D    + + YS+   + F  +F+I+   G  +I +    + + +    G   LT++A +      NS+   + I+++D NDN   F  P Y  ++ EN  AG  ++      V   DL+A+ ++   S +Y+ + SS F +              +   + LD E +KS  + I       V    +   A V+I +LD+NDN P++ +  Y   + E SP  T +  V A D D G  G ++YS+N     + I+ +TG I T+        +LDRE+ +       R  +++ ATD G          TV + L DLNDN P F       ++ E       G    RV+  D D + AN  +      + MG P    +F++N +TG +     +DRE+I    L+  ++AYD        T  + I V DVND  P F  + ++V++ +++  +  ++ LN TD D      ++++Y +      G  SV F        +TG +       R     +   +EA D G  P   R      + + V ++ND  P+F Q+ +  S  EN+  G +I QV ATD D   N  + Y I+              N  F++ +L GL   G +      LDRE  S+   +++    A  + L    +   + + + DVND  P+F  S + +  L E          G +   V+ATD D    G + Y L       F VD  +G +  +  LD ET ++    VS +D          TV +T+L+  D    F+     +++ E    GT   +  A  +D   N   + Y  +  +SP  L+L    ++   +T+ G+        Y L +   D   G      +  V I ++D N+N P F         I E T IG  +  VLA DKD G NG V++ ++     DV     F+I  VN+  G++ +N+ L      R+   V A+DNG P    + ++ V I+D+NDN P   +P           S+ EN    T +  + ATD+D G N  + + + + N D  F         ++     DRE +  Y   V   D GTP+L+++  + V ++D +DN P FP    +    + EGP T  +I         I  V TA+D D G N  I Y  +   +   F ++  +G +  +   D E +   Y  TV A         P   L        S   V+V ++D+NDNPP+F  P
Sbjct:   36 VTLRGRLDYELMRRFTLTILARDGGGEETTGRLRINVMDVNDNAPVFQKEAYTGSLMENEQAPQQVIRARATDEDSPPNNILTYSIIYASQFRSFFSISIAEGYAVITVTRPLDYEQVPG--GLIFLTLMAKDGGNPSLNSTVPVI-IELIDQNDNPPEFSLPSYIVNIPENIVAGATVL-----FVNATDLDASREFGQTSLIYSLQGSSQFRLNTRSG--------EITTTALLDRE-MKSEYILIVRAVDGGVGPQQKTGIATVNITVLDINDNAPVWRDEPYQANVVEMSPIDTDVITVFAVDPDYGDNGTVVYSINPENPFYTINRNTGKIRTS------GAVLDRESQDARSAQLMRTIIIS-ATDRGTPPLRSSASATVFVNLLDLNDNDPAF---LNLPFVAEVPEGLPIGSSVFRVQVQDPD-EAANGAVTMA---LQMGMPRL--DFRLNITTGILVSTVVLDREQIGQYYLR--IIAYDAGQFPRTSTSTLTITVLDVNDETPTFFPSVYNVSLEESVPRDYLVVRLNCTDNDAG--LNAELSYFITAGNQDGKFSVGF--------RTGVVRTVVGLDRETQASYRLVIEAIDNG--PAGGRRTGTATVYVEVLDVNDNRPIFLQNSYETSVLENIPRGTSILQVQATDADQGENGKVLYRILSGN-----------NGQFSMDSLSGLISRGSVA-----LDRETRSSNVLEVE----AYNSDLGSMRSTVRVIVYVEDVNDEFPVFTQSQYNRLGLRE------TAGIGTSVVVVRATDPDTGDGGAVAYSLVSGSDRKFEVDVSTGLLTTVDYLDYETKTSYLMNVSATDQSPPFHRSYCTVYVTLLNELDEAVAFLSAGYEVSLRENIATGTEVVQVKAQSAD---NLNQLSYRFDPDTSPAALALFKIDSVTGRITVTGLLDRERGDSYTLTVVADD---GGPKRGSTVVVSITILDENDNSPEFDITSDLSVNIPEDTAIGKRVAVVLARDKDAGRNGLVNFTLIAGNMQDV-----FKINTVNNTYGEVYLNAPLDRESVDRYLLKVRAMDNGSPPRYTDVSLTVNIVDVNDNPPVLQSP------RGYNVSVSENVGGGTSVLRVVATDRDIGANAMLSYYITAGNQDLTFRMDRMTGEIVTRPSPPDREKQQQYTLTVTVEDDGTPTLSTSTTVWVRIIDENDNAPEFPEEEYVT--ELREGPNTVGAI---------IATV-TAIDPDEGLNGTIRYAISKGNLAQTFQINSVTGQIVVVSALDYEISNGHYVLTVTATDQC-----PIPLLR-----LTSSTTVLVNVIDVNDNPPIFPRP 1267          

HSP 4 Score: 265.003 bits (676), Expect = 2.080e-70
Identity = 381/1379 (27.63%), Postives = 604/1379 (43.80%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSA-YHVSINFTFIQVIDVEDVPPIFQ-NSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAIN---ETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPL-YQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVS------IAILDVNDNTPIFGNSSYTFMIFENSPNF--TLIGVVTATDKDSGIFGKIIYSLNDP--FKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAI-ATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP-----VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY-NPKTGAIIKKYPNARLQVRVHNFTVEASDR-GYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINI----GQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQ--SMLDREKYSTLTGQIQVID---KAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKA-LDRETVSNLNFTVSCSD-GVFLVNSTVSITVL--DVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVAND----------------SDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKS---KEVGIYVIDVNNNFPIFSQV-FYEFSP-ITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARF-TFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND--LGTPS--LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            ++T+T  LD ER     L + A D      S     I ++D  D  P F   S  S  + E+  +   V  V A D D      V ++L  GN   + F IN    T GE+ +   +DRES D         +  +   + P   + S T   + I+D+NDN      P  Y  SV EN   G +++    ++  D+D+ ANA  +      N+  +    + +  M   I    V   S  D E+ +   +++          + +D    +S      + I+D NDN P F    Y   + E  PN    +I  VTA D D G+ G I Y+++     + F I+S TG I          + LD E     +V+ + ATD        L + TTV++ + D+NDNPPIF         FE  +  T G        VKATD D   +N ++ Y     S+   +  + F I++  G++ +   +  DRE I      + + A D    S+  T ++ I+V D+NDN P+      + +V +  +  T I+ + A D+D      + +TY +   +S      A Y N  +G +    P  R +V  ++ T+   D    P ++ R   L+ VT  ++ND  P+F+QS +     EN   G  +    G V A D D             +NAV S G+    L    ++  ++   G+V V+  ++LDRE +S    ++ ++        + +P       L I ILDVNDNPP+F  S F   L E      N  TG     + ATD D    G LQY L       F VD++SG + +  A LDRE  S+    V  +D G   ++ T ++TV+  DVND+ P F+  +Q ++++E T  G + A   A D                 D G NAV      +     FG+    G + +  PL    +  +++I+ + DN    I    S    ++ I V+DVN+N P F       FS  I E    GT +  V A D D G NG + Y++L     ++      R++  +  G+I+ N ++     ++  F V A D+G P       V + IID+NDN P F  P+        Q SI+E+    T+I  + ATD DSGL   I + L  ++G+ + F I+P +G++  + + DRETKD Y     A D   G+P+    ++V +++ VLD++D  P F     +   S++E     TS+               A D D G NAL+ Y   G     F LDP +G +  ++    ++ + ++ TV A               G  P     A + + ++D+NDN P+F  P
Sbjct:  890 RITVTGLLDRERGDSYTLTVVADDGGPKRGSTVVVSITILDENDNSPEFDITSDLSVNIPEDTAIGKRVAVVLARDKDAGRNGLVNFTLIAGN-MQDVFKINTVNNTYGEVYLNAPLDRESVDRY----LLKVRAMDNGSPPRYTDVSLT---VNIVDVNDNPPVLQSPRGYNVSVSENVGGGTSVL---RVVATDRDIGANAMLSYYITAGNQDLT----FRMDRMTGEI----VTRPSPPDREKQQQYTLTV---------TVEDDGTPTLSTSTTVWVRIIDENDNAPEFPEEEYVTELRE-GPNTVGAIIATVTAIDPDEGLNGTIRYAISKGNLAQTFQINSVTGQIVV-------VSALDYEISNGHYVLTVTATDQCPIPLLRLTSSTTVLVNVIDVNDNPPIF------PRPFEGPFEITEGQPGPRVWTVKATDADSG-SNGKVEY-----SITAGDLKNEFVISSVEGELRVRKDIELDRETIA--YYNITITAKDLGTPSLNATVVVGILVLDINDNDPILLNLPANTSVSEGAAVQTFIIQVRAQDSDSGR--NALLTYSITAGNSDG----AFYINETSGVVQVNRPLDRERVAEYSLTITVKDNPDNPRIARRDSELLTVTLLDVNDNRPIFSQSSYRGEISENSPTGTTVLILNGPVLAEDKDIG-----------VNAVVSYGL----LGTRVDIFSIDSRTGVVSVRGGAVLDREAFSVPRVELFLVSVDVGGLNSSVP-------LTITILDVNDNPPVFNPSSFTVRLPE------NSPTGVVVTQLSATDADAGSNGWLQYRLDSGAQDRFIVDALSGAVLVGNATLDREERSSYRLVVIATDRGTPSLSGTATLTVVLDDVNDSRPRFIQPVQTISVNESTPPGVVVATLAAEDPDLKPRLEYYIISVEAKDDGNNAV------DGLQQSFGIDFHTGAVFVRNPLNRELVATFEIIVSVHDNASDVIEMSVSVPNAKLTINVLDVNDNAPRFRPFGVANFSESILEGAVPGTTLLSVTAVDPDKGPNGQIIYQLL-----NLPRGNYIRLEDPS-TGKIVANRTVDFEQVQWLNFTVRAQDHGSPPRFTELPVYLRIIDVNDNNPVFQQPLY-------QKSIFEDVALGTIIVSVRATDADSGLFSVIEYGL--VDGEGK-FGITPTTGDIYILSALDRETKDRYTLTAYARDNPGGSPNNRRENSVQVQLTVLDVNDFRPRFSER--VFTTSVFENEPVGTSVI-----------TMKATDLDEGENALLTYSLQGPGADAFSLDPDTGLIRSLRLL--QSFERFNLTVVATDQ------------GRPPL-WGTASLQITVIDVNDNRPIFVRP 2134          

HSP 5 Score: 256.914 bits (655), Expect = 6.558e-68
Identity = 289/1023 (28.25%), Postives = 441/1023 (43.11%), Query Frame = 2
Query: 1724 ATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP---VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTG--DVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQ--VIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVG----TLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVF--LVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISN-SSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTIL 4720
            ATD D G FG + Y  +D   +F +D+ TG  +  +    DY L+      R  +  +A DGGG      + I + D+NDN P+F+   Y   L EN       P   +R +ATD+D    NN + Y     S     +   F I+ + G   +T+  P+D E++P  ++ L ++A D  N S+  T  + I + D NDN P F L ++ VN+P+NI    T+LF+NATD D S    Q+ + Y L G            N ++G I       R     +   V A D G  P     I  +N+T  +IND  PV+    +  +  E   I  ++  V A DPD   N  + Y     +IN       P N  + +    G  +T G V     LDRE     + Q+   +I  A +   PP   +A AT+ + +LD+NDN P F    F   + E       +  G++ F V+  D D       T+      P L F ++  +G +     LDRE +      +   D G F     ST++ITVLDVND  P F   +  +++ E      +  +    D+DAG NA + ++    N    F +    G +  +  L       Y+L+IE +DN         +  V + V+DVN+N PIF Q  YE S + E    GT I +V ATD D GENG V Y+IL   +       +  +  +  +G + ++   +   +     V A ++ +  + +   V V + D+ND +P FT       G      I     T + ++ ATD D+G  G + ++L  ++G    F +   +G L+ +   D ETK  Y   V A D   P   S   + V +L+  D    F S       S+ E   T T +    + S   +  ++   D D    AL          +F +D  +G +      DRE  D+Y+ TV A       DG         P   S   V + ILD NDN P F I + L
Sbjct:    5 ATDNDIGTFGVVRYYFSDEPDQFSLDAETG--WVTLRGRLDYELM-----RRFTLTILARDGGGEETTGRLRINVMDVNDNAPVFQKEAYTGSLMENEQ----APQQVIRARATDED-SPPNNILTYSIIYASQ----FRSFFSISIAEGYAVITVTRPLDYEQVPGGLIFLTLMAKDGGNPSLNSTVPVIIELIDQNDNPPEFSLPSYIVNIPENIVAGATVLFVNATDLDASREFGQTSLIYSLQGSSQFRL------NTRSGEITTTALLDREMKSEYILIVRAVDGGVGPQQKTGIATVNITVLDINDNAPVWRDEPYQANVVEMSPIDTDVITVFAVDPDYGDNGTVVY-----SIN-------PENPFYTINRNTGKIRTSGAV-----LDRESQDARSAQLMRTIIISATDRGTPPLRSSASATVFVNLLDLNDNDPAFLNLPFVAEVPE------GLPIGSSVFRVQVQDPDEAANGAVTMALQMGMPRLDFRLNITTGILVSTVVLDREQIGQYYLRIIAYDAGQFPRTSTSTLTITVLDVNDETPTFFPSVYNVSLEESVPRDYLVVRLNCTDNDAGLNAELSYFITAGNQDGKFSVGFRTGVVRTVVGLDRETQASYRLVIEAIDNGPAGGRRTGTATVYVEVLDVNDNRPIFLQNSYETS-VLENIPRGTSILQVQATDADQGENGKVLYRILSGNNGQ---FSMDSLSGLISRGSVALDRETR---SSNVLEVEAYNSDLGSMRSTVRVIVYVEDVNDEFPVFTQSQYNRLGLRETAGIG----TSVVVVRATDPDTGDGGAVAYSL--VSGSDRKFEVDVSTGLLTTVDYLDYETKTSYLMNVSATDQSPPFHRSYCTVYVTLLNELDEAVAFLSAG--YEVSLRENIATGTEVVQVKAQSADNLNQLSYRFDPDTSPAAL---------ALFKIDSVTGRITVTGLLDRERGDSYTLTVVA------DDG--------GPKRGSTVVVSITILDENDNSPEFDITSDL 944          

HSP 6 Score: 209.534 bits (532), Expect = 1.665e-53
Identity = 346/1336 (25.90%), Postives = 558/1336 (41.77%), Query Frame = 2
Query:  914 FIQVIDVEDVPPIFQNSSYSS-TMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTS-SIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFG-NSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEV-RFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGD-VTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNIST-NTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHN----FTVEASDRGYPPL---STRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQS--MLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATG----FYVKATDVD----IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG------VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIF----AKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVG---------IYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR--FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL----------DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYE-GPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYL---DPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
             + V DV D  P+F  S Y+   + E   + T V+ V A D D      V YSL  G+  +  F ++ ++G +     +D E++        + + V AT+ +P  F+ S   V + +L+  D +  F    Y+ S+ EN      I  G+E+ V+ K  +A+    LS  ++  TS +   ++ I ++   I V        LD E+  S  +++      P       S   VSI ILD NDN+P F   S  +  I E++     + VV A DKD+G  G + ++L      D FK   ++++ G +Y N         LDRE+ +R  +   A D G     T V + +   D+NDNPP+ +  R Y   + EN    T   +RV ATD+D+    N +L   Y ++ G  N    F+++  TG+ VT  +P DREK       L V   D    ++  +  + + + D NDNAP F    +   + +  +T    I  + A D DE       I Y    +   N       N  TG I+     + L   + N     TV A+D+   PL   ++   +L+NV ++ND PP+F +             G  +  V ATD D+  N  + Y I                   ++ N   ++   G + V+    LDRE  +     I   D       P   A   + I +LD+NDN PI            +    +++S GA        V+A D D     + T      +   +FY++  SG + + + LDRE V+  + T++  D           +  +++T+LDVNDN P F        ISE +  GT         +A D D G NAVV +         F  S+D    +++   + G     L  E    PR  + F  S +VG         I ++DVN+N P+F+   +    + E +  G ++ ++ ATD D G NG + Y+ L     D FI+           G +LV ++  +   R  +  +V A D G P LS   T+ V + D+ND+ P F  PV          S+ E+T   + + +   +D  L   + + +          ++++G  + F I   +G +      +RE    ++  V  +D  +  +  +V++    L +         N L +N +     P    + S S L G   G      TAVD D G N  I+Y         Y+   DP +G +   +  D E     + TVRA     +G          SP   +E  V + I+D+NDN PVF  P
Sbjct:  715 IVYVEDVNDEFPVFTQSQYNRLGLRETAGIGTSVVVVRATDPDTGDGGAVAYSLVSGS--DRKFEVDVSTGLLTTVDYLDYETKT------SYLMNVSATDQSPP-FHRSYCTVYVTLLNELDEAVAFLSAGYEVSLREN------IATGTEV-VQVKAQSADNLNQLSYRFDPDTSPAALALFKIDSVTGRITVT-----GLLDRERGDSYTLTVVADDGGP----KRGSTVVVSITILDENDNSPEFDITSDLSVNIPEDTAIGKRVAVVLARDKDAGRNGLVNFTLIAGNMQDVFKINTVNNTYGEVYLNAP-------LDRESVDRYLLKVRAMDNGSPPRYTDVSLTVNIVDVNDNPPVLQSPRGYNVSVSENVGGGT-SVLRVVATDRDI--GANAMLS--YYITAG--NQDLTFRMDRMTGEIVTRPSPPDREK--QQQYTLTVTVEDDGTPTLSTSTTVWVRIIDENDNAPEFPEEEYVTELREGPNTVGAIIATVTAIDPDEG--LNGTIRY---AISKGNLAQTFQINSVTGQIVVV---SALDYEISNGHYVLTVTATDQCPIPLLRLTSSTTVLVNVIDVNDNPPIFPRPFEGPFEITEGQPGPRVWTVKATDADSGSNGKVEYSITAG----------------DLKNEFVISSVEGELRVRKDIELDRETIAYYNITITAKDLGT----PSLNATVVVGILVLDINDNDPILL----------NLPANTSVSEGAAVQTFIIQVRAQDSDSGRNALLTYSITAGNSDGAFYINETSGVVQVNRPLDRERVAEYSLTITVKDNPDNPRIARRDSELLTVTLLDVNDNRPIFSQSSYRGEISENSPTGTTVLILNGPVLAEDKDIGVNAVVSYGLLGTRVDIF--SIDSRTGVVS---VRGGAV--LDREAFSVPRVEL-FLVSVDVGGLNSSVPLTITILDVNDNPPVFNPSSFTVR-LPENSPTGVVVTQLSATDADAGSNGWLQYR-LDSGAQDRFIVDAL-------SGAVLVGNATLDREERSSYRLVVIATDRGTPSLSGTATLTVVLDDVNDSRPRFIQPVQ-------TISVNESTPPGVVVATLAAEDPDLKPRLEYYIISVEAKDDGNNAVDGLQQSFGIDFHTGAVFVRNPLNRELVATFEIIVSVHDNASDVIEMSVSVPNAKLTI---------NVLDVNDNAPRFRPFGVANFSESILEGAVPGTTLLSVTAVDPDKGPNGQIIYQLLNLPRGNYIRLEDPSTGKIVANRTVDFEQVQWLNFTVRA---QDHG----------SPPRFTELPVYLRIIDVNDNNPVFQQP 1925          

HSP 7 Score: 57.7658 bits (138), Expect = 2.047e-7
Identity = 102/385 (26.49%), Postives = 153/385 (39.74%), Query Frame = 2
Query: 3719 ATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISA--TDKDSGLNGEIRFNLDSMNGDHEFFFISPISGN--LSNIRSFDRET--KDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNV-ATAVD--RDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPF 4843
            ATD D G  G V Y      + D F L         + G + +   L   L  RFT  + A D G    +    + + ++D+NDN P F              S+ EN      +I A  TD+DS  N  + +++   +    FF IS   G   ++  R  D E     L    ++A D G PSL S V +          + +   N     FS+   P    +I  + ++G  +  V AT +D  R+ G  +LI Y   G +  F L+  SG +      DRE K  Y   VRAV     G GP              A V + +LDINDN PV+        +V+ +  ++ ++ +  +  D D      + Y I    PF
Sbjct:    5 ATDNDIGTFGVVRY--YFSDEPDQFSLDA-------ETGWVTLRGRLDYELMRRFTLTILARDGGGEETTGR--LRINVMDVNDNAPVFQKEAYTG-------SLMENEQAPQQVIRARATDEDSPPNNILTYSIIYASQFRSFFSISIAEGYAVITVTRPLDYEQVPGGLIFLTLMAKDGGNPSLNSTVPV---------IIELIDQNDNPPEFSL---PSYIVNIPENIVAGATVLFVNATDLDASREFGQTSLI-YSLQGSS-QFRLNTRSGEITTTALLDREMKSEYILIVRAV---DGGVGPQQ--------KTGIATVNITVLDINDNAPVWRDEPYQANVVEMSPIDTDVITV--FAVDPDYGDNGTVVYSINPENPF 344          
BLAST of Cadherin-23 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 356.295 bits (913), Expect = 2.362e-98
Identity = 390/1370 (28.47%), Postives = 621/1370 (45.33%), Query Frame = 2
Query:  794 GYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQV----IDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSA-----NFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLN-ANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIK----GLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNST--VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKV-NDKGQILVNSSLKNLGAR-FTFIVNAVDNGVPR-LSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIF--TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDI 4795
            G  +   L  T  LD E  P  QL +Q +D        F ++QV     D+ D PP F +  Y +++ E+  V + V+ + A D D    + + Y L +G PF     I+  +G ++I   +D E++        + LT+ A +   PSL+  +RT   +++LD+NDN        F       SV EN+Q G  + +   + V D D + AN   ++S +  N+    F+V+     N ++    +K  S LD E+I S N+++     G  +A        S+A + I + D+ND+ PIF  + Y   I E+ P  + I  V+ATD DSG    + YSL   +    F I  ++G +       T    L+RE    + +   A D G    ++ T +I+ + D+ND  P F    Y   + E+S   +   V + ATD D+   N  I + F   S  P +  + F++++++G ++  T +DRE+  + +L   + A D     +   C + I ++DVNDN+PVF    +  N+ +N  + +++  + A+D D        + Y +   DS  F + +     +G +       R +   +   V A+D G     T  I+ + V +  D P VF Q  +SF  +EN+ +G  IG V+AT  D + ++ Y I         +SG    SLF +          G +    ++DRE+ +    Q++VI +A E      T    + I + D+NDN P F  S+   S  E      N +TG   F  KA+D D    G + Y L  +P   F++    G I L   L+  T S+    V  SD GV    S+  ++I+V DVNDN P F      + I E   V + F +  A D D+G N  +++     N+   FG+  DG L +   L       Y L++   D  R       S  V I + D+N+N P+F+   Y F    E    G ++G V A DKDFG N  V Y      +T     +L  I  V     Q+   S ++  GA  F+F V + D G+P+ L +   V V I DINDN P FT  +        Q SI E+   +T +  +SA+D D   NG + +++   N + + F I   SG ++ +   D ET   Y  +++A D G+  L+S   + + VLD +DN P FP + L ++                 L   +IG +    TA D D G NA I Y    T +   F + P +G +F +K+ D ET+  Y   V A    +             P   S   V++ + D NDNPPVFT   I   I +    ++ ++ I+ + TD DI
Sbjct:  189 GEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGE--PKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQ----IDPKAGTVVIKEGLDYETKR------EYSLTIHAVDNGVPSLY--TRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVAL---LTVSDSDSSTANGNISVSILGGNEQRH-FDVHSSPVPNLSL----IKVASVLDRERISSYNLTVSVSDNGKPLA------RSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLV-------TSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGS-ELVVLSATDSDLG-PNGTIRFSF--DSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLL--YIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGR--NGTVKYAITAGDSSKFHISST----SGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTNITYLI---------ASG-DQRSLFGI--------KAGQITALGLIDREEQAFY--QLRVIARAGEV-----TGETLVNITVKDLNDNAPNFMHSVEHVSAVE------NWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKD--RAVESLSASVNVSILLDDINDNRPLFNSTNYVFH-FEEEQERGALVGRVFAEDKDFGPNSEVRYSF----ETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIY-------QASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQ-FSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDV----------------LENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGR-------------PSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADI 1435          

HSP 2 Score: 286.189 bits (731), Expect = 8.990e-77
Identity = 351/1268 (27.68%), Postives = 566/1268 (44.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAY---HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAIL---VIRVKNGSFLDYEQIKSINVSIKGLQI-APVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN-DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVE--ASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDRE---KYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSN------LNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYEN--TITLITIISATDKDSGLNGEIRFN--LDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSG 4513
            LD ER     L +   D+       S     I V D+ D PPIFQ + Y   ++E++P  +++  V+A DGD    + ++YSL  GN    +FAI+E SG +  A  ++RE+          +++       P +   S T + + I D+ND    F Q  Y  S+ E+S AG  +++   +   D DL  N     S  ++++T       P+   NK  L     R+   + LD E+  S  + I+     AP    P  S   V+I + DVNDN+P+F    Y   I EN P+ + +  VTA+D D G  G + Y++      KF I S++G + T V        LDRE      +   ATDGGGL + T  I+ +   D  DNP +F  + Y   +FEN      G +    +   VD+  N      Y ++ G    L  F I A  G +T +  +DRE+      QL V+A       +    ++ I V+D+NDNAP F  +   V+  +N +T   I    A+D DE+      I Y L       F +      K G I    P   L+V   ++ +E  ASD G P  ++ + + I+V ++ND  PVF Q  +  +  E+  +     +V ATD D+  N ++ Y II                  N  ++ G+   G + Y+++ LDRE   +YS L   +   D+A E+     +A   + I + D+NDN P+F ++ + F  FE+ + +     GA    V A D D      ++Y +  P  +F +++I+G +     LDRE++         +FTV  SD          + V + + D+NDN P F   I   +I+E  Q  T   +  A+D D  +N +V +     N    F + S  G +TL+  L       Y L I   D+  G++    +  + I V+D N+N P F +       + E   IG ++  V ATD D G N +++Y I    +   F +      +F ++K++ + Q L           +   V A D+G P  S++  V + + D NDN P FT    P +      SI EN    T +  I+A D D+ +NG + ++  L +  G H  F I  +SG +   +  DRE  +L++  + A D   P+      ++ + + + D     P+ ++  N  + E  +   SI  + L          A D D G N  + Y +  GD+  F +D +SG
Sbjct:  419 LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLG-WFAISENSGLVTSAAELNRETASEI----VLNISAKDQGLQPKI---SYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVV---LSATDSDLGPNGTIRFS--FDSET-------PVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAP----PLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLV-------ALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFEN---VPVGTIIGTVSATTVDLHTNIT----YLIASGDQRSL--FGIKA--GQITALGLIDREE--QAFYQLRVIA---RAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGM--IVYSLKQNPKGLFHIHE----KHGLISLTGP---LEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISG----------------NTRDVFGIFPDGQL-YIKADLDREVQDRYSLL---VVAKDRAVES----LSASVNVSILLDDINDNRPLFNSTNYVFH-FEEEQER-----GALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDS--GSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVD-VLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSL-----------YKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFT----PGDIFK---SIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGH--FRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPT-FISQNALVAESNIVIGSILTTVL----------AFDPDEGANGEVEYELVRGDSDTFIMDRYSG 1566          

HSP 3 Score: 266.544 bits (680), Expect = 8.555e-71
Identity = 358/1356 (26.40%), Postives = 600/1356 (44.25%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRS--PVQYSLKDGNPFNEY---FAINETSGEIIIAMI----IDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQ--IAPVFNIPEDSYADVSIAILDVNDNTPI-----FGNSSYTFMIFENSPNFTLIGVVTATDKDSGIF-GKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERL-FVVAIATDGGGLMNMT--TVIIILKDLNDNPPIFEVRFYQAWLFEN--SYNFTFGPVRVKATDKDVDV-ANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDAD-----------ESNTPQSDI-TYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSF--TNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRET------KDLYKFRVLANDLGTPS-LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFT--GDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDI--SKYVTDKDIVSQNALTYWI 4825
            I V+D+ D  P+F ++S   +  E+      VI  TA D D          Y +  GN   ++     +N +     + ++    +DRE+        F+ L + +  +  P  F   +  V IQ  DINDN  +FD   YQ SV+E++  G +++   +I   D D  ANA+      Y     + F++ P     KA  V+ +K G  LDYE  +  +++I  +   +  ++     +  + ++ +LDVNDN P+     F  +S    + EN+   T++ ++T +D DS    G I  S+   +  + F + SS      N++     ++LDRE        V+++ +G  L   +  +++I + D+ND+PPIF+   Y+  + E+    ++  G   V ATD D    AN R     Y++  G  N L  F I+ ++G VT    ++RE     +L   + A D           + + + DVND  P F  NT+ V++ ++    + ++ L+ATD+D           +S TP SD   +RL   DS            +G +       R +   +   + A+D G PPL +   + I + ++ND  PVF    +  +  EN   G ++  V A+DPD   +     ++  I A +SS   ++S            T G V     LDRE+ +    Q+   D        P    A + + ++D  DNP +F    + F +FE      N+  G     V AT VD+   + YL             +GQI  +  +DRE  +     V    G     + V+ITV D+NDN P F+  ++ ++  E    G    +  A+D D   N ++++    N    F +    G ++L  PL +    Y    +E++ +  G      S  + I V DVN+N P+F Q+ YE + I E   + +    V ATDKD G NG + Y I+     DVF         +   GQ+ + + L + +  R++ +V A D  V  LS +  V++ + DINDN P F  TN V         F   +    L+  + A DKD G N E+R++ ++   +   F ++ I+G L++    DRE+        ++ F VL++D G P  L     ++V + D++DN P F  +       IY+      SI+ S+ +  ++  V +A D D   N L+ Y  T   +   F +D  SG +  + + D ET  +YS  + A              SG  P + S   + + +LD NDN P F   T+   +++    N +I ++  S   TD D  S   +TY I
Sbjct:  117 IVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTP------FYQLLIQVEDKGEPKKFGYLQVNVTIQ--DINDNPPSFDHEQYQTSVFEDAAVGSSVL---QIAASDLDEGANAEI----TYLLDEGTPFQIDP-----KAGTVV-IKEG--LDYETKREYSLTIHAVDNGVPSLY-----TRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSP---VPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKG---VSATDGDSGQNANLR-----YSLVSG--NSLGWFAISENSGLVTSAAELNRETASEIVLN--ISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRL---DST-----------SGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRN---GTVKYAITAGDSSKFHISS------------TSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTP----AIVTVTVVDTQDNPLVFGQKDYSFVMFE------NVPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEVTTSSYQ---LEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVT-ILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVF--------GIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVF-------HFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSN---FELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKD-------IYQA-----SIAESAQNMTQLLRV-SASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAED------------SGSVPLS-STCVLSISVLDDNDNSPSFPKSTLSVDVLE----NMRIGELVASVTATDSDSGSNADITYSI 1338          

HSP 4 Score: 256.144 bits (653), Expect = 1.112e-67
Identity = 331/1215 (27.24%), Postives = 530/1215 (43.62%), Query Frame = 2
Query: 1013 ITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYS--LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG---LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDI-LQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTL--QYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIY---------GIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATD-KDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISA--TDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF-TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRA 4579
            I+ T  +G  +L   V Y++  G   ++ F I+  SGE+     +DRE +        + L V A +       SS  +V I + DIND++  F + +Y   + E+   G  +   + I+  D D   N +   S V  +   S F + PI  +      +  +   F     I ++  +  G + + V          V   +LDVND+ P+F +S YT  I E+      +  V+A D+D G    ++ S  L+    +F I+ STG I T+       +LLDRE      ++ +A+DGG    L +  TV +++ D+NDNPP F    +  ++     + + G +    T  D D  +N  L+  Y+++       + FKI+   G +T       EK+     +   V   D   +   D+  + +      D  P   L   +   P+N  TNT +     T    S+     ++Y +   +  N F ++ +    +G +  + P     +  +   +EA D+G+PP S    + I V ++ND  PVF Q  F     ENL     +  V+A D D+  N  L Y II                  N  N   +N+  G +     LDREK +  + +++  D+     +PP++    + I +LDVNDN P F + +F  ++ E      N   G T   V  TD D       +Y   D SL F +   +G I + + L+RE   +    VS  D  + V++ V+I V D+NDN P F      L+  E+T++G+I  +  A D D G N   IFYF  + +  F ++       I     Y          +  +  I+   D  RG         V I V+D N+N P F    Y F+P+T+   +GT + +V A D KDFG N  + Y I     ++      FR+ K    G + V SSL  +    +   + A D G P LS+  TV + + + N + P F+      N  +   S      T I  +SA   DKD  +NG I +N+ S N D   F +   +G LS  ++ D ETK  ++ RV A D G  + TS V + + V D++DN PVF P  Y             F  +  +  SG  +  +  A D+D G NAL+ Y+  + D+ +F +DP +G +      D E K  Y  TV+A
Sbjct: 1732 ISQTCAEGANAL---VTYAIISG--ADDSFRIDPESGELSATRRLDRERRSK------YSLLVRADDGQ----QSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIV---AAILASDGDSGVNGEITYS-VEEDDEDSTFLLNPITGVFNVTRALDFETQPFF----ILTVRAADGGGRSSSV---------RVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQFSINPSTGLIITS-------SLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFH---HHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLH--YSLTG---RNSEKFKIDPIRGAITA-----SEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIV-----TKVTGSSPRAGPLSYYIASGNLDNAFHIDQL----SGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSGPNGQLEYAIIDG----------------NKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRG----MPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPE------NAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNG-KIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASD--RGIKPLMSETTVMINVVDSNDNPPTFESPSY-FTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSN-----KFRLDK--QTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQ-----NQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGN-DDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEY-------------FPVVQENVPSGTTVVKM-NATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKA 2825          

HSP 5 Score: 254.988 bits (650), Expect = 2.768e-67
Identity = 349/1323 (26.38%), Postives = 564/1323 (42.63%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL--QIAPVFNI---------PED-SYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQ-----AWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAST----GDVTIVTPVDREKIPNDILQLLVVAYD---PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-------TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYW 4822
            EE PV T+V T+         +    Y   + +   + F+IN T+G I  + +IDRE      V     + V+   + P+      T VRI +LDINDN+  F       S  E++ +G  +I+ +     D D+ +N         ++ T  I            I V     G+FL         VS  GL  +  P + +         P+   Y  V++ I D+NDN P F +  Y   +FE++   + +  + A+D D G   +I Y L D    F ID   G +            LD E      +   A D G   L   T   + L D+NDN P+ + R++      A + EN+   T   + +  +D D   AN  I     ++S+   N   +F +++S       + + + +DRE+I +    L V   D   P   S F + +  I V D+ND+ P+F    + V++ ++I   + I  ++ATD D      +++ Y L+  +S+ +      +  +G +       R         + A D+G  P  +   +++N+T++ND+ P FTQ+ +  S  E+   G  +  ++ATD D   +        TI     S  PV+      N   L+ T G +   + LDRE+ S+    I+  D  A    PP  +   + I + DVNDN P+F    +    F +   K N  +G++   V A+D D+   GT++Y +    S  F++ S SG++  + ALDRE  +     V+ +DG  L + T   V++TV+D  DN   F        + E   VGTI     A   D   N +       +  S FG+   G +T +  +      +Y+L +                 V I V D+N+N P F       S +  +   G  I +  A+D D   NG + Y +            LF I + +  G I +   L+   + +   V A D GVP+ +++  + +++ D+NDN P F            Q S YE TI       +    + ATDKDSG+NGEI +++ S N   + F I P  G L      DRE +D Y   V+A D    SL+++VN+ +L+ D++DN P+F S   + +F                  G  +G V  A D+D G N+ + Y F      F L+  +G L    + DRE+            M Q G    SF       G       +A+V V I DINDNPP FT       I + A   +Q++ +S    D++   +N L ++
Sbjct:   47 EEQPVGTYVGTIET-------KPAFTYRFSEQH---KLFSINATTGVIYTSSVIDRE------VLPGNIINVVVLSSQPTY----PTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDT---ATDADIGSNG-------VDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHL-------VSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLL-DEGTPFQIDPKAGTVVIKEG-------LDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVAL-LTVSDSDSSTANGNI-----SVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISS--YNLTVSVSDNGKPLARSSFASLV--IFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQ--NANLRYSLVSGNSLGWF---AISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPN-------GTIRFSFDSETPVSD----QNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGA----PPLHSVCKVNITLKDVNDNSPVF----YPMQYFANI--KENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTN-ITYLIASGDQRSLFGIKA-GQITALGLIDREEQAFYQLRVIARAG-----EVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWAT-GHHIFQAKASDPDEATNGMIVYSLKQNPKG------LFHIHEKH--GLISLTGPLEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFD-----------QLS-YEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGN-TRDVFGIFP-DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHF------------EEEQERGALVGRVF-AEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESL-----------MRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDEN---KNGLVHY 1231          

HSP 6 Score: 247.284 bits (630), Expect = 6.348e-65
Identity = 367/1372 (26.75%), Postives = 601/1372 (43.80%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMN-KAILVIRVKNGSFL----DYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG---GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI--IKK--YPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNA--TDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNL--NFTVSCSD-GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEI---MDNPRGTIHFKKSKEVGIYVIDVNNNFPI--FSQVFYEFS-----PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALI---VYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTY 4819
            Q+T    +D E     QL++ A+ +          I V D+ D  P F +S    +  E      H+    A D D +    + YSLK  NP    F I+E  G I +   ++  +         + L V+A++       SS  F+ I + D+NDN+  FDQ  Y+ ++ E+            +   DKD   N +     +  N T  +F ++P   +  KA L   V++   L        ++S++ S+                 +VSI + D+NDN P+F +++Y F   E      L+G V A DKD G   ++ YS   P   F +++ TG + + +  + +  +  R A    F V +++D G    L +   V + ++D+NDNPP F    YQA + E++ N T   +RV A+  DVD   N +++  Y+++ G  N    F I++++G VT+V  +D E  P+    L ++A D  +  +  TC++ I V D NDN+P F  +T SV+V +N+     +  + ATD+D  +   +DITY    + + N       +P TG+I  +KK  Y    L    +   V A D G P  S+ + ++I+V + ND PPVFT      S  ENL I  ++  + A  TD D N  L Y I   T         P    F +      +   G++Y    +DRE  +     I+  D+A       + A   + I + D NDN P F   + Q +L  +    SNI  G+    V A D D    G ++Y L    S +F +D  SG I L   L     S L  +  VS +D G    +S   +T++    + P F     +  + E    GT      A+        V  F     S    G    G L        + I  +  +I+    +D  +G+  +     + +Y I+ +   P    ++V + F       +    N+   I +  A     G N  V+Y I+   D        FRI    + G++     L +   ++++ +V A D    + S++  V +T+ DIND+ P+F+  V         F I E+    +++  I A+D DSG+NGEI ++++  + D   F ++PI+G  +  R+ D ET+  +   V A D G  S +  V   +L ++          +  L N S+Y      TSI  S  +G  +  V +A DRD G ++ +   V++  GD   F ++P +G +      DRET+ +Y   V A       DG        +P + S A V V++ DINDNPP F     +  I    +  S +  ++  VTD+D  S + L Y
Sbjct:  831 QITALGLIDREEQAFYQLRVIAR-AGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQ-NP-KGLFHIHEKHGLISLTGPLEVTTSS-------YQLEVVASDLGVPQRTSS-LFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFF---RVEATDKDSGVNGEIVYDIISGN-TRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASV-----------------NVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTV-LSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMT-QLLRVSAS--DVDENKNGLVH--YDITEG--NEEKQFSIDSNSGQVTLVGKLDYETTPS--YSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGS--NADITY---SISATNNHGTFSISPNTGSIFLVKKLDYETQSL----YKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQT---------PRGGHFRI------DSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEF-RRFALKNVTIWVTDQNDNIPTF---ISQNALVAE----SNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLASQL---IPSKLIYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRS----GGKAAGRL--------FTIGRHSGVIQTAAELDREQGSDLYL----LDVYAIETDAKQPRTQHAEVSFLFDFFFKVMLLLKGNLREHISQTCAE----GANALVTYAIISGADDS------FRIDP--ESGELSATRRLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSRSVY-------SFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDED-STFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVN---------DHPPLFNSSVYT-----TSILESLSAGASVLTV-SAADRDHGNSSTLLNSVHLSGGDG-QFSINPSTGLIITSSLLDRETRASYQLLVVA------SDGGQP-----TPLS-SSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVT--VTDEDSGSNSQLHY 2056          

HSP 7 Score: 247.284 bits (630), Expect = 6.348e-65
Identity = 362/1349 (26.83%), Postives = 580/1349 (42.99%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSIN---VSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDP-FKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPP----IFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNR----ILYQFYNMS--MGPPNY------LDN-FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSNLN--------FTVSCSD-GV--FLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVAND-SDAGENAVVIFYFP-NNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGE--NGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNL----GARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI---TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS--AVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            +L+ T  LD ER     L ++A D      I +  I V D+ D  P F  S YS  + E++   + V  + A DGD  +   + YS+++ +  +  F +N  +G   +   +D E+Q       FF LTV A +       SS   V   +LD+ND+   F+  +Y  S+ E+  AG +++    +   D+D + N+   L++V+ +     F + P   +        +   S LD E   S     V+  G Q  P+      S A VS+ + D+NDN P F +  Y   I  ++   +L+  VT TD+DSG   ++ YSL     +KF ID   GAI                A E+L   +            T  + +KD   NP        VRF     F +          +K  DK      N+    I+ +    S   GP +Y      LDN F I+  +G+++I  P+D E I   +L +          S ++   ++I V DVNDN PVF    F   + +N+S    +L ++A D D    P   + Y +I  +  N F +    N  TG I    P  R +V  ++  V+A+DRG PP ST V +LI+V ++ND  P F++ +FS +  EN  +G  + +V  TD D              NA++   +   SL  +     ++ + G + +   L+RE       ++   D          T    + I + D+NDN P F     + S + D+   + I  G+    V ATD D     +  YF  S +  F ++S SG+IF+ + L  +  S  N        F V+ SD G+   +  +TV I V+D NDN P F        +++  +VGT   K  A D  D G N+ + +     NSS+ F L    G +T+ + L       Y  ++EI  + +G         V I V + N++ P FSQ     + ++E   +GT I  + A DKD  +  NG ++Y I    D  +F +            Q  V S  K L      +    V+A D G    ++  TV + + D+NDN P F +PV         F + +  +   T +  ++ATDKDSG N  + + + S   D + F I P +G ++     D E K +Y   V A ++      S   VNI++             +N  +  F   +    +  IS ++  G  +G V  A DRD+G + ++ Y+  G +    F ++  +G ++     DRE ++  S  V A             + G    +  E  V + +LD ND PPVFT
Sbjct: 1764 ELSATRRLDRERRSKYSLLVRADDGQQSSDI-WVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDE-DSTFLLNPITGVFNVTRALDFETQP------FFILTVRAADGG---GRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLT---VSAADRD-HGNSSTLLNSVHLSGGDGQFSINPSTGL--------IITSSLLDRETRASYQLLVVASDGGQPTPLS-----SSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAI---------------TASEKLTGSS----------EVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPH----------IKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEK--VEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSG--PNGQLEYAIIDGNKENSFNI----NRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAGA-----------NAISRYSITDASLPFI-----IHPSTGDITISRPLNREDTDHYIAKVSAHDSG-------WTVSTDVTIFVTDINDNAPRFS----KPSYYLDYPELTEI--GSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVY--LLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVT-VSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVH----------SQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVF-DPVE-------YFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQS--SDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKG-----------ANEYVPRFVSKQ---YYFEISEAAPKGTVVGEVF-ASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS--------IRGA---DIDEVLVNITVLDAND-PPVFT 2960          

HSP 8 Score: 246.128 bits (627), Expect = 1.579e-64
Identity = 359/1407 (25.52%), Postives = 592/1407 (42.08%), Query Frame = 2
Query:  692 ICNLTITSVTSGSISDFNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAY--HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTF----VRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGS---EIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFT-LIGVVTATDKDSGIFGKIIY---SLNDPFKK----FVIDSSTGAIYTNVNANTDYTLLDREAYERLF---VVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNF---TVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIG------LNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY---FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITVLDVNDNE-PYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVAT---AVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKY 4777
            + ++T T   SGS +D   +  + N +   S+S    S+F   L   LDYE   + +L + A+DS      S     I V D  D PP+F       ++ E LP+ T V+++TA D D  +   ++YS+    P   +F I+  SG I     IDRE  ++      F+LT+ AT+ A P+ F   R F    V I + D NDN   F   + Q ++   S     I+IGS    ++  D D  AN +     V  +  + I + Y               +G      Q+    + I  L ++   +  +   +   + I+    + P+F    Y  ++ E  P  T +I +  ++ + +G   K+ Y   S+    K     F I   +G I T          LDRE    L+   V AI TD          +  L D           F++  L         G +R   +    + AN  + Y   + +       D+F+I+  +G+++    +DRE+       LLV A D   SS      + I V D+ND+ P F  + +S ++P+++S  + +  + A+D D       +ITY +   D  +     + NP TG          L      F   TV A+D G    S+ V +  N+ ++ND PP+F  S+++ S  E+L  G ++  V+A D D                 NSS     +L N  +L G      +N + G++   S+LDRE  ++    +   D    TPL   ++ AT+ + + D+NDNPP F    +   +       ++ STG+  F V  TD D     Q  Y      S  F +D I G I   + L     S + FTV   D G      + ++TV  V   + P+     +     E     TI  K   +   AG   +  +    N  + F +  L G L++  PL    I  Y L IE  D  +G   +   ++V I V+DVN+N P+F Q  +    +   +    ++  V A D+D G NG + Y I+     D      F I +    G+I     L +   A+++  V A D G+P  S    V ++++D+NDN P F+   S    + P+ +    T+T +T    TD+D+G N   R+++   +     F I P +G+++  R  +RE  D Y  +V A+D G  ++++ V I V  ++ +      PS Y           L +  ++       +IG++ T   A D D G+N  I Y     T  F ++  SG +F IK+  R    +    +            HSF+      G  P   SE  V++ ++D NDNPP F  P+    + K     ++++ ++ Y
Sbjct: 1318 VASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIF---LVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNL------FELTIKATDQAVPAEF---RRFALKNVTIWVTDQNDNIPTF---ISQNALVAESN----IVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRY---------------SGDIRLASQLIPSKL-IYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNVISLDASSPRGAGT--KVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAE-------LDREQGSDLYLLDVYAIETDAKQPRTQHAEVSFLFDF----------FFKVMLLLK------GNLREHISQTCAEGANALVTYAIISGAD------DSFRIDPESGELSATRRLDRER--RSKYSLLVRADDGQQSSDI---WVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSG--VNGEITYSVEEDDEDSTF---LLNPITGVF---NVTRALDFETQPFFILTVRAADGGG--RSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHG---------------NSS-----TLLNSVHLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPL---SSSATVSVVVADINDNPPRFHHHPYVTHI------PASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAG--PLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARD--QGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLV--VSALDQDSGPNGQLEYAII-----DGNKENSFNINRAT--GEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFS---ATVPENAPVGFTVTRVT---TTDEDAGANAISRYSITDASLP---FIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGW-TVSTDVTIFVTDINDNAPRFSKPSYY-----------LDYPELT-------EIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIF-IKQQLRYQNSSGHNNINV--------NRHSFIVTASDRGIKPL-MSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAY 2561          

HSP 9 Score: 244.973 bits (624), Expect = 3.346e-64
Identity = 288/951 (30.28%), Postives = 432/951 (45.43%), Query Frame = 2
Query: 1517 LDYEQIKSINVSIKGL-QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IK---KYPNAR----LQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYF--VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIE---IMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN--NCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLD-SMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAV 4267
            LDYE I+   + I+   Q  P    P  +Y  V IA+LDVNDN P+F    +   I EN SP   L  VV+A D+DSG  G++ Y++ D  K+  F I+ +TG I T          LDRE   +  +   ATD G     T V +++   D+NDN P F  + + A + EN+    F   RV  TD+D   AN    Y   + S+        F I+ STGD+TI  P++RE   + I +  V A+D   +   D   + I V D+NDNAP F   ++ ++ P+     + +  ++ATD DE    +    +  I   +  F +    N  +G I IK   +Y N+     + V  H+F V ASDRG  PL +   ++INV + ND PP F    +     +++ +G  + +V A D         F + + I    S G       N +N   L++  G V V S L  +       +I   DK      PP +   T++I + + N + P F  +    ++ E     + I T +     K  D  + G + Y      D  L F V S +G + L K LD ET       VS +DG ++  +   TV+I V DVNDN P F  V+Y  V  + E    GT   K  A D D+G NA++ +   ++ S  F +  + G +T    L       Y L ++   + D  R +  +     V I +   N   P F    Y F  I+E    GT++GEV A+D+D GE+G V Y I  +     F         +N K GQI V+ SL +    + +  V A + G  R ++     V +T++D ND  P FT     V  + G SP          L+T +SA D DS +    RF    + N +   F I+P +G +S     DRET  +Y   +LA D G+P+ T + 
Sbjct: 2180 LDYENIEKYVLWIEARDQGFP----PYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVL--VVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTT-------RPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENA-PVGFTVTRVTTTDEDAG-ANAISRYSITDASL-------PFIIHPSTGDITISRPLNREDTDHYIAK--VSAHDSGWTVSTD---VTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGK---IFYFIRSQTEYFRI----NSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKD------FGLNSEIEYAISGG-------NSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGN----PPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSA--RDKDKDKQMNGLITYNISSGNDDGL-FSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPV--VQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAY-----VNIQLKGANEYVPRFVSKQYYFE-ISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGF--------SINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQVNEGLSPG--------GLVTFVSAEDSDS-VPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSA 3049          

HSP 10 Score: 233.417 bits (594), Expect = 9.278e-61
Identity = 290/1096 (26.46%), Postives = 491/1096 (44.80%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAY--HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANA--QYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGV----VTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAI-------YTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCD-LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF--PNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGEN-GNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPV 3994
            +L++  PLDYE      L ++A+D  +  + +     I V+DV D  P+F+   + + + E L     V+ V+A+D D      ++Y++ DGN  N  F IN  +GEI     +DRE          + L V AT+   P    S+   V I +LD+NDN+  F + ++  +V EN+  G  +   + +   D+D  ANA  +Y+++       S  F ++P       I + R  N    D+  I  ++    G  ++           DV+I + D+NDN P F   SY    + + P  T IG     V+ATD D G  GKI Y +    + F I+SS+G I       Y N + + +  +       R   +  A+D G   LM+ TTV+I + D NDNPP FE   Y   + + S       ++V A DK     N+ I Y    +S G  N  + F+++  TG VT+ + +  +   N +  L + A D  N  + D   ++I V + N + P F  N  +V V + ++  T I  L+A D D+       ITY +  G D   F V +    +TG + + K  +   + + H   V A+D G+   ++ V + I VT++ND PPVF    +     EN+  G  + ++NATD D+  + L  ++IQ++                 ++L  ++   GI+  Q  LD E          +  KA   P   + +FA + I++   N+  P F +  + F + E   PK     G     V A+D D+   G + YL F  S    F ++  +GQI++  +LDRE    ++  V   +     G  +    V+ITVLD ND  P F   +  + ++E    G +     A DSD+  +     Y    N+  + F ++   G +++ + L    +  Y L I  +D+  G+     S  + + + D+N+N P     + E   + E    GT +  + + D D   N G  +Y ++       +         ++  G++  +  + +   + F   V   D+G+P++S+  TV + + D NDN PS +  V
Sbjct: 2173 ELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENL-SPQRVLVVSALDQDSGPNGQLEYAIIDGNKENS-FNINRATGEIRTTRPLDREK------VAQYSLRVKATDRGMPP--KSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTV---TRVTTTDEDAGANAISRYSIT-----DASLPFIIHPSTG---DITISRPLNREDTDH-YIAKVSAHDSGWTVS----------TDVTIFVTDINDNAPRFSKPSY----YLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINV------NRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTK-SVKVGTRLLKVTAYDKKDFGLNSEIEYA---ISGG--NSSNKFRLDKQTGSVTVASSLAADT--NKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHS----QTGVLSLAKTLDYETKQK-HELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD----------------SDLFIIDPNTGIITTQGFLDYEAKQVY----HLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISE-AAPK-----GTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDS--GSPAATGSAILIVTLEDINDNGPTLVTTYGE---VMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYF-------TISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDN-PSESRSV 3172          

HSP 11 Score: 229.18 bits (583), Expect = 2.284e-59
Identity = 295/1121 (26.32%), Postives = 480/1121 (42.82%), Query Frame = 2
Query:  977 TMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT-FGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV------DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSC---SDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLI-TPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEV--GIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKD-FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGL---NGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            T  E  P +T    VT + G      P+ Y +  GN  +  F I++ SGE+ I   +D E+          +  V+  E     F   S+   V I +LD+NDN   F+Q  +   + EN      +++ +     D+D   N Q   + +  NK +S         +N+A   IR      LD E++   ++ +K          P+ +   V I++LDVNDN P F +  ++  + EN+P    +  VT TD+D+G      YS+ D    F+I  STG I       T    L+RE  +       A D G  ++ T V I + D+NDN P    RF +   + +    T  G +  +V ATD D +  N +I Y   + +       + F+IN+S+G++ I   +          I  +    +V A D     +     + I V D NDN P F   ++   V +++   T +L + A D  +     S+I Y + G +S N   +   + +TG++      A    +V+   + ASD+G PPLS R  + I VTE N   P F+Q+  + +  E L +G  I  ++A D D +  +   I  N I++ N  G     LF+V +     QTG ++ +   LD E       ++   D         +T++ T+ I++ DVNDNPP+F    + F + ++     N+ +G T   + ATD D        Y     D  L F +D  +G I     LD E     + TV      D      + V+I +   N+  P FV       ISE    GT+  +  A+D D GE+ VV +Y     S   G S++     I    ++      K+ ++++    G+I      EV   I V+D N+  P+F+Q  Y+   + E  + G ++  V A D D        +Y I    + + F +           GQ+ V S L +     +   + AVD+G P  + +  + VT+ DINDN P+                + EN      +++ + +D  L    G   ++L S      +F ISP +G L+  R  DRE    +   VL  D G P ++S
Sbjct: 2128 TFPENQPTNT---IVTKVTGSSPRAGPLSYYIASGN-LDNAFHIDQLSGELSIRKPLDYEN---------IEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSAL----DQDSGPNGQLEYAIIDGNKENSF-------NINRATGEIRTTRP--LDREKVAQYSLRVKATDRG---MPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDI-------TISRPLNREDTDHYIAKVSAHDSGWTVS-TDVTIFVTDINDNAP----RFSKPSYYLDYPELTEIGSIVTQVSATDPD-EGFNGKIFYFIRSQT-------EYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGL-NSEIEYAISGGNSSN---KFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYN-ISSGNDDG-----LFSVHS-----QTG-VLSLAKTLDYETKQKHELRVSATDGG----WIAKTSYVTVNIQVTDVNDNPPVFDPVEY-FPVVQE-----NVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDL-FIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVV-YYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQ-VNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTIN-------PQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYG---------EVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISP-TGELTTSREVDREQISDFYLSVLIKDSGIPQMSS 3151          

HSP 12 Score: 225.713 bits (574), Expect = 2.319e-58
Identity = 356/1382 (25.76%), Postives = 565/1382 (40.88%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDR----SLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVR---VKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQV-------IDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKP-KSNISTGATGFYVKATDVDIVGTLQYLYF-----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL----SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVA---VTIIDINDNYPSFTNPVSPSNGSSPQ--FSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEG--PLTFTS-----ISNSSLSGFKIGNVATAVDRD-IGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIV-SQNALTY 4819
            +T  LD+E  P   L ++A D     S    +  ++DV D PP+F +S Y++++ E L     V+TV+A D D     +L + V  S  DG      F+IN ++G II + ++DRE++        + L V+A++       SS   V + + DINDN   F    Y   +  ++  G  +     + V D+D  +N+Q + S    N  S  F++ PI     AI       GS    E   +++V   G         P+     V++  +   D  P        F   EN P  T++  VT +   +G     I S N     F ID  +G +            LD E  E+  +   A D G         V I + D+NDN P+FE   + A + EN       P R   V A D+D    N ++ Y   +      N  ++F IN +TG++    P+DREK+      L V A D           + I V DVNDNAP F    FS  VP+N     T+  +  TD D      + I+   I   S+ FI+    +P TG I    P  R     +   V A D G+  +ST V I   VT+IND  P F++  +     E  +IG  + QV+ATDPD   N  + YFI                     T    +N + G ++++  L   +Y   +G   +       I  A++  + P  +  T+ I ++D NDNPP F++  +       F P   ++  G     V A D    G    + +     + S  F +D  +G + +  +L  +T       ++ SD         +TV I V + N + P F      + +SE   VGT      A D D  +    +  +  +S +  GL    S  G L+L   L       ++L +   D   G I       V I V DVN+N P+F  V Y F  + E    GT + ++ ATDKD G N  ++Y ++   D+D+FI        ++    I+      +  A+  + +      VP     C+ A   + +   N+  P F          S Q  F I E     T++  + A+D+D G +G + + L         F I+  +G +    S DRE ++    +VLA + G+       +I+                 +L+N ++ +   P  FT        N  LS   +    +A D D +   +   Y    +     F ++P +G +    E DRET   Y+ T+ AV             SG SP     A ++V + DINDN P  T+ T  G +++     + ++ +S    D D+  +Q   TY
Sbjct: 1869 VTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHLSGGDGQ-----FSINPSTGLIITSSLLDRETR------ASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFA---VTVTDEDSGSNSQLHYSLTGRN--SEKFKIDPIRG---AITASEKLTGS---SEVTFTVHVKDGGTN-------PKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLD-NAFHIDQLSGELSIR-------KPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILEN-----LSPQRVLVVSALDQDSG-PNGQLEYAIIDG-----NKENSFNINRATGEIRTTRPLDREKVAQ--YSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAG---ANAISRYSITDASLPFII----HPSTGDITISRPLNREDTDHYIAKVSAHDSGW-TVSTDVTIF--VTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQ------------------TEYFRINSSSGEIFIKQQL---RYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSY-------FTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDG--GWIAKTSYVTVNIQVTDVNDNPPVFDPVEY-FPVVQENVPSGTTVVKMNATDKDSGSNALMAY-VIQSSDSDLFI--------IDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPD-EERCSFAYVNIQLKGANEYVPRFV---------SKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYY-LIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS---IRGADIDE----------------VLVNITVLDANDPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVD------------SG-SPAATGSAILIVTLEDINDNGP--TLVTTYGEVMENQRAGTPVMTLSSR--DPDLAPNQGPFTY 3101          

HSP 13 Score: 166.777 bits (421), Expect = 1.679e-40
Identity = 224/847 (26.45%), Postives = 359/847 (42.38%), Query Frame = 2
Query:  857 IQLQLQAQDSAYHVSINF----------------------TFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDG-DRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAI-IIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE--QIKSINVS-IKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTDYTLLDREAYE--RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVF-LVNSTVSI 3295
            I+ QL+ Q+S+ H +IN                         I V+D  D PP F++ SY + + + + V T ++ VTA D  D  L S ++Y++  GN  N+ F +++ +G + +A  +  ++  +      + L + A++   P L  S RT V+I + + N ++  F Q     +V E    G AI  + +    +DK +N    YN+S+  ++   S+     ++++ K            LDYE  Q   + VS   G  IA      + SY  V+I + DVNDN P+F    Y  ++ EN P+ T +  + ATDKDSG    + Y +       F+ID +TG I T          LD EA +   L V A         +   V I LK  N+  P F  + Y    FE S     G V   V A+D+D+   +  + Y  +  S         F IN  TG + +   +DREK     L++L         +  D  ++ I V D ND  PVF    + V V + +S    + F++A D+D S    S  TY +      N       NP+TG +       R  V V+N T+ A D G P  +   I+++ + +IND  P    +       EN   G  +  +++ DPD   +   F       ++ S+G   +S F ++         G +     +DRE+ S     + + D      +P  ++  T+ I++ D NDNP   ++       F +  P      G +   VK  D DI  T Q     P  +      +G   LI    R T    + +V  +DGV   VNS V +
Sbjct: 2482 IKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNK-FRLDKQTGSVTVASSLAADTNKV------YLLEITASDKGNPPL--SDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKT-----------LDYETKQKHELRVSATDGGWIA------KTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQ-------GFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQY---YFEISEAAPKGTVVGEVFASDRDLG-EDGVVYYLIFGRSRK-----RGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSD-SVPSWSRFTYAIAANHERNTFT---INPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGEV--MENQRAGTPVMTLSSRDPDLAPNQGPFTY-----SLVSTGA-ASSYFTISPT-------GELTTSREVDREQISDFYLSVLIKDSG----IPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFP------GGSLGVVKPQDPDIQDTFQ-CSLTPPAALLFSIPTGTCDLISN-SRSTDGTFDLSVRSNDGVHSAVNSHVRV 3254          
BLAST of Cadherin-23 vs. Ensembl Zebrafish
Match: LO018022.1 (FAT atypical cadherin 4 [Source:NCBI gene;Acc:101882648])

HSP 1 Score: 356.295 bits (913), Expect = 2.731e-98
Identity = 390/1370 (28.47%), Postives = 621/1370 (45.33%), Query Frame = 2
Query:  794 GYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQV----IDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSA-----NFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLN-ANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIK----GLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNST--VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKV-NDKGQILVNSSLKNLGAR-FTFIVNAVDNGVPR-LSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIF--TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDI 4795
            G  +   L  T  LD E  P  QL +Q +D        F ++QV     D+ D PP F +  Y +++ E+  V + V+ + A D D    + + Y L +G PF     I+  +G ++I   +D E++        + LT+ A +   PSL+  +RT   +++LD+NDN        F       SV EN+Q G  + +   + V D D + AN   ++S +  N+    F+V+     N ++    +K  S LD E+I S N+++     G  +A        S+A + I + D+ND+ PIF  + Y   I E+ P  + I  V+ATD DSG    + YSL   +    F I  ++G +       T    L+RE    + +   A D G    ++ T +I+ + D+ND  P F    Y   + E+S   +   V + ATD D+   N  I + F   S  P +  + F++++++G ++  T +DRE+  + +L   + A D     +   C + I ++DVNDN+PVF    +  N+ +N  + +++  + A+D D        + Y +   DS  F + +     +G +       R +   +   V A+D G     T  I+ + V +  D P VF Q  +SF  +EN+ +G  IG V+AT  D + ++ Y I         +SG    SLF +          G +    ++DRE+ +    Q++VI +A E      T    + I + D+NDN P F  S+   S  E      N +TG   F  KA+D D    G + Y L  +P   F++    G I L   L+  T S+    V  SD GV    S+  ++I+V DVNDN P F      + I E   V + F +  A D D+G N  +++     N+   FG+  DG L +   L       Y L++   D  R       S  V I + D+N+N P+F+   Y F    E    G ++G V A DKDFG N  V Y      +T     +L  I  V     Q+   S ++  GA  F+F V + D G+P+ L +   V V I DINDN P FT  +        Q SI E+   +T +  +SA+D D   NG + +++   N + + F I   SG ++ +   D ET   Y  +++A D G+  L+S   + + VLD +DN P FP + L ++                 L   +IG +    TA D D G NA I Y    T +   F + P +G +F +K+ D ET+  Y   V A    +             P   S   V++ + D NDNPPVFT   I   I +    ++ ++ I+ + TD DI
Sbjct:  181 GEGAFLHLVSTGGLDRETTPFYQLLIQVEDKGE--PKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLLDEGTPFQ----IDPKAGTVVIKEGLDYETKR------EYSLTIHAVDNGVPSLY--TRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVAL---LTVSDSDSSTANGNISVSILGGNEQRH-FDVHSSPVPNLSL----IKVASVLDRERISSYNLTVSVSDNGKPLA------RSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLGWFAISENSGLV-------TSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGS-ELVVLSATDSDLG-PNGTIRFSF--DSETPVSDQNKFRLDSTSGRLSTSTELDREEESSYLL--YIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGR--NGTVKYAITAGDSSKFHISST----SGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTNITYLI---------ASG-DQRSLFGI--------KAGQITALGLIDREEQAFY--QLRVIARAGEV-----TGETLVNITVKDLNDNAPNFMHSVEHVSAVE------NWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEV-TTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKD--RAVESLSASVNVSILLDDINDNRPLFNSTNYVFH-FEEEQERGALVGRVFAEDKDFGPNSEVRYSF----ETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIY-------QASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQ-FSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDV----------------LENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSLYKLNVTAKDSGR-------------PSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADI 1427          

HSP 2 Score: 285.804 bits (730), Expect = 1.003e-76
Identity = 351/1268 (27.68%), Postives = 566/1268 (44.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAY---HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAIL---VIRVKNGSFLDYEQIKSINVSIKGLQI-APVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN-DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVE--ASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDRE---KYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSN------LNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYEN--TITLITIISATDKDSGLNGEIRFN--LDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSG 4513
            LD ER     L +   D+       S     I V D+ D PPIFQ + Y   ++E++P  +++  V+A DGD    + ++YSL  GN    +FAI+E SG +  A  ++RE+          +++       P +   S T + + I D+ND    F Q  Y  S+ E+S AG  +++   +   D DL  N     S  ++++T       P+   NK  L     R+   + LD E+  S  + I+     AP    P  S   V+I + DVNDN+P+F    Y   I EN P+ + +  VTA+D D G  G + Y++      KF I S++G + T V        LDRE      +   ATDGGGL + T  I+ +   D  DNP +F  + Y   +FEN      G +    +   VD+  N      Y ++ G    L  F I A  G +T +  +DRE+      QL V+A       +    ++ I V+D+NDNAP F  +   V+  +N +T   I    A+D DE+      I Y L       F +      K G I    P   L+V   ++ +E  ASD G P  ++ + + I+V ++ND  PVF Q  +  +  E+  +     +V ATD D+  N ++ Y II                  N  ++ G+   G + Y+++ LDRE   +YS L   +   D+A E+     +A   + I + D+NDN P+F ++ + F  FE+ + +     GA    V A D D      ++Y +  P  +F +++I+G +     LDRE++         +FTV  SD          + V + + D+NDN P F   I   +I+E  Q  T   +  A+D D  +N +V +     N    F + S  G +TL+  L       Y L I   D+  G++    +  + I V+D N+N P F +       + E   IG ++  V ATD D G N +++Y I    +   F +      +F ++K++ + Q L           +   V A D+G P  S++  V + + D NDN P FT    P +      SI EN    T +  I+A D D+ +NG + ++  L +  G H  F I  +SG +   +  DRE  +L++  + A D   P+      ++ + + + D     P+ ++  N  + E  +   SI  + L          A D D G N  + Y +  GD+  F +D +SG
Sbjct:  411 LDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQNANLRYSLVSGNSLG-WFAISENSGLVTSAAELNRETASEI----VLNISAKDQGLQPKI---SYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVV---LSATDSDLGPNGTIRFS--FDSET-------PVSDQNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGAP----PLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLV-------ALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFEN---VPVGTIIGTVSATTVDLHTNIT----YLIASGDQRSL--FGIKA--GQITALGLIDREE--QAFYQLRVIA---RAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGM--IVYSLKQNPKGLFHIHE----KHGLISLTGP---LEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISG----------------NTRDVFGIFPDGQL-YIKADLDREVQDRYSLL---VVAKDRAVES----LSASVNVSILLDDINDNRPLFNSTNYVFH-FEEEQER-----GALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAEDS--GSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVD-VLENMRIGELVASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIFLVKKLDYETQSL-----------YKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFT----PGDIFK---SIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGH--FRIDSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEFRRFALKNVTIWVTDQNDNIPT-FISQNALVAESNIVIGSILTTVL----------AFDPDEGANGEVEYELVRGDSDTFIMDRYSG 1558          

HSP 3 Score: 266.544 bits (680), Expect = 9.149e-71
Identity = 357/1356 (26.33%), Postives = 598/1356 (44.10%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRS--PVQYSLKDGNPFNEY---FAINETSGEIIIAMI----IDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQ--IAPVFNIPEDSYADVSIAILDVNDNTPI-----FGNSSYTFMIFENSPNFTLIGVVTATDKDSGIF-GKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLM---NMTTVIIILKDLNDNPPIFEVRFYQAWLFEN--SYNFTFGPVRVKATDKDVDV-ANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDAD-----------ESNTPQSDI-TYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSF--TNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRET------KDLYKFRVLANDLGTPS-LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFT--GDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDI--SKYVTDKDIVSQNALTYWI 4825
            I V+D+ D  P+F ++S   +  E+      VI  TA D D          Y +  GN   ++     +N +     + ++    +DRE+        F+ L + +  +  P  F   +  V IQ  DINDN  +FD   YQ SV+E++  G +++   +I   D D  ANA+      Y     + F++ P     KA  V+ +K G  LDYE  +  +++I  +   +  ++     +  + ++ +LDVNDN P+     F  +S    + EN+   T++ ++T +D DS    G I  S+   +  + F + SS      N++     ++LDRE      +    +D G  +   +  +++I + D+ND+PPIF+   Y+  + E+    ++  G   V ATD D    AN R     Y++  G  N L  F I+ ++G VT    ++RE     +L   + A D           + + + DVND  P F  NT+ V++ ++    + ++ L+ATD+D           +S TP SD   +RL   DS            +G +       R +   +   + A+D G PPL +   + I + ++ND  PVF    +  +  EN   G ++  V A+DPD   +     ++  I A +SS   ++S            T G V     LDRE+ +    Q+   D        P    A + + ++D  DNP +F    + F +FE      N+  G     V AT VD+   + YL             +GQI  +  +DRE  +     V    G     + V+ITV D+NDN P F+  ++ ++  E    G    +  A+D D   N ++++    N    F +    G ++L  PL +    Y    +E++ +  G      S  + I V DVN+N P+F Q+ YE + I E   + +    V ATDKD G NG + Y I+     DVF         +   GQ+ + + L + +  R++ +V A D  V  LS +  V++ + DINDN P F  TN V         F   +    L+  + A DKD G N E+R++ ++   +   F ++ I+G L++    DRE+        ++ F VL++D G P  L     ++V + D++DN P F  +       IY+      SI+ S+ +  ++  V +A D D   N L+ Y  T   +   F +D  SG +  + + D ET  +YS  + A              SG  P + S   + + +LD NDN P F   T+   +++    N +I ++  S   TD D  S   +TY I
Sbjct:  109 IVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDTATDADIGSNGVDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHLVSTGGLDRETTP------FYQLLIQVEDKGEPKKFGYLQVNVTIQ--DINDNPPSFDHEQYQTSVFEDAAVGSSVL---QIAASDLDEGANAEI----TYLLDEGTPFQIDP-----KAGTVV-IKEG--LDYETKREYSLTIHAVDNGVPSLY-----TRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVALLTVSDSDSSTANGNISVSILGGNEQRHFDVHSSP---VPNLSLIKVASVLDRERISSYNLTVSVSDNGKPLARSSFASLVIFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKG---VSATDGDSGQNANLR-----YSLVSG--NSLGWFAISENSGLVTSAAELNRETASEIVLN--ISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPNGTIRFSFDSETPVSDQNKFRL---DST-----------SGRLSTSTELDREEESSYLLYIRATDSGAPPLHSVCKVNITLKDVNDNSPVFYPMQYFANIKENEPSGSSVTTVTASDPDLGRN---GTVKYAITAGDSSKFHISS------------TSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTP----AIVTVTVVDTQDNPLVFGQKDYSFVMFE------NVPVGTIIGTVSATTVDLHTNITYLIASGDQRSLFGIKAGQITALGLIDREEQAFYQLRVIARAGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQNPKGLFHIHEKHGLISLTGPLEVTTSSYQ---LEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFDQLSYEVT-ILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGNTRDVF--------GIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVF-------HFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSN---FELNAITGVLTSTLQLDRESLMRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKD-------IYQA-----SIAESAQNMTQLLRV-SASDVDENKNGLVHYDITEGNEEKQFSIDSNSGQVTLVGKLDYETTPSYSLKIIAED------------SGSVPLS-STCVLSISVLDDNDNSPSFPKSTLSVDVLE----NMRIGELVASVTATDSDSGSNADITYSI 1330          

HSP 4 Score: 261.151 bits (666), Expect = 3.458e-69
Identity = 332/1217 (27.28%), Postives = 531/1217 (43.63%), Query Frame = 2
Query: 1013 ITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSG----IFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG---LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDI-LQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTL--QYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIY---------GIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATD-KDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISA--TDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF-TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRA 4579
            I+ T  +G  +L   V Y++  G   ++ F I+  SGE+     +DRE +        + L V A +       SS  +V I + DIND++  F + +Y   + E+   G  +   + I+  D D   N +   S V  +   S F + PI  +      +  +   F     I ++  +  G + + V          V   +LDVND+ P+F +S YT  I E+      +  V+A D+D G    +   + YSL+    +F I+ STG I T+       +LLDRE      ++ +A+DGG    L +  TV +++ D+NDNPP F    +  ++     + + G +    T  D D  +N  L+  Y+++       + FKI+   G +T       EK+     +   V   D   +   D+  + +      D  P   L   +   P+N  TNT +     T    S+     ++Y +   +  N F ++ +    +G +  + P     +  +   +EA D+G+PP S    + I V ++ND  PVF Q  F     ENL     +  V+A D D+  N  L Y II                  N  N   +N+  G +     LDREK +  + +++  D+     +PP++    + I +LDVNDN P F + +F  ++ E      N   G T   V  TD D       +Y   D SL F +   +G I + + L+RE   +    VS  D  + V++ V+I V D+NDN P F      L+  E+T++G+I  +  A D D G N   IFYF  + +  F ++       I     Y          +  +  I+   D  RG         V I V+D N+N P F    Y F+P+T+   +GT + +V A D KDFG N  + Y I     ++      FR+ K    G + V SSL  +    +   + A D G P LS+  TV + + + N + P F+      N  +   S      T I  +SA   DKD  +NG I +N+ S N D   F +   +G LS  ++ D ETK  ++ RV A D G  + TS V + + V D++DN PVF P  Y             F  +  +  SG  +  +  A D+D G NAL+ Y+  + D+ +F +DP +G +      D E K  Y  TV+A
Sbjct: 1724 ISQTCAEGANAL---VTYAIISG--ADDSFRIDPESGELSATRRLDRERRSK------YSLLVRADDGQ----QSSDIWVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIV---AAILASDGDSGVNGEITYS-VEEDDEDSTFLLNPITGVFNVTRALDFETQPFF----ILTVRAADGGGRSSSV---------RVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGGDGQFSINPSTGLIITS-------SLLDRETRASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFH---HHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLH--YSLTG---RNSEKFKIDPIRGAITA-----SEKLTGSSEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGD-FPHIKLKDKAFTFPENQPTNTIV-----TKVTGSSPRAGPLSYYIASGNLDNAFHIDQL----SGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSGPNGQLEYAIIDG----------------NKENSFNINRATGEIRTTRPLDREKVAQYSLRVKATDRG----MPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPE------NAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGWTVSTDVTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNG-KIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASD--RGIKPLMSETTVMINVVDSNDNPPTFESPSY-FTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSN-----KFRLDK--QTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQ-----NQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGN-DDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEY-------------FPVVQENVPSGTTVVKM-NATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKA 2819          

HSP 5 Score: 254.988 bits (650), Expect = 2.479e-67
Identity = 349/1323 (26.38%), Postives = 564/1323 (42.63%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL--QIAPVFNI---------PED-SYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQ-----AWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAST----GDVTIVTPVDREKIPNDILQLLVVAYD---PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-------TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYW 4822
            EE PV T+V T+         +    Y   + +   + F+IN T+G I  + +IDRE      V     + V+   + P+      T VRI +LDINDN+  F       S  E++ +G  +I+ +     D D+ +N         ++ T  I            I V     G+FL         VS  GL  +  P + +         P+   Y  V++ I D+NDN P F +  Y   +FE++   + +  + A+D D G   +I Y L D    F ID   G +            LD E      +   A D G   L   T   + L D+NDN P+ + R++      A + EN+   T   + +  +D D   AN  I     ++S+   N   +F +++S       + + + +DRE+I +    L V   D   P   S F + +  I V D+ND+ P+F    + V++ ++I   + I  ++ATD D      +++ Y L+  +S+ +      +  +G +       R         + A D+G  P  +   +++N+T++ND+ P FTQ+ +  S  E+   G  +  ++ATD D   +        TI     S  PV+      N   L+ T G +   + LDRE+ S+    I+  D  A    PP  +   + I + DVNDN P+F    +    F +   K N  +G++   V A+D D+   GT++Y +    S  F++ S SG++  + ALDRE  +     V+ +DG  L + T   V++TV+D  DN   F        + E   VGTI     A   D   N +       +  S FG+   G +T +  +      +Y+L +                 V I V D+N+N P F       S +  +   G  I +  A+D D   NG + Y +            LF I + +  G I +   L+   + +   V A D GVP+ +++  + +++ D+NDN P F            Q S YE TI       +    + ATDKDSG+NGEI +++ S N   + F I P  G L      DRE +D Y   V+A D    SL+++VN+ +L+ D++DN P+F S   + +F                  G  +G V  A D+D G N+ + Y F      F L+  +G L    + DRE+            M Q G    SF       G       +A+V V I DINDNPP FT       I + A   +Q++ +S    D++   +N L ++
Sbjct:   39 EEQPVGTYVGTIET-------KPAFTYRFSEQH---KLFSINATTGVIYTSSVIDRE------VLPGNIINVVVLSSQPTY----PTEVRIVVLDINDNAPVFPDASIVVSFKEDASSGRQVILDT---ATDADIGSNG-------VDHTTYRIISGNDQRKFRLDITVNPSGEGAFLHL-------VSTGGLDRETTPFYQLLIQVEDKGEPKKFGYLQVNVTIQDINDNPPSFDHEQYQTSVFEDAAVGSSVLQIAASDLDEGANAEITYLL-DEGTPFQIDPKAGTVVIKEG-------LDYETKREYSLTIHAVDNGVPSLYTRTEATVKLLDVNDNDPVVKFRYFPTTSKFASVDENAQVGTVVAL-LTVSDSDSSTANGNI-----SVSILGGNEQRHFDVHSSPVPNLSLIKVASVLDRERISS--YNLTVSVSDNGKPLARSSFASLV--IFVNDINDHPPIFQEAVYRVDISEDIPKGSYIKGVSATDGDSGQ--NANLRYSLVSGNSLGWF---AISENSGLVTSAAELNRETASEIVLNISAKDQGLQPKISYTKLIVNITDVNDQVPTFTQNTYHVSITEHSPAGSELVVLSATDSDLGPN-------GTIRFSFDSETPVSD----QNKFRLDSTSGRLSTSTELDREEESSYLLYIRATDSGA----PPLHSVCKVNITLKDVNDNSPVF----YPMQYFANI--KENEPSGSSVTTVTASDPDLGRNGTVKYAITAGDSSKFHISSTSGKVTTLVALDREEKTAYQLQVTATDGGGLRSHTPAIVTVTVVDTQDNPLVFGQKDYSFVMFENVPVGTIIGTVSATTVDLHTN-ITYLIASGDQRSLFGIKA-GQITALGLIDREEQAFYQLRVIARAG-----EVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWAT-GHHIFQAKASDPDEATNGMIVYSLKQNPKG------LFHIHEKH--GLISLTGPLEVTTSSYQLEVVASDLGVPQRTSSLFLTISVYDVNDNAPVFD-----------QLS-YEVTILESEPVNSRFFRVEATDKDSGVNGEIVYDIISGN-TRDVFGIFP-DGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASVNVSILLDDINDNRPLFNSTNYVFHF------------EEEQERGALVGRVF-AEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESL-----------MRQRGAAVFSFTVLSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMTQLLRVSASDVDEN---KNGLVHY 1223          

HSP 6 Score: 248.44 bits (633), Expect = 2.683e-65
Identity = 366/1373 (26.66%), Postives = 600/1373 (43.70%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMN-KAILVIRVKNGSFL----DYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG---GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI--IKK--YPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNA--TDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNL--NFTVSCSD-GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEI---MDNPRGTIHFKKSKEVGIYVIDVNNNFPI--FSQVFYEFS-----PITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIV----YIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTY 4819
            Q+T    +D E     QL++ A+ +          I V D+ D  P F +S    +  E      H+    A D D +    + YSLK  NP    F I+E  G I +   ++  +         + L V+A++       SS  F+ I + D+NDN+  FDQ  Y+ ++ E+            +   DKD   N +     +  N T  +F ++P   +  KA L   V++   L        ++S++ S+                 +VSI + D+NDN P+F +++Y F   E      L+G V A DKD G   ++ YS   P   F +++ TG + + +  + +  +  R A    F V +++D G    L +   V + ++D+NDNPP F    YQA + E++ N T   +RV A+  DVD   N +++  Y+++ G  N    F I++++G VT+V  +D E  P+    L ++A D  +  +  TC++ I V D NDN+P F  +T SV+V +N+     +  + ATD+D  +   +DITY    + + N       +P TG+I  +KK  Y    L    +   V A D G P  S+ + ++I+V + ND PPVFT      S  ENL I  ++  + A  TD D N  L Y I   T         P    F +      +   G++Y    +DRE  +     I+  D+A       + A   + I + D NDN P F   + Q +L  +    SNI  G+    V A D D    G ++Y L    S +F +D  SG I L   L     S L  +  VS +D G    +S   +T++    + P F     +  + E    GT      A+        V  F     S    G    G L        + I  +  +I+    +D  +G+  +     + +Y I+ +   P    ++V + F       +    N+   I +  A     G N  V+Y I+   D        FRI    + G++     L +   ++++ +V A D    + S++  V +T+ DIND+ P+F+  V         F I E+    +++  I A+D DSG+NGEI ++++  + D   F ++PI+G  +  R+ D ET+  +   V A D G  S +  V   +L ++          +  L N S+Y      TSI  S  +G  +  V +A DRD G ++ ++    Y  +G    F ++P +G +      DRET+ +Y   V A       DG        +P + S A V V++ DINDNPP F     +  I    +  S +  ++  VTD+D  S + L Y
Sbjct:  823 QITALGLIDREEQAFYQLRVIAR-AGEVTGETLVNITVKDLNDNAPNFMHSVEHVSAVENWATGHHIFQAKASDPDEATNGMIVYSLKQ-NP-KGLFHIHEKHGLISLTGPLEVTTSS-------YQLEVVASDLGVPQRTSS-LFLTISVYDVNDNAPVFDQLSYEVTILESEPVNSRFF---RVEATDKDSGVNGEIVYDIISGN-TRDVFGIFPDGQLYIKADLDREVQDRYSLLVVAKDRAVESLSASV-----------------NVSILLDDINDNRPLFNSTNYVFHFEEEQERGALVGRVFAEDKDFGPNSEVRYSFETPQSNFELNAITGVLTSTLQLDRESLMRQRGAAVFSFTV-LSSDQGLPKPLKDQAKVQVYIQDINDNPPKFTKDIYQASIAESAQNMT-QLLRVSAS--DVDENKNGLVH--YDITEG--NEEKQFSIDSNSGQVTLVGKLDYETTPS--YSLKIIAEDSGSVPLSSTCVLSISVLDDNDNSPSFPKSTLSVDVLENMRIGELVASVTATDSDSGS--NADITY---SISATNNHGTFSISPNTGSIFLVKKLDYETQSL----YKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQT---------PRGGHFRI------DSVSGVIYTNKDIDREFSNLFELTIKATDQAVPAEF-RRFALKNVTIWVTDQNDNIPTF---ISQNALVAE----SNIVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRYSGDIRLASQL---IPSKLIYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNVISLDASSPRGAGTKVEYFIVSVRS----GGKAAGRL--------FTIGRHSGVIQTAAELDREQGSDLYL----LDVYAIETDAKQPRTQHAEVSFLFDFFFKVMLLLKGNLREHISQTCAE----GANALVTYAIISGADDS------FRIDP--ESGELSATRRLDRERRSKYSLLVRADDG---QQSSDIWVNITVSDINDHTPTFSRSVY-------SFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDED-STFLLNPITGVFNVTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVN---------DHPPLFNSSVYT-----TSILESLSAGASVLTV-SAADRDHGNSSTLLNSVHYSLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVA------SDGGQP-----TPLS-SSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVT--VTDEDSGSNSQLHY 2050          

HSP 7 Score: 244.973 bits (624), Expect = 3.206e-64
Identity = 357/1401 (25.48%), Postives = 590/1401 (42.11%), Query Frame = 2
Query:  692 ICNLTITSVTSGSISDFNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAY--HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTF----VRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGS---EIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFT-LIGVVTATDKDSGIFGKIIY---SLNDPFKK----FVIDSSTGAIYTNVNANTDYTLLDREAYERLF---VVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNF---TVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY---FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITVLDVNDNE-PYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVAT---AVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKY 4777
            + ++T T   SGS +D   +  + N +   S+S    S+F   L   LDYE   + +L + A+DS      S     I V D  D PP+F       ++ E LP+ T V+++TA D D  +   ++YS+    P   +F I+  SG I     IDRE  ++      F+LT+ AT+ A P+ F   R F    V I + D NDN   F   + Q ++   S     I+IGS    ++  D D  AN +     V  +  + I + Y               +G      Q+    + I  L ++   +  +   +   + I+    + P+F    Y  ++ E  P  T +I +  ++ + +G   K+ Y   S+    K     F I   +G I T          LDRE    L+   V AI TD          +  L D           F++  L         G +R   +    + AN  + Y   + +       D+F+I+  +G+++    +DRE+       LLV A D   SS      + I V D+ND+ P F  + +S ++P+++S  + +  + A+D D       +ITY +   D  +     + NP TG          L      F   TV A+D G    S+ V +  N+ ++ND PP+F  S+++ S  E+L  G ++  V+A D D           N+   +NS      SL        +N + G++   S+LDRE  ++    +   D    TPL   ++ AT+ + + D+NDNPP F    +   +       ++ STG+  F V  TD D     Q  Y      S  F +D I G I   + L     S + FTV   D G      + ++TV  V   + P+     +     E     TI  K   +   AG   +  +    N  + F +  L G L++  PL    I  Y L IE  D  +G   +   ++V I V+DVN+N P+F Q  +    +   +    ++  V A D+D G NG + Y I+     D      F I +    G+I     L +   A+++  V A D G+P  S    V ++++D+NDN P F+   S    + P+ +    T+T +T    TD+D+G N   R+++   +     F I P +G+++  R  +RE  D Y  +V A+D G  ++++ V I V  ++ +      PS Y           L +  ++       +IG++ T   A D D G+N  I Y     T  F ++  SG +F IK+  R    +    +            HSF+      G  P   SE  V++ ++D NDNPP F  P+    + K     ++++ ++ Y
Sbjct: 1310 VASVTATDSDSGSNADITYSISATNNHGTFSISPNTGSIF---LVKKLDYETQSLYKLNVTAKDSGRPSRSSSIPVIIHVRDFNDNPPVFTPGDIFKSIPENLPISTSVMSITAHDTDADINGLLEYSIALQTPRGGHFRIDSVSGVIYTNKDIDREFSNL------FELTIKATDQAVPAEF---RRFALKNVTIWVTDQNDNIPTF---ISQNALVAESN----IVIGSILTTVLAFDPDEGANGEVEYELVRGDSDTFIMDRY---------------SGDIRLASQLIPSKL-IYSLMVSATDHGTDRKSSRTELTIILQGTDGPVFSQPKYITILKEGQPAGTNVISLDASSPRGAGT--KVEYFIVSVRSGGKAAGRLFTIGRHSGVIQTAAE-------LDREQGSDLYLLDVYAIETDAKQPRTQHAEVSFLFDF----------FFKVMLLLK------GNLREHISQTCAEGANALVTYAIISGAD------DSFRIDPESGELSATRRLDRER--RSKYSLLVRADDGQQSSDI---WVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSG--VNGEITYSVEEDDEDSTF---LLNPITGVF---NVTRALDFETQPFFILTVRAADGGG--RSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHG---------NSSTLLNSVHY---SLSGGDGQFSINPSTGLIITSSLLDRETRASYQLLVVASDGGQPTPL---SSSATVSVVVADINDNPPRFHHHPYVTHI------PASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAITASEKLTGS--SEVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPHIKLKDKAFTFPENQPTNTIVTKVTGSSPRAG--PLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARD--QGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLV--VSALDQDSGPNGQLEYAII-----DGNKENSFNINRAT--GEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSKIFS---ATVPENAPVGFTVTRVT---TTDEDAGANAISRYSITDASLP---FIIHPSTGDITISRPLNREDTDHYIAKVSAHDSGW-TVSTDVTIFVTDINDNAPRFSKPSYY-----------LDYPELT-------EIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIF-IKQQLRYQNSSGHNNINV--------NRHSFIVTASDRGIKPL-MSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAY 2555          

HSP 8 Score: 244.973 bits (624), Expect = 3.233e-64
Identity = 288/951 (30.28%), Postives = 432/951 (45.43%), Query Frame = 2
Query: 1517 LDYEQIKSINVSIKGL-QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IK---KYPNAR----LQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYF--VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIE---IMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN--NCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLD-SMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAV 4267
            LDYE I+   + I+   Q  P    P  +Y  V IA+LDVNDN P+F    +   I EN SP   L  VV+A D+DSG  G++ Y++ D  K+  F I+ +TG I T          LDRE   +  +   ATD G     T V +++   D+NDN P F  + + A + EN+    F   RV  TD+D   AN    Y   + S+        F I+ STGD+TI  P++RE   + I +  V A+D   +   D   + I V D+NDNAP F   ++ ++ P+     + +  ++ATD DE    +    +  I   +  F +    N  +G I IK   +Y N+     + V  H+F V ASDRG  PL +   ++INV + ND PP F    +     +++ +G  + +V A D         F + + I    S G       N +N   L++  G V V S L  +       +I   DK      PP +   T++I + + N + P F  +    ++ E     + I T +     K  D  + G + Y      D  L F V S +G + L K LD ET       VS +DG ++  +   TV+I V DVNDN P F  V+Y  V  + E    GT   K  A D D+G NA++ +   ++ S  F +  + G +T    L       Y L ++   + D  R +  +     V I +   N   P F    Y F  I+E    GT++GEV A+D+D GE+G V Y I  +     F         +N K GQI V+ SL +    + +  V A + G  R ++     V +T++D ND  P FT     V  + G SP          L+T +SA D DS +    RF    + N +   F I+P +G +S     DRET  +Y   +LA D G+P+ T + 
Sbjct: 2174 LDYENIEKYVLWIEARDQGFP----PYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVL--VVSALDQDSGPNGQLEYAIIDGNKENSFNINRATGEIRTT-------RPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENA-PVGFTVTRVTTTDEDAG-ANAISRYSITDASL-------PFIIHPSTGDITISRPLNREDTDHYIAK--VSAHDSGWTVSTD---VTIFVTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGK---IFYFIRSQTEYFRI----NSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKD------FGLNSEIEYAISGG-------NSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGN----PPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSA--RDKDKDKQMNGLITYNISSGNDDGL-FSVHSQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPV--VQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAY-----VNIQLKGANEYVPRFVSKQYYFE-ISEAAPKGTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGF--------SINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQVNEGLSPG--------GLVTFVSAEDSDS-VPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSA 3043          

HSP 9 Score: 243.047 bits (619), Expect = 1.247e-63
Identity = 360/1349 (26.69%), Postives = 580/1349 (42.99%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTS--SIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSIN---VSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDP-FKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPP----IFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNR----ILYQFYNMS--MGPPNY------LDN-FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSNLN--------FTVSCSD-GV--FLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVAND-SDAGENAVVIFYFP-NNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGE--NGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNL----GARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI---TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            +L+ T  LD ER     L ++A D      I +  I V D+ D  P F  S YS  + E++   + V  + A DGD  +   + YS+++ +  +  F +N  +G   +   +D E+Q       FF LTV A +       SS   V   +LD+ND+   F+  +Y  S+ E+  AG +++    +   D+D + N+   L++V+ + +     F + P   +        +   S LD E   S     V+  G Q  P+      S A VS+ + D+NDN P F +  Y   I  ++   +L+  VT TD+DSG   ++ YSL     +KF ID   GAI                A E+L   +            T  + +KD   NP        VRF     F +          +K  DK      N+    I+ +    S   GP +Y      LDN F I+  +G+++I  P+D E I   +L +          S ++   ++I V DVNDN PVF    F   + +N+S    +L ++A D D    P   + Y +I  +  N F +    N  TG I    P  R +V  ++  V+A+DRG PP ST V +LI+V ++ND  P F++ +FS +  EN  +G  + +V  TD D              NA++   +   SL  +     ++ + G + +   L+RE       ++   D          T    + I + D+NDN P F     + S + D+   + I  G+    V ATD D     +  YF  S +  F ++S SG+IF+ + L  +  S  N        F V+ SD G+   +  +TV I V+D NDN P F        +++  +VGT   K  A D  D G N+ + +     NSS+ F L    G +T+ + L       Y  ++EI  + +G         V I V + N++ P FSQ     + ++E   +GT I  + A DKD  +  NG ++Y I    D  +F +            Q  V S  K L      +    V+A D G    ++  TV + + D+NDN P F +PV         F + +  +   T +  ++ATDKDSG N  + + + S   D + F I P +G ++     D E K +Y   V A ++      S   + + +   ++ +P F S               +  IS ++  G  +G V  A DRD+G + ++ Y+  G +    F ++  +G ++     DRE ++  S  V A             + G    +  E  V + +LD ND PPVFT
Sbjct: 1756 ELSATRRLDRERRSKYSLLVRADDGQQSSDI-WVNITVSDINDHTPTFSRSVYSFDIPEDMSPGSIVAAILASDGDSGVNGEITYSVEEDDE-DSTFLLNPITGVFNVTRALDFETQP------FFILTVRAADGG---GRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLT---VSAADRD-HGNSSTLLNSVHYSLSGGDGQFSINPSTGL--------IITSSLLDRETRASYQLLVVASDGGQPTPLS-----SSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFAVTVTDEDSGSNSQLHYSLTGRNSEKFKIDPIRGAI---------------TASEKLTGSS----------EVTFTVHVKDGGTNPKTDSTTVTVRFVTGGDFPH----------IKLKDKAFTFPENQPTNTIVTKVTGSSPRAGPLSYYIASGNLDNAFHIDQLSGELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEK--VEIAVLDVNDNHPVFEQEPFHAEILENLSPQ-RVLVVSALDQDSG--PNGQLEYAIIDGNKENSFNI----NRATGEIRTTRPLDREKVAQYSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTVTRVTTTDEDAGA-----------NAISRYSITDASLPFI-----IHPSTGDITISRPLNREDTDHYIAKVSAHDSG-------WTVSTDVTIFVTDINDNAPRFS----KPSYYLDYPELTEI--GSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVY--LLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVT-VSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVH----------SQTGVLSLAKTLDYETKQKHELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVF-DPVE-------YFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQS--SDSDLFIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQY------------YFEISEAAPKGTVVGEVF-ASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS--------IRGA---DIDEVLVNITVLDAND-PPVFT 2954          

HSP 10 Score: 233.417 bits (594), Expect = 1.001e-60
Identity = 290/1096 (26.46%), Postives = 491/1096 (44.80%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAY--HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANA--QYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGV----VTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAI-------YTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCD-LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF--PNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGEN-GNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPV 3994
            +L++  PLDYE      L ++A+D  +  + +     I V+DV D  P+F+   + + + E L     V+ V+A+D D      ++Y++ DGN  N  F IN  +GEI     +DRE          + L V AT+   P    S+   V I +LD+NDN+  F + ++  +V EN+  G  +   + +   D+D  ANA  +Y+++       S  F ++P       I + R  N    D+  I  ++    G  ++           DV+I + D+NDN P F   SY    + + P  T IG     V+ATD D G  GKI Y +    + F I+SS+G I       Y N + + +  +       R   +  A+D G   LM+ TTV+I + D NDNPP FE   Y   + + S       ++V A DK     N+ I Y    +S G  N  + F+++  TG VT+ + +  +   N +  L + A D  N  + D   ++I V + N + P F  N  +V V + ++  T I  L+A D D+       ITY +  G D   F V +    +TG + + K  +   + + H   V A+D G+   ++ V + I VT++ND PPVF    +     EN+  G  + ++NATD D+  + L  ++IQ++                 ++L  ++   GI+  Q  LD E          +  KA   P   + +FA + I++   N+  P F +  + F + E   PK     G     V A+D D+   G + YL F  S    F ++  +GQI++  +LDRE    ++  V   +     G  +    V+ITVLD ND  P F   +  + ++E    G +     A DSD+  +     Y    N+  + F ++   G +++ + L    +  Y L I  +D+  G+     S  + + + D+N+N P     + E   + E    GT +  + + D D   N G  +Y ++       +         ++  G++  +  + +   + F   V   D+G+P++S+  TV + + D NDN PS +  V
Sbjct: 2167 ELSIRKPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENL-SPQRVLVVSALDQDSGPNGQLEYAIIDGNKENS-FNINRATGEIRTTRPLDREK------VAQYSLRVKATDRGMPP--KSTAVKVLISVLDVNDNAPRFSK-IFSATVPENAPVGFTV---TRVTTTDEDAGANAISRYSIT-----DASLPFIIHPSTG---DITISRPLNREDTDH-YIAKVSAHDSGWTVS----------TDVTIFVTDINDNAPRFSKPSY----YLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQTEYFRINSSSGEIFIKQQLRYQNSSGHNNINV------NRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTK-SVKVGTRLLKVTAYDKKDFGLNSEIEYA---ISGG--NSSNKFRLDKQTGSVTVASSLAADT--NKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHS----QTGVLSLAKTLDYETKQK-HELRVSATDGGWIAKTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSD----------------SDLFIIDPNTGIITTQGFLDYEAKQVY----HLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISE-AAPK-----GTVVGEVFASDRDLGEDGVVYYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVDS--GSPAATGSAILIVTLEDINDNGPTLVTTYGE---VMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYF-------TISPTGELTTSREVDREQISDFYLSVLIKDSGIPQMSSTGTVHIKVNDQNDN-PSESRSV 3166          

HSP 11 Score: 229.18 bits (583), Expect = 1.945e-59
Identity = 358/1383 (25.89%), Postives = 571/1383 (41.29%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDR----SLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPI-FGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVR---VKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQV-------IDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKP-KSNISTGATGFYVKATDVDIVGTLQYLYF-----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL----SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVA---VTIIDINDNYPSFTNPVSPSNGSSPQ--FSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEG--PLTFTS-----ISNSSLSGFKIGNVATAVDRD-IGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIV-SQNALTY 4819
            +T  LD+E  P   L ++A D     S    +  ++DV D PP+F +S Y++++ E L     V+TV+A D D     +L + V YSL  G   +  F+IN ++G II + ++DRE++        + L V+A++       SS   V + + DINDN   F    Y   +  ++  G  +     + V D+D  +N+Q + S    N  S  F++ PI     AI       GS    E   +++V   G         P+     V++  +   D   I   + ++TF   EN P  T++  VT +   +G     I S N     F ID  +G +            LD E  E+  +   A D G         V I + D+NDN P+FE   + A + EN       P R   V A D+D    N ++ Y   +      N  ++F IN +TG++    P+DREK+      L V A D           + I V DVNDNAP F    FS  VP+N     T+  +  TD D      + I+   I   S+ FI+    +P TG I    P  R     +   V A D G+  +ST V I   VT+IND  P F++  +     E  +IG  + QV+ATDPD   N  + YFI                     T    +N + G ++++  L   +Y   +G   +       I  A++  + P  +  T+ I ++D NDNPP F++  +       F P   ++  G     V A D    G    + +     + S  F +D  +G + +  +L  +T       ++ SD         +TV I V + N + P F      + +SE   VGT      A D D  +    +  +  +S +  GL    S  G L+L   L       ++L +   D   G I       V I V DVN+N P+F  V Y F  + E    GT + ++ ATDKD G N  ++Y ++   D+D+FI        ++    I+      +  A+  + +      VP     C+ A   + +   N+  P F          S Q  F I E     T++  + A+D+D G +G + + L         F I+  +G +    S DRE ++    +VLA + G+       +I+                 +L+N ++ +   P  FT        N  LS   +    +A D D +   +   Y    +     F ++P +G +    E DRET   Y+ T+ AV             SG SP     A ++V + DINDN P  T+ T  G +++     + ++ +S    D D+  +Q   TY
Sbjct: 1861 VTRALDFETQPFFILTVRAADGGGRSSSVRVYFNLLDVNDHPPLFNSSVYTTSILESLSAGASVLTVSAADRDHGNSSTLLNSVHYSLSGG---DGQFSINPSTGLIITSSLLDRETR------ASYQLLVVASDGGQPTPLSSSATVSVVVADINDNPPRFHHHPYVTHIPASTSTGSLVFA---VTVTDEDSGSNSQLHYSLTGRN--SEKFKIDPI---RGAITASEKLTGS---SEVTFTVHVKDGGTN-------PKTDSTTVTVRFVTGGDFPHIKLKDKAFTFP--ENQPTNTIVTKVTGSSPRAGPLSYYIASGNLD-NAFHIDQLSGELSIR-------KPLDYENIEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILEN-----LSPQRVLVVSALDQDSG-PNGQLEYAIIDG-----NKENSFNINRATGEIRTTRPLDREKVAQ--YSLRVKATDRGMPPKSTAVKVLISVLDVNDNAPRFS-KIFSATVPENAPVGFTVTRVTTTDEDAG---ANAISRYSITDASLPFII----HPSTGDITISRPLNREDTDHYIAKVSAHDSGW-TVSTDVTIF--VTDINDNAPRFSKPSYYLDYPELTEIGSIVTQVSATDPDEGFNGKIFYFIRSQ------------------TEYFRINSSSGEIFIKQQL---RYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSY-------FTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNKFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKTLDYETKQKHELRVSATDG--GWIAKTSYVTVNIQVTDVNDNPPVFDPVEY-FPVVQENVPSGTTVVKMNATDKDSGSNALMAY-VIQSSDSDLFI--------IDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPD-EERCSFAYVNIQLKGANEYVPRFV---------SKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVVYY-LIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGS---IRGADIDE----------------VLVNITVLDANDPPVFTQELYDVQVNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTINPQTGQVSVASELDRETVPVYNLTILAVD------------SG-SPAATGSAILIVTLEDINDNGP--TLVTTYGEVMENQRAGTPVMTLSS--RDPDLAPNQGPFTY 3095          

HSP 12 Score: 229.18 bits (583), Expect = 2.135e-59
Identity = 295/1121 (26.32%), Postives = 481/1121 (42.91%), Query Frame = 2
Query:  977 TMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT-FGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREK------IPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSC---SDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLI-TPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEV--GIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKD-FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGL---NGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            T  E  P +T    VT + G      P+ Y +  GN  +  F I++ SGE+ I   +D E+          +  V+  E     F   S+   V I +LD+NDN   F+Q  +   + EN      +++ +     D+D   N Q   + +  NK +S         +N+A   IR      LD E++   ++ +K          P+ +   V I++LDVNDN P F +  ++  + EN+P    +  VT TD+D+G      YS+ D    F+I  STG I       T    L+RE  +       A D G  ++ T V I + D+NDN P    RF +   + +    T  G +  +V ATD D +  N +I Y   + +       + F+IN+S+G++ I   +  +       I  +    +V A D     +     + I V D NDN P F   ++   V +++   T +L + A D  +     S+I Y + G +S N   +   + +TG++      A    +V+   + ASD+G PPLS R  + I VTE N   P F+Q+  + +  E L +G  I  ++A D D +  +   I  N I++ N  G     LF+V +     QTG ++ +   LD E       ++   D         +T++ T+ I++ DVNDNPP+F    + F + ++     N+ +G T   + ATD D        Y     D  L F +D  +G I     LD E     + TV      D      + V+I +   N+  P FV       ISE    GT+  +  A+D D GE+ VV +Y     S   G S++     I    ++      K+ ++++    G+I      EV   I V+D N+  P+F+Q  Y+   + E  + G ++  V A D D        +Y I    + + F +           GQ+ V S L +     +   + AVD+G P  + +  + VT+ DINDN P+                + EN      +++ + +D  L    G   ++L S      +F ISP +G L+  R  DRE    +   VL  D G P ++S
Sbjct: 2122 TFPENQPTNT---IVTKVTGSSPRAGPLSYYIASGN-LDNAFHIDQLSGELSIRKPLDYEN---------IEKYVLWIEARDQGFPPYSAYEKVEIAVLDVNDNHPVFEQEPFHAEILENLSPQRVLVVSAL----DQDSGPNGQLEYAIIDGNKENSF-------NINRATGEIRTTRP--LDREKVAQYSLRVKATDRG---MPPKSTAVKVLISVLDVNDNAPRF-SKIFSATVPENAPVGFTVTRVTTTDEDAGANAISRYSITDASLPFIIHPSTGDI-------TISRPLNREDTDHYIAKVSAHDSGWTVS-TDVTIFVTDINDNAP----RFSKPSYYLDYPELTEIGSIVTQVSATDPD-EGFNGKIFYFIRSQT-------EYFRINSSSGEIFIKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGL-NSEIEYAISGGNSSN---KFRLDKQTGSVTVASSLAADTNKVYLLEITASDKGNPPLSDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYN-ISSGNDDG-----LFSVHS-----QTG-VLSLAKTLDYETKQKHELRVSATDGG----WIAKTSYVTVNIQVTDVNDNPPVFDPVEY-FPVVQE-----NVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDL-FIIDPNTGIITTQGFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQYYFEISEAAPKGTVVGEVFASDRDLGEDGVV-YYLIFGRSRKRGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDANDP-PVFTQELYDVQ-VNEGLSPGGLVTFVSAEDSDSVPSWSRFTYAIAANHERNTFTIN-------PQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYG---------EVMENQRAGTPVMTLSSRDPDLAPNQGPFTYSLVSTGAASSYFTISP-TGELTTSREVDREQISDFYLSVLIKDSGIPQMSS 3145          

HSP 13 Score: 166.777 bits (421), Expect = 1.780e-40
Identity = 224/847 (26.45%), Postives = 359/847 (42.38%), Query Frame = 2
Query:  857 IQLQLQAQDSAYHVSINF----------------------TFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDG-DRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAI-IIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE--QIKSINVS-IKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTDYTLLDREAYE--RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVF-LVNSTVSI 3295
            I+ QL+ Q+S+ H +IN                         I V+D  D PP F++ SY + + + + V T ++ VTA D  D  L S ++Y++  GN  N+ F +++ +G + +A  +  ++  +      + L + A++   P L  S RT V+I + + N ++  F Q     +V E    G AI  + +    +DK +N    YN+S+  ++   S+     ++++ K            LDYE  Q   + VS   G  IA      + SY  V+I + DVNDN P+F    Y  ++ EN P+ T +  + ATDKDSG    + Y +       F+ID +TG I T          LD EA +   L V A         +   V I LK  N+  P F  + Y    FE S     G V   V A+D+D+   +  + Y  +  S         F IN  TG + +   +DREK     L++L         +  D  ++ I V D ND  PVF    + V V + +S    + F++A D+D S    S  TY +      N       NP+TG +       R  V V+N T+ A D G P  +   I+++ + +IND  P    +       EN   G  +  +++ DPD   +   F       ++ S+G   +S F ++         G +     +DRE+ S     + + D      +P  ++  T+ I++ D NDNP   ++       F +  P      G +   VK  D DI  T Q     P  +      +G   LI    R T    + +V  +DGV   VNS V +
Sbjct: 2476 IKQQLRYQNSSGHNNINVNRHSFIVTASDRGIKPLMSETTVMINVVDSNDNPPTFESPSYFTPVTKSVKVGTRLLKVTAYDKKDFGLNSEIEYAISGGNSSNK-FRLDKQTGSVTVASSLAADTNKV------YLLEITASDKGNPPL--SDRTTVKIAVTEENHHTPEFSQNQVTVTVSEALTVGTAIRTLSARDKDKDKQMNGLITYNISSGNDDGLFSVHSQTGVLSLAKT-----------LDYETKQKHELRVSATDGGWIA------KTSYVTVNIQVTDVNDNPPVFDPVEYFPVVQENVPSGTTVVKMNATDKDSGSNALMAYVIQSSDSDLFIIDPNTGIITTQ-------GFLDYEAKQVYHLTVKAFNVPDEERCSFAYVNIQLKGANEYVPRFVSKQY---YFEISEAAPKGTVVGEVFASDRDLG-EDGVVYYLIFGRSRK-----RGFSINKKTGQIYVSGSLDREKEEKISLKVLAKNAGSIRGADIDEVLVNITVLDAND-PPVFTQELYDVQVNEGLSPGGLVTFVSAEDSD-SVPSWSRFTYAIAANHERNTFT---INPQTGQVSVASELDRETVPVYNLTILAVDSGSPAATGSAILIVTLEDINDNGPTLVTTYGEV--MENQRAGTPVMTLSSRDPDLAPNQGPFTY-----SLVSTGA-ASSYFTISPT-------GELTTSREVDREQISDFYLSVLIKDSG----IPQMSSTGTVHIKVNDQNDNPSESRSVEIYVHYFGNMFP------GGSLGVVKPQDPDIQDTFQ-CSLTPPAALLFSIPTGTCDLISN-SRSTDGTFDLSVRSNDGVHSAVNSHVRV 3248          
BLAST of Cadherin-23 vs. Ensembl Zebrafish
Match: BX530069.1 (dachsous cadherin-related 1b [Source:NCBI gene;Acc:553300])

HSP 1 Score: 315.464 bits (807), Expect = 6.955e-86
Identity = 379/1316 (28.80%), Postives = 578/1316 (43.92%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGS---EIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYA-DVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGK-------IIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMT---TVIIILKDLNDNPPIFEVRFYQAWLF----ENSYNFT-FGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGL----NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINV---TEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT---NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVID--KAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVG-------TLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS------TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIY--EN--TITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            I V+     PP+F+ + Y  T++E++   T V  V A      +   V Y++  G+P + YF ++  +G +  ++ +D ES+       FFDL + A   +P  F  +R  VR+ I D+NDN+     P++  S  E+     A  +G+    +  ED+D   N Q +   +    +S     + +   +  + +I    GS L Y+ +   ++ +    IA     P+ S    + + I   N+  P+F   +Y   + EN+P  T    V A ++D    G        + Y L        F I   +G ++         + LDRE  +   +  +AT G G M  T   T+ + + D NDN P    RF Q  +F    EN    T FG  RV ATD+D  + N+R+ Y+  +           F+IN+ TG+++    +DRE       QL+VV  D        T    I V D NDNAP F          + V + +   + +  LNA D DE       I Y L G  +  F +    NP TG +    P  R +   ++FT+ ASDRG P  S+  ++LI V   T I+ +P   + +L S    E    G  IG V A D      N  + Y ++  T +            F V  L       G VY+   LD EK S  T QI+V D  KA      P T    L I + D ND+ P F        + E      N   G++ +  +ATD D  G       ++Q  + D    F +D ++G + L + LD E  S+L   V   D     N       T  + V D NDN P F     V ++ E   VG +    +A D+D GEN  V +   + N++  F LS + G L+++ PL       Y L I   D+  G      ++ + I VIDVN+  P F +  +E + I E    GT I +V A+D+D G NG V+Y  + +   D F +         + G I     L + L   +T  V A D G+P       V +T++D NDN P+F            Q+S+   EN   + L T + ATD+D G +G + + + + + D + F +   SG LS  R  DRE K  Y  +V+  D G+PSL S  ++E+ VLD++DN P F S+   ++            +S  +  G  + + ATA D D G N  I+Y  + +    F +DP +G +      DRE + +Y   V AV            LS  +P N S A+V V ILD+NDN P F
Sbjct:  193 ISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRA-SSRNGVSKDVTYTISAGDP-DGYFMVDPETGALRTSLPLDHESRP------FFDLEIQARSGSPPAFGDTR--VRVTIADVNDNA-----PIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLI----SSGGQRTFGVERSSGEVRLI----GS-LSYDSVPRYDLQV----IAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIAPDSGWLFVK-------SALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAP----RFSQERVFLAVRENLPAGTGFG--RVSATDRDAGL-NSRLTYRLLHTDR-------YFQINSQTGEISTRAALDREH--QSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGE--NGTIFYSLSGSRAERFSL----NPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSV---EGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDH---------EGTFMVDRLT------GDVYLARELDYEKGSRYTLQIEVDDFSKAY-----PNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPE------NTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAV-SVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDH--GIPQHSTTQVLSIQVIDVNDEAPWFERNEFE-AQIRENQPAGTSIIQVTASDRDHGTNGLVTYGGVTE---DGFTINA-------ETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAF---------GLQQYSLEVPENLQPVELFT-LKATDRDIGESGRLEYKIKAGDPDGD-FRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVD------------VSEDAAIGLVVLD-ATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVD-----------LSPAAPRN-STAQVTVTILDVNDNAPFF 1372          

HSP 2 Score: 273.478 bits (698), Expect = 4.974e-73
Identity = 370/1393 (26.56%), Postives = 598/1393 (42.93%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINF-----TFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN--DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANN-RILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQ-NISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCD-LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSM--LDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGF-----YVKATDVDIVGTLQYLYF----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFI----LQLFRIQKVN-DKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIIS--ATDKD-SGLNGEIRFNLDSMNGDHEFFFISPIS----------GNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTF------TSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            L L   LD+E    + L +QA DSA   +          + V D  D  PIF + +  S M E+ PV   ++ V A D D+     V Y ++ GN     F ++  SG + I   +DRE Q+       ++LT++A +   P   +S+   + IQ++D+ND +  F++  ++  + EN  AG +II   ++   D+D   N       V  +        + I A    I   RV +    D+    +I V  K   I P F     + A V I +LD NDN P FG   Y+  + EN     L   + ATD+D G  G++ Y +   DP   F +D S+GA+ T+         LDRE      +  +  D G   L +  +V I + D+NDN P F    Y   + E++     G V + AT  DVD   N +ILY     + G       F ++ +TG +T    +DREK  +   Q+  V   P+ +    T  + + + DVNDNAP F  +   +NV   ++ T+  +  + A D D        + YR   +    F +    N  TGAI        L        VEA D+G PP S+  +++I V E + +   F+++    S  EN D G  + Q  A  PD   D + Y I     N  +S  +  N+              G ++VQS   LD E     T +++++ KA  T     ++F  + + + DVNDN P FQ   +   + E           A G+      V A DVD     Q  Y     + S  F +D  +G I     +DRE  +     +  +D      +  +T+++ ++D+NDN P  +   + + + E + +GT       ND D+G   V+ +    ++S+     +D   G ++L  PL      +YKL I   D+       +    + + V DVN+N P F+Q  Y+ + + E++  G+ +  V ATD+D GENG VSY++L       ++      LF  QK   D  +  V           + ++ A D G P LS++ TV V ++D+NDN P F       +    + ++ E+ +   TI++  A D D S  N    F + S N  + F   S +           G L      D E    Y   V  +D G P  +S+V                P+  ++    + + P  F       ++S  + +G +I  V TA D D    A + Y I +GD + +F +D ++G +   +  DRE+++++   V+A       DG   F         + A + V + DINDN P F I T+   I +    NS +  +  +  D D      L Y++
Sbjct:  906 LKLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTAVSVM-EDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGR-FVLSSNSGSLSILKPLDREEQE------SYNLTIVAEDHGIPQ--HSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSII---QVTASDRDHGTNGLVTYGGVTEDG-------FTINAETGVISATRVLDRELQDH---YTITVYAKDGGIPPNF-----AKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELF-TLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTS-------RPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDA---AIGLVVLDATATDVDEGQNGQILYFLSQEAKGA------FTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPA-APRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQVVATMRAEDKDFGAN--GSVFYRF-AMPVRGFAI----NSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPDGTRDGINYSIFSG--NKYHSFSISSNT--------------GEIWVQSSNGLDFED----TPRLRLVVKAETTS---SSSFMAVNLILQDVNDNRPRFQLQNYVTYMHE-----------AQGYDFPIIQVVAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRGSPKLVGTATITVIIVDLNDNSPT-IPVPREVRVPENSLIGTEITLVTGNDVDSG--PVLSYSLQLDASTQGKFDIDRYNGRVSLTAPLDYEERTWYKLTIRASDS-----KHQSEANLTVVVEDVNDNVPTFTQDLYQVT-LPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDGFYVDPKNGTLFIRQKAKFDPEEPSV-----------SIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIF-------HQLEYKATVSEDQLPGATILTLEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSV----------------PA--IITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRV-TATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQA------SDGHGRF---------ALAPISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVL--HAIDYDTGVYGQLKYYL 2148          

HSP 3 Score: 231.876 bits (590), Expect = 2.298e-60
Identity = 351/1405 (24.98%), Postives = 588/1405 (41.85%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGV--AIIIGSEIMVEDKDLNANAQ--YNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATD-KDSGIFGKIIYSL---NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLM----NMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYN----FTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPND--ILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI--VGTLQYL--YFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMD----NPRGTIHFKKSKEVGIYVIDVNNNFPIFSQ--VFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNL-GARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLT-SAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF--TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDIS-KYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKN 5008
            + V D  D  P F        + E LP  T    V+A D D  L S + Y L      + YF IN  +GEI     +DRE Q        + L V+  +      +++ T   I +LD NDN+  F        +    Q G+    ++G+ +  +D D   N    Y+LS     +    F + P     ++   +R    +   +    +I  S +G   AP     + S A + I ++     +P     S T    E +   ++IG V A D ++  + G++ Y +    D    F++D  TG +Y           LD E   R + + I  D         +M  + I ++D ND+ P F        + EN+      +TF     +ATDKD    N+ I Y         P+  D F ++  TG + +   +D E+  +   ++Q +  A DP N  ++ +   ++ V D NDNAP+F   T +V+V ++      +L++ A DAD+    +  ++YR   + S N     V +  +G++    P  R +   +N T+ A D G P  ST  ++ I V ++NDE P F ++ F     EN   G +I QV A+D D  TN  + Y         V   G  +N+              G++    +LDRE    L     +   A +  +PP  A A + I +LD NDN P F    +   + E+ +P          F +KATD DI   G L+Y     DP   F +D  SG +   + LDRE  S+ +  V   D G   +NST S  I+VLDVNDN P F      +++SE   +G +     A D D G+N  ++++    +   F +  + G +T    L       Y   +  +D     PR +     + +V + ++DVN+N P F Q  +    S  + +T+   ++  + A DKDFG NG+V Y+  +        ++ F I  +   G I    +L+ L   + T IV A+D G P  S+   V + + + +     F+        ++   S+ EN    T++    A   D   +G I +++ S N  H F  IS  +G +    S   + +D  + R++     T S +  AVN+ +  ++ +         + L N+  Y        +  +    F I  V  A D D G N  + Y    +  + +F +DP +G +      DRE        ++A                 SP     A + VII+D+NDN P   +P       +   P + ++      VT  D+ S   L+Y +      Q D + Q K       F ++  +G +S    + +++    + +++I  SD K+++
Sbjct:  515 VSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLH---TDRYFQINSQTGEISTRAALDREHQS------SYQLMVVVQDGGTPPRSATGT-AHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGT-LNAKDPDEGENGTIFYSLSGSRAER----FSLNPNTGELRSSSPLRRAEKAEYSF----TITASDRG---APS----QSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARE-------LDYEKGSR-YTLQIEVDDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTF-----QATDKDGSGPNSEIRYSVQQRW---PDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQAMDSALDP-NQRLWGSVTARVFVTDENDNAPIFSSPT-AVSVMEDQPVGFVLLYVMAWDADQGENGR--VSYR---IQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY-------GGVTEDGFTINA------------ETGVISATRVLDRE----LQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQP-------VELFTLKATDRDIGESGRLEYKIKAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEAKGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNS-----TAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTH--QVVATMRAEDKDFGANGSVFYRFAMP-------VRGFAINSLT--GAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSR-------TARDVSLQENADKGTVVAQAQAQHPDGTRDG-INYSIFSGNKYHSFS-ISSNTGEIWVQSSNGLDFEDTPRLRLVVKAETTSSSSFMAVNLILQDVNDNR------PRFQLQNYVTY--------MHEAQGYDFPIIQV-VAEDVDQGQNGQVTYTIESSNQSGLFKIDPQTGSITTTAIMDREIWTQAKLVIKATDRG-------------SPKLVGTATITVIIVDLNDNSPTIPVPR------EVRVPENSLIGTEITLVTGNDVDSGPVLSYSL------QLDASTQGK-------FDIDRYNGRVSLTAPLDYEERT--WYKLTIRASDSKHQS 1766          

HSP 4 Score: 230.72 bits (587), Expect = 5.395e-60
Identity = 339/1349 (25.13%), Postives = 566/1349 (41.96%), Query Frame = 2
Query: 1058 VQYSLKDGN---PFNEYFAINETSGEIIIAMIIDR-ESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTS--SIFEVYPIVAMNKAI---------LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIY--SLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADE-----SNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEA-SDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDN---EPYFVDYIQVLNISEVTQVGTIFAKFVANDSDA----GENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSK------EVGIYVIDVNNNFPIFSQVFYEFSPIT----EYTNIGTIIGEVLATDKDF-GENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV---PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTIT--LITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFA---TPNSQIVDI-SKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTA 4930
            + YS+  G+   P ++ F+IN+ SG+I  +  +DR E  D       F  TV AT+      ++S       + DINDN  +F    Y  S+   S  G ++I    +   D D  AN +     V    +S  ++ +   ++++++++         +VI  ++G  L       +N+S+ G  +AP                       P+F  + Y F + E+    T +GVV A+ ++ G+   + Y  S  DP   F++D  TGA+ T++        LD E+    F + I    G       T V + + D+NDN PIF     ++ L   +        RV+A D+D    N ++ +    +S G       F +  S+G+V ++  +  + +P   LQ  V+A D     +  T  + + +Q  N+  PVF   T+ V + +N   NT  L + A + D      S+TP S + YRL    D+V F +     P +G +  K    R    ++  TV A S  G    +    I ++VT+ ND  P F+Q     +  ENL  G   G+V+ATD D   N  L Y                   L +      +N   G +  ++ LDRE  S+   Q+ V+ +   T  PP++A  T  I +LD NDN P F  +     +    + +  +  G+    + A D D    GT+ Y L    +  F ++  +G++     L R   +  +FT++ SD      S+ ++ ++ V  +    P        LN  E  + G++     A+D       G+   ++    ++  +     L G + L   L       Y L IE+ D       F K+       ++ I V D N++ P F +      P+T    E T  G+ +    ATDKD  G N  + Y +  +   +  +  L  +  V   G+ L +    +L      +V A+D+ +    RL  + T  V + D NDN P F++P +         S+ E+     ++  + A D D G NG + + + S N     F +S  SG+LS ++  DRE ++ Y   ++A D G P  ++   + + V+D++D  P F  N       I E     TSI              TA DRD G N L+ Y    +   F ++  +G +   +  DRE +D Y+ TV A               G  P N ++A+V + +LD NDN P F       G+ +++     N Q V++ +   TD+DI     L Y I+   P              D  F L+ +SG LST+
Sbjct:   28 ITYSIGSGSVSAPLSQ-FSINKESGQICTSTALDRDEGAD------SFHFTVTATDGGGLSSSASVLVS---LEDINDNRPSFYPLNYAVSLSTQSSPGTSVI---RVTAHDPDAGANGRVTYHTVSGGGSSFFTLNKDTGVISLSRSLHGKANSVIPMVISARDGGGLTAPVNARVNISVVGGSVAP-----------------------PVFEQAQYFFTVSEDVLRGTEVGVVRASSRN-GVSKDVTYTISAGDPDGYFMVDPETGALRTSLP-------LDHESRP-FFDLEIQARSGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSG-PNGQLSFDL--ISSGGQR---TFGVERSSGEVRLIGSLSYDSVPRYDLQ--VIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVGFGIA----PDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTY------------------RLLHTDRYFQINSQTGEISTRAALDREHQSSY--QLMVVVQDGGT--PPRSATGTAHITVLDENDNAPAFSHTQPGREIL--IQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTYLVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDD-------FSKAYPNTHMIQLEINVQDSNDHAPQFPE-----DPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSL----FLVVQAMDSALDPNQRLWGSVTARVFVTDENDNAPIFSSPTA--------VSVMEDQPVGFVLLYVMAWDADQGENGRVSYRIQSGNTAGR-FVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEF--EAQIRENQPAGTSIIQ-----------VTASDRDHGTNGLVTYGGVTED-GFTINAETGVISATRVLDRELQDHYTITVYA-------------KDGGIPPNFAKAKVHITVLDENDNAPAF-------GLQQYSLEVPENLQPVELFTLKATDRDIGESGRLEYKIKAGDP--------------DGDFRLDGSSGALSTS 1222          

HSP 5 Score: 226.483 bits (576), Expect = 1.011e-58
Identity = 314/1209 (25.97%), Postives = 517/1209 (42.76%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFPMIQLQLQAQDS-AYHVSINFTFIQVIDVED-VPPIFQNSSYSSTMNEELPVDTHVITVTAID-------GDRSLRSPVQYSLK-DGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIF----ENSPNFTLIGVVTATDKDSGIFGKIIYSLNDP-FKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVR----------VKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQ--IIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYR----------LIGVDSVNFIVEAVYNPKTGAIIKKYPNAR--LQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFD--PSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFG-LSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVD--NGVPRLSNNCTVAVTIIDINDNYPSF-TNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEI--RFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            S  ++ L   L Y+  P   LQ+ A+DS A  +S  F+ +  I  E+   P+F   +Y   + E  P++T+ + V A++       G  +  S + Y L+ DG+     F I   SG + +   +DRE +DI      + LTV+AT  +  +  +    +R+ + D NDN+  F Q     +V EN  AG        +   D+D   N++     ++ ++    F++      N     I  +  + LD E   S  + +    +      P  +     I +LD NDN P F ++     I     E  P  +L+G + A D D G  G I YSL+    ++F ++ +TG + ++        L   E  E  F +  A+D G     ++ +++++       I   R        N+ + T   V           V+A D+     N ++ Y    + +G  ++   F ++  TGDV +   +D EK     LQ+ V   D  + +  +T +IQ  I VQD ND+AP F  +  ++ +P+N    +++    ATD D S  P S+I Y           L  +D V  ++      K G  +     +   L V+  +  ++ + R +  ++ RV     VT+ ND  P+F+ S  + S  E+  +G  +  V A D D   N  ++Y      I + N++G  V           L+   G + +   LDRE+  +    I   D      +P  +    L I+++DVND  P F+ + F+  + E      N   G +   V A+D D  GT   + +       F +++ +G I   + LDRE   +   TV   DG    N   + V ITVLD NDN P F      L + E  Q   +F    A D D GE+  + +     +  P G   LD   G L+   PL       Y L + + D+  G+     +  V I V+DVN+N P FS   Y    ++E   IG ++ +  ATD D G+NG + Y  L Q+    F +         + G+I   + L +   A + F V AVD     PR ++   V VTI+D+NDN P F  +P+  +  S   F     T  ++  + A DKD G NG +  RF +         F I+ ++G +    +    T+      V A D G+P  +S
Sbjct:  362 SSGEVRLIGSLSYDSVPRYDLQVIAKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNFLQVRALNRDPNGNGGSSTPTSTLAYRLRPDGDAVG--FGIAPDSGWLFVKSALDREVKDI------YLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGF---GRVSATDRDAGLNSRLTYRLLHTDR---YFQI------NSQTGEISTR--AALDREHQSSYQLMVV---VQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSRAERFSLNPNTGELRSS------SPLRRAEKAEYSFTI-TASDRGAPSQSSSAVLLIQ------VIGSTRISPK---PNTLSMTLNSVEGAKPGSVIGSVRAHDQREVTLNGQVTY----LVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEV---DDFSKAYPNTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSG-PNSEIRYSVQQRWPDNPDLFNLDPVTGVL------KLGRELDHEETSSLFLVVQAMDSALDPNQRLWGSVTARVF----VTDENDNAPIFS-SPTAVSVMEDQPVGFVLLYVMAWDADQGENGRVSY-----RIQSGNTAGRFV-----------LSSNSGSLSILKPLDREEQESYNLTIVAEDHG----IPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRE------NQPAGTSIIQVTASDRDH-GTNGLVTYGGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKDGGIPPNFAKAKVHITVLDENDNAPAFGLQQYSLEVPENLQPVELFT-LKATDRDIGESGRLEYKI--KAGDPDGDFRLDGSSGALSTSRPLDRERKSSYSLQVVVQDH--GSPSLNSTASVEISVLDVNDNSPKFSSSSYTVD-VSEDAAIGLVVLDATATDVDEGQNGQILY-FLSQEAKGAFTVD-------PNTGRITTAALLDREKRASYFFQVYAVDLSPAAPR-NSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVF-----THQVVATMRAEDKDFGANGSVFYRFAMPVRG-----FAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSS 1458          

HSP 6 Score: 220.32 bits (560), Expect = 8.589e-57
Identity = 343/1323 (25.93%), Postives = 562/1323 (42.48%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVI--DVEDVPPIF-QNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATET-APSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSI-FEVYP-------IVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMT--TVIIILKDLNDNPPIF-EVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGV--DSVNFIVEAVYNPKTGAI-------IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIIL-INVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD---TNCDLAYFIIQNTINAVNSSGVPVN-SLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFA--TLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYL--YFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIF---YYKLIIEIMDNPRGTI--HFKKSKEVGIYVIDVNNNFPIFS------QVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILL-QKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPS-LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL 4621
            L  + PLD+E  P   L++QA+ S    +   T ++V   DV D  PIF  +SS S  + E   + T V  V A D D      + + L         F +  +SGE+ +   +  +S         +DL VIA ++ AP L  +    V IQ    N+    FD   Y+  + EN+      +   ++   ++D N N   +        TS++ + + P        +A +   L ++    S LD E +K I + +  L  +    +     A + +++ D NDN P F        + EN P  T  G V+ATD+D+G+  ++ Y L    + F I+S TG I T          LDRE      ++ +  DGG        T  I + D NDN P F   +  +  L +       G +      KD D   N  +  FY++S    +  + F +N +TG++   +P+ R +         + A D    S   + ++ I V      +P     + ++N  +     + I  + A D  E  T    +TY ++G       F+V+ +    TG +        +K     LQ+ V +F+     + YP  +T +I L INV + ND  P F +   +    EN   G ++    ATD D    N ++ Y + Q           P N  LFN      L+   G++ +   LD E+ S+L   +Q +D A +   P Q  +   T R+ + D NDN PIF +S    S+ ED +P      G    YV A D D    G + Y     + +  F + S SG + ++K LDRE   + N T+   D     +ST   +SI V+DVND  P+F        I E    GT   +  A+D D G N +V +       +  G +++    +I+   +       +Y + +   D   G I  +F K+K V I V+D N+N P F       +V     P+  +T        + ATD+D GE+G + YKI     D D      FR+      G +  +  L +   + ++  V   D+G P L++  +V ++++D+NDN P F++       SS    + E+    + ++  +ATD D G NG+I + L         F + P +G ++     DRE +  Y F+V A DL   +   S   + V +LD++DN P F  + L++N            +S+ S+   ++     A D+D G N  + Y F      F ++  +G +   +     T+   +  V A  M Q G  P S L
Sbjct:  261 LRTSLPLDHESRPFFDLEIQAR-SGSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLISSG-GQRTFGVERSSGEVRLIGSLSYDS------VPRYDLQVIAKDSGAPQLSATFSLVVHIQAE--NNQGPVFDTITYRVELKENTPLNTNFL---QVRALNRDPNGNGGSS------TPTSTLAYRLRPDGDAVGFGIAPDSGWLFVK----SALDRE-VKDIYL-LTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHTDRYFQINSQTGEISTRA-------ALDREHQSSYQLMVVVQDGGTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTI--FYSLSG---SRAERFSLNPNTGELRSSSPLRRAEKAE--YSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPGSVIGSVRAHDQREV-TLNGQVTYLVVGGTDHEGTFMVDRL----TGDVYLARELDYEKGSRYTLQIEVDDFS-----KAYP--NTHMIQLEINVQDSNDHAPQFPEDPVTIVIPENTQAGSSVYTFQATDKDGSGPNSEIRYSVQQR---------WPDNPDLFN------LDPVTGVLKLGRELDHEETSSLFLVVQAMDSALD---PNQRLWGSVTARVFVTDENDNAPIF-SSPTAVSVMED-QP-----VGFVLLYVMAWDADQGENGRVSYRIQSGNTAGRFVLSSNSGSLSILKPLDREEQESYNLTIVAEDHGIPQHSTTQVLSIQVIDVNDEAPWFERNEFEAQIRENQPAGTSIIQVTASDRDHGTNGLVTY----GGVTEDGFTINAETGVISATRVLDRELQDHYTITVYAKD---GGIPPNFAKAK-VHITVLDENDNAPAFGLQQYSLEVPENLQPVELFT--------LKATDRDIGESGRLEYKIKAGDPDGD------FRLD--GSSGALSTSRPLDRERKSSYSLQVVVQDHGSPSLNSTASVEISVLDVNDNSPKFSS-------SSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLSQEA--KGAFTVDPNTGRITTAALLDREKRASYFFQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIIN------------VSSGSVFTHQVVATMRAEDKDFGANGSVFYRFAMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEA--MDQ-GSPPQSSL 1459          

HSP 7 Score: 201.445 bits (511), Expect = 4.189e-51
Identity = 300/1150 (26.09%), Postives = 493/1150 (42.87%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTF---IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQ-PL----YQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPV--FNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFE-NSYNFTFGPVRVKATDKDVDVA-NNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL-------SFYVDS----ISGQIF-------LIKALDRETVSNLNFTVSCSD-GVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL------------LQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTI-IDINDNY-PSFTNPVSPSNGSSPQFSIYENTIT--LITIISATDKDSGLNG 4096
            L+ + PLD ER     LQ+  QD     S+N T    I V+DV D  P F +SSY+  ++E+  +   V+  TA D D      + Y L         F ++  +G I  A ++DRE +       +F   V A + +P+   +S   V + ILD+NDN+  F Q PL      GSV+ +        + + +  EDKD  AN              S+F  +   AM      I    G+    E ++++  + + L +  +   + P+ S   V I + + +     F  ++    + EN+   T++    A   D G    I YS+   + +  F I S+TG I+   +   D+    R    RL V A  T     M    V +IL+D+NDN P F+++ Y  ++ E   Y+F   P+ ++   +DVD   N ++ Y   +      N    FKI+  TG +T    +DRE       +L++ A D  +  +  T  I +I+ D+NDN+P   +    V VP+N    T I  +   D D    P    + +L       F ++  YN   G +    P    +   +  T+ ASD  +    +   + + V ++ND  P FTQ L+  +  E+   G  +  V ATD D+  N  ++Y ++ +T +            F V      +   G ++++    + K+      + ++ +A +   PP ++ AT++++++DVNDN PIF    ++ ++ ED  P      GAT   ++A D D+  + +   FD ++       +F ++S    I G  F       L + LD E +S+ N TVS SD GV   +S+V   ITV DVNDN P F     ++ +SE    G    +  A D D+   A V +   +        S+D   G + L  PL       + +I++  D   G   F  +  + + V D+N+N P F       S I E   + + +  + A D D G  G + Y ++             Q   +V   Q+F  +KVN                 F FI  AVD G    +N+ TV V + I   D Y P FT        S   F + E       I ++ A D+D G++G
Sbjct: 1219 LSTSRPLDRERKSSYSLQVVVQDHG-SPSLNSTASVEISVLDVNDNSPKFSSSSYTVDVSEDAAIGLVVLDATATDVDEGQNGQILYFLS--QEAKGAFTVDPNTGRITTAALLDREKR-----ASYF-FQVYAVDLSPAAPRNSTAQVTVTILDVNDNAPFFIQDPLIINVSSGSVFTHQ-------VVATMRAEDKDFGANG-------------SVFYRF---AMPVRGFAINSLTGAIQTTENLQTLTQTQRTLIVEAMDQGSPPQSSLGVVIIYVKEQDYKGIRFSRTARDVSLQENADKGTVVAQAQAQHPD-GTRDGINYSIFSGNKYHSFSISSNTGEIWVQSSNGLDFEDTPR---LRLVVKAETTSSSSFM---AVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDF---PI-IQVVAEDVDQGQNGQVTYTIESS-----NQSGLFKIDPQTGSITTTAIMDREIWTQ--AKLVIKATDRGSPKLVGTATITVIIVDLNDNSPTIPV-PREVRVPENSLIGTEITLVTGNDVDSG--PVLSYSLQLDASTQGKFDIDR-YN---GRVSLTAPLDYEERTWYKLTIRASDSKH---QSEANLTVVVEDVNDNVPTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDG-----------FYV------DPKNGTLFIRQ---KAKFDPEEPSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLP------GATILTLEAVDGDL--SQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKL-FSVDQWTGAMKLQRPLDRESQNSHVVIVQASD---GHGRFALAP-ISVEVKDINDNRPYFPIATLTAS-IRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNS----------------FNFIALAVDAG----NNSATVTVQVFITGEDEYDPVFTT-------SDLSFEVPEGAKKGQSIGLVQAKDEDGGVDG 2247          

HSP 8 Score: 160.229 bits (404), Expect = 1.666e-38
Identity = 269/1058 (25.43%), Postives = 445/1058 (42.06%), Query Frame = 2
Query: 1703 TLIGVVTATDKDSGIFGKIIYSLND-----PFKKFVIDSSTGAIYTNVNANTDYTLLDR-EAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPV-FTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVG---------TLQYLYFDP---SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV----NSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFS--QVFYE-FSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNL-GARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYP---SFTNPVSPSNGSSPQFSIYENTITLITIISATD-KDSGLNGEIRFNLDSMNGDHE-FFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGT--PSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFT----SISNSSLSGFKIGNVATAVDRD-IGYNALIVY----IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTIL 4720
            T  G       D G FG I YS+       P  +F I+  +G I T+       T LDR E  +       ATDGGGL +  +V++ L+D+NDN P F    Y   L   S   T   +RV A D D   AN R+ Y  + +S G  ++   F +N  TG +++   +  +   N ++ +++ A D    +      + I V   +   PVF    +   V +++   T +  + A+     N    D+TY +   D   +    + +P+TGA+    P         +  ++A   G PP      + + + ++ND  P+ F  S  S    E   +G  + +V A D D+  N  L++ +I        SSG             G+ ++ G V +   L  +        +QVI  A ++  P  +A  +L + I   N+  P+F T  ++  L E+    +N         V+A + D  G         TL Y    P   ++ F +   SG +F+  ALDRE       TV  + G   +    ++T+ ++V D NDN P F      L + E    GT F +  A D DAG N+ + +       YF  NS +       G ++    L       Y+L++ + D   GT     +    I V+D N+N P FS  Q   E    + E    G+++G + A D D GENG + Y +   +       + F +    + G++  +S L+    A ++F + A D G P  S++  + + +I      P   + +  ++   G+ P         ++I  + A D ++  LNG++ + L     DHE  F +  ++G++   R  D E    Y  ++  +D     P+ T  + +E+ V D +D+ P FP           E P+T      + + SS+  F+      A D+D  G N+ I Y     +  +  +F LDP +G L   +E D E   +    V+A  M    D P+  L G        ARV V   D NDN P+F+ PT +
Sbjct:   10 TSAGCQIEDQPDGGSFGTITYSIGSGSVSAPLSQFSINKESGQICTS-------TALDRDEGADSFHFTVTATDGGGLSSSASVLVSLEDINDNRPSFYPLNYAVSLSTQSSPGT-SVIRVTAHDPDAG-ANGRVTY--HTVSGGGSSF---FTLNKDTGVISLSRSLHGKA--NSVIPMVISARDGGGLTAPVNARVNISVVGGSVAPPVFEQAQYFFTVSEDVLRGTEVGVVRAS---SRNGVSKDVTYTISAGDPDGYF---MVDPETGALRTSLPLDHESRPFFDLEIQARS-GSPPAFGDTRVRVTIADVNDNAPIFFPSSSESLLLPEATKMGTIVYRVQAEDRDSGPNGQLSFDLI--------SSG--------GQRTFGVERSSGEVRLIGSLSYDSVPRY--DLQVI--AKDSGAPQLSATFSLVVHIQAENNQGPVFDTITYRVELKENTPLNTNF------LQVRALNRDPNGNGGSSTPTSTLAY-RLRPDGDAVGFGIAPDSGWLFVKSALDREVKDIYLLTVLATSGSGQMGRTGSATIRVSVTDENDNAPRFSQERVFLAVRENLPAGTGFGRVSATDRDAGLNSRLTYRLLHTDRYFQINSQT-------GEISTRAALDREHQSSYQLMVVVQDG--GTPPRSATGTAHITVLDENDNAPAFSHTQPGREILIQVQEGLPAGSLLGTLNAKDPDEGENGTIFYSLSGSR------AERFSLNP--NTGELRSSSPLRRAEKAEYSFTITASDRGAPSQSSSAVLLIQVIGSTRISPKPNTLSMTLNSVEGAKPG--------SVIGSVRAHDQREVTLNGQVTY-LVVGGTDHEGTFMVDRLTGDVYLARELDYEKGSRYTLQIEVDDFSKAYPN-THMIQLEINVQDSNDHAPQFP-----------EDPVTIVIPENTQAGSSVYTFQ------ATDKDGSGPNSEIRYSVQQRWPDNPDLFNLDPVTGVLKLGRELDHEETSSLFLVVQA--MDSALD-PNQRLWG-----SVTARVFVT--DENDNAPIFSSPTAV 963          

HSP 9 Score: 158.303 bits (399), Expect = 5.461e-38
Identity = 218/835 (26.11%), Postives = 357/835 (42.75%), Query Frame = 2
Query: 1049 RSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLT----VIATETAPSLFNSSRTFVRIQIL--DINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN---DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPND----ILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRV-------HNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPF 3472
            R  + YS+  GN ++  F+I+  +GEI +           +N   F D      V+  ET      SS +F+ + ++  D+NDN   F    Y   ++E       II   +++ ED D   N Q   +   +N+ S +F++ P            +   + +D E      + IK         +     A +++ I+D+NDN+P          + ENS   T I +VT  D DSG    + YSL        KF ID   G +  ++ A  DY   +   + +L + A  +      N+T V+  + D     P F    YQ  L E+S   +  PV  V ATD+D    N ++ Y+  + +       D F ++   G + I     R+K   D     + +++ A D  +  +  +  +Q+ + DVNDNAP+F    +   V ++     TIL L A D D S    S   + +   +  N F +E+      G   +      L  R+       +N TV  SDRG P  S+ V  +I VT++ND PPVF ++ +  +  E    G  I +V ATDPD+     Y  +Q +I    SSG       +   L  ++Q  G + +Q  LDRE  ++    +Q  D         + A A + +E+ D+NDN P F  +    S+ E+ +P   +++  T  +    D  + G L+Y   D S      F+VD  SG++   +  D E V++ NF     D G      TV + +   ++ +P F        + E  + G       A D D G + +V++ FPN  SSP+
Sbjct: 1507 RDGINYSIFSGNKYHS-FSISSNTGEIWVQS---------SNGLDFEDTPRLRLVVKAET-----TSSSSFMAVNLILQDVNDNRPRFQLQNYVTYMHEAQGYDFPII---QVVAEDVDQGQNGQVTYTIESSNQ-SGLFKIDPQTGS--------ITTTAIMDREIWTQAKLVIKATDRGSPKLV---GTATITVIIVDLNDNSPTI-PVPREVRVPENSLIGTEITLVTGNDVDSGPV--LSYSLQLDASTQGKFDIDRYNGRV--SLTAPLDY---EERTWYKLTIRASDSKHQSEANLTVVVEDVNDNV---PTFTQDLYQVTLPEHSPPGS--PVITVTATDRDSG-ENGKVSYRVLSSTR------DGFYVDPKNGTLFI-----RQKAKFDPEEPSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILTLEAVDGDLSQE-NSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDS---APYAEVQYSI----SSG-------DDMKLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHG------RFALAPISVEVKDINDNRPYFPIATLTASIREN-QP---LNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTKQIFDFEKVNSFNFIALAVDAGNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPN--SSPY 2259          

HSP 10 Score: 145.976 bits (367), Expect = 3.273e-34
Identity = 152/549 (27.69%), Postives = 242/549 (44.08%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQY----SLKDGNPFNEYFAINETSGEIIIAMII--DRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLN--------ANAQYNLSAVYNNKTSSIF-EVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYA-DVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN--DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDAD 2404
            +++LT PLDYE     +L ++A DS +    N T +     ++V P F    Y  T+ E  P  + VITVTA D D      V Y    S +DG      F ++  +G + I      D E   ++ V    D        +P L  SS   V++Q++D+NDN+  F Q  Y+ +V E+   G  I+    +   D DL+        A A  N+   +  ++S  F E +    +   IL  R      LD+E +   N+++          +P+ S +    I + DVNDN P+FG + Y   + E +     I  VTATD DS  + ++ YS++  D  K F +D  TGA+            LDRE+     V+  A+DG G   +  + + +KD+NDN P F +    A + EN          + A D D  V       ++Y M    P   D F ++ ++G+V      D EK+  +    + +A D  N+S   T  +Q+ +   ++  PVF  +  S  VP+      +I  + A D D
Sbjct: 1738 RVSLTAPLDYEERTWYKLTIRASDSKHQSEANLTVVVEDVNDNV-PTFTQDLYQVTLPEHSPPGSPVITVTATDRDSGENGKVSYRVLSSTRDG------FYVDPKNGTLFIRQKAKFDPEEPSVSIVIEARD------GGSPPL--SSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGATILT---LEAVDGDLSQENSGFDFAIASGNVGNAFQIESSVRFIEGHGFQTVGTLILAER------LDFEALSHYNLTVS----VSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGAMKLQ-------RPLDRESQNSHVVIVQASDGHGRFALAPISVEVKDINDNRPYFPIATLTASIRENQ-PLNSAVTVLHAIDYDTGVYGQ---LKYYLMDHSSPGK-DLFFVDQNSGEVRTKQIFDFEKV--NSFNFIALAVDAGNNSA--TVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDED 2242          

HSP 11 Score: 92.0485 bits (227), Expect = 8.045e-18
Identity = 120/460 (26.09%), Postives = 205/460 (44.57%), Query Frame = 2
Query:  851 PMIQLQLQAQDSAYH-VSINFTF-IQVIDVEDVPPIFQNSSYSSTMNE-ELPVDTHVITVTAIDGDRSLR-SPVQYSLKDGNPFNEYFAIN-----------ETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLN--ANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND---PFKK-FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNF-TFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTG 2164
            P + + ++A+D     +S + T  +Q++DV D  PIF    Y +T++E +LP  T ++T+ A+DGD S   S   +++  GN  N  F I            +T G +I+A  +D E+         ++LTV  ++      +SS   + I + D+NDN   F +  Y  ++ E + AG  I+    +   D D    A  QY++S+  + K  S+ +    + + +            LD E   S  V ++       F +     A +S+ + D+NDN P F  ++ T  I EN P  + + V+ A D D+G++G++ Y L D   P K  F +D ++G + T         + D E       +A+A D G      TV + +   ++  P+F        + E +    + G V+ K  D  VD     +LY F       PN    F +N +TG
Sbjct: 1853 PSVSIVIEARDGGSPPLSSSATVQVQLMDVNDNAPIFHQLEYKATVSEDQLPGAT-ILTLEAVDGDLSQENSGFDFAIASGNVGNA-FQIESSVRFIEGHGFQTVGTLILAERLDFEA------LSHYNLTVSVSDRGVPQRSSSVPAI-ITVTDVNDNPPVFGRAEYIVALSEGAAAGAEIL---RVTATDPDSAPYAEVQYSISSGDDMKLFSVDQWTGAMKLQRP-----------LDRESQNSHVVIVQASDGHGRFAL-----APISVEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAIDYDTGVYGQLKYYLMDHSSPGKDLFFVDQNSGEVRTK-------QIFDFEKVNSFNFIALAVDAGNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVD---GIVLYSF-------PNSSPYFDVNKTTG 2267          

HSP 12 Score: 84.3445 bits (207), Expect = 1.661e-15
Identity = 87/357 (24.37%), Postives = 150/357 (42.02%), Query Frame = 2
Query:  794 GYYSVFQLTLTTPLDYERFPMIQLQLQAQDSA--YHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQD-------ITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYA-DVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVN 1834
            G+ +V  L L   LD+E      L +   D       S     I V DV D PP+F  + Y   ++E       ++ VTA D D +  + VQYS+  G+   + F++++ +G + +   +DRESQ+        ++  G F L  I+                +++ DINDN   F       S+ EN     A+ +   I     D +      L     + +S   +++  V  N       V+     D+E++ S N       IA   +   +S    V + I   ++  P+F  S  +F + E +     IG+V A D+D G+ G ++YS  +    F ++ +TG IY  ++
Sbjct: 1951 GFQTVGTLILAERLDFEALSHYNLTVSVSDRGVPQRSSSVPAIITVTDVNDNPPVFGRAEYIVALSEGAAAGAEILRVTATDPDSAPYAEVQYSISSGDDM-KLFSVDQWTGAMKLQRPLDRESQNSHVVIVQASDGHGRFALAPIS----------------VEVKDINDNRPYFPIATLTASIRENQPLNSAVTVLHAI-----DYDTGVYGQLKYYLMDHSSPGKDLF-FVDQNSG----EVRTKQIFDFEKVNSFNF------IALAVDAGNNSATVTVQVFITGEDEYDPVFTTSDLSFEVPEGAKKGQSIGLVQAKDEDGGVDGIVLYSFPNSSPYFDVNKTTGVIYLKMD 2274          
BLAST of Cadherin-23 vs. Ensembl Zebrafish
Match: fat1a (FAT atypical cadherin 1a [Source:ZFIN;Acc:ZDB-GENE-050425-1])

HSP 1 Score: 299.286 bits (765), Expect = 9.019e-81
Identity = 362/1327 (27.28%), Postives = 593/1327 (44.69%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFTFIQVI--DVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL-KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-NDPFK-KFVIDSSTGAIYTNVNANTDYTLLDRE-AYERLFVVA-IATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD---PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY--NPKTGAIIKKYPNARLQVRVHNFTVEA-SDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV-GTLQYLYF----DPSLSFYVDSISGQ--IFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPR-LSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-------TLITIISATDKDSGLNGEIRFNLDSMNGDHE-FFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLT--SAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDT-VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            LD+E  P  +L ++A DS         F+ +I  DV D PP+F    Y+++++E   + T V+ V+A D D      + Y + +D +   +YF+I+  +G I    ++D E +    +     L        P+L  SS   V I ++D+NDN+  F Q +Y+ +V E +  G  +   +++   D D++ + +   S +  N+  +        AM+     + + N      E + +INVS+       VF     S A V + ++  N + P F    Y   + ENSP  TL+    ATD DSG +G++ Y + ND  K KF I S  G I+T          LDRE A E++  ++ IA DGGG +   TV +IL D+NDN P F    Y+  +   + + + G   +K    D+D  +N  +   Y++     N  +NF+I+  +G   IVT      + N +   LV A D   P+ SS+     ++I+  +V    P F  + +   + +++S  + I  + A    ES+ P   + Y L+  ++     + V+  +P +G++           + +  T++A S+     + + V I I V ++ND  P+F  + +     ENL  G ++ QV ATD D  TN  + Y +  N                ++  L  +N   G +     LDRE  +  T  +   D+  +  L    A   + + ++DVNDNPP F   +++ ++ ED  P   I+  +T      TD+D      Q  YF    DP   F ++   G+  + + K LDRE   N    ++ +DG F   + V + VLD NDN P       + ++ E +  G +  +  A D+D   NA + +      S  F + S  G L  + PL       +K+ +  +D   G   F ++ EV I V DVN+N P F+   Y F+ + E T I T +  + A+D D G N  + Y +L   D       +F I++  + G + ++  L + L + +T    A D G PR LS++ TV+V+I+DINDN P F            +   Y  T+       T +  I A  +D+    EI + +  +NG+    F + P +G +  I   D ET   +   V A D GTPSL+  + VNI +  ++          N  + N  IY        IS  +  G  +  V          N +   I  G+    F +DP  G +   +  DRE    Y+ TV A   S  G          SP   S A + V + DINDNPP+F+
Sbjct: 2240 LDFETHPAYKLSVRATDSLTGAKAEV-FVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKVLFYQIVEDKDKSFDYFSIDRDTGTIWTTRMLDHEEKPSHRL-----LIRAVDGGVPAL--SSEVMVLIDVMDLNDNTPVFSQNVYEATVSELAPRGHFV---TQVQASDADISDSGKLEFSILSGNEGQNF-------AMDPNTGALVISNHRKPHMESLYNINVSVSD----GVFR----SSAIVKVNVISANFHNPTFNQVDYVVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVNDIAKDKFSI-SENGEIFT-------LESLDRENALEKVIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNV---ASDVSRGTTILKIAASDMDEGSNADIT--YSIETDADNVEENFEIHQFSG--VIVTKESLIGLENQMYTFLVRAKDGGNPTKSSVV-PVYVKILAPEVP--VPKFIESHYRFAIEEDLSLGSEIDVIQA----ESDQP---VFYSLVKGNTPESNQDEVFVVDPSSGSLKLDKKLDHESTKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGTNGHVVYNLDPN------------QETRDIVELFAINSESGWITTLKELDRETRNKYTVSVLATDRGDKVQL---MASTRVDVTVVDVNDNPPKFTAEIYKGTVSEDDPPGGVIAILST------TDLDTEENNKQISYFITGGDPLGQFAIEHTQGEWKVSVRKPLDREEKDNYLLNITATDGTFTAKAVVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQISYELLGPGSEHFSIDSETGELKTLLPLDREEEEVHKMKVRALD---GGGRFCEA-EVEITVEDVNDNPPQFTTDPYTFT-VFENTEINTPVARLYASDLDTGANAEILYSLLDSADG------VFSIEE--ETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHLSSHTTVSVSILDINDNPPVF------------ERREYTATVAEDIPVGTQVLRIHAASRDTEAGTEITYAI--INGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVN---------DNSPVFNQDIYSA-----VISEDAELGKTVLTVMADDADGPSSNQVRFSIIDGNQGSPFTIDPVRGEVKVARLLDREKTSGYTLTVLA---SDNG----------SPARSSSATINVDVSDINDNPPIFS 3440          

HSP 2 Score: 255.373 bits (651), Expect = 2.218e-67
Identity = 335/1290 (25.97%), Postives = 575/1290 (44.57%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT-------VTAIDGDRSLRSPVQYSLKDGNPF-NEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDN---TPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIAT--DGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-------IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY--LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYF--VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNN-SSSPFGLSLDGYLTLITPLTIYGIFYYKLIIE-IMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR-FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLA-NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF-----TGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRA 4579
            LDYE  P  +L +Q  + A   S     I + D  D  P+F    ++  ++E  PV++ V+T       + A+D DR   S + Y + +  PF + YFAI+ ++G I     +D E + +      F  +V   +   P  F      V I+ILD+ND    F Q LY+ +V   +  GV +I    +   D D   N++   S V  N     F++ P+        VI ++N + L       + VS             +  ++  S+  ++V +N   T  F   SY   + ENS     + V+ A      +   + Y++ +P K+F I  ++G +      ++  T  DRE      +V   T  D    +    V +I++D+NDNPP+F    YQA L +   +      +V A D D++  N  I Y            L+ F   ++ G++++   +D++ +  + + + VVA D    ++  +  + I+V  VN   PVF    +S+ +P+NI   T I+ + A D   S  P+  I Y +   D +N   +   N  TG I        + +P  +L VR  +    A           V + I + ++ND PPVF   L++ S  E   IG ++ +V+ATD DT  N  L Y I+++   + +                 +++  G ++   MLD E+  +    I+ +D      +P  ++   + I+++D+NDN P+F  ++++ ++ E   P+ +  T      V+A+D DI   G L++  L  +   +F +D  +G + +         S  N  VS SDGVF  ++ V + V+  N + P F  VDY  V+ + E + VGT+ A+  A D D+G    + ++  N+ +   F +S +G +  +  L         + I  I  +  G + F     V + + D+N+N P F    Y  +  ++ +  GT I ++ A+D D G N +++Y I    D    + + F I + +  G I+   SL  L  + +TF+V A D G P  S+   V V I+      P F         S  +F+I E+    + I +I A          ++ N    N D E F + P SG+L   +  D E+   Y+  + A ++     + SAV+I + V D++DN P+F SN        YE  +       +S+   K      A D D G N  +VY       T D V +F ++  SG +  +KE DRET++ Y+ +V A
Sbjct: 1723 LDYETIPSYKLTIQGTNMAGLASNTTLLIHLKDENDNAPVFIQDQFAGMVSESSPVNSVVLTKDNTPLVIRALDTDRDANSRLVYQIVE--PFAHNYFAIDSSTGAIRTISELDYEQRSV------FRFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQDLYETTVLVPTYKGVEVIT---VNASDADSGPNSRLFYSIVEGN-IGEKFKMDPVTG------VITIQNVTQLRSRYELRVRVS-------------DGRFSKTSLVKINVRENKESTLRFTQESYKAFVPENSSEKKTLAVIAAVGNQ--VNEPLFYTILNPDKRFTISRTSGVL------SSTGTPFDREEQGVFDIVVEVTRDDKSPDVAHVLVTVIIEDVNDNPPVFVNLPYQA-LVQVDADVDHIITKVTAVDADIN-ENAEINYHLQE--------LNEFVQISTDGEISLTKKLDKDSVNTEFI-ITVVARDGGEPALSSSVEVPILV--VNKAMPVFEKAFYSLEIPENIQLLTPIVHIQAND---SEGPR--IVYTITEGDPLN---QFTINFNTGVIQVVKTLDFETHPAYKLSVRATDSLTGAK--------AEVFVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVSATDADTGNNKVLFYQIVEDKDKSFD--------------YFSIDRDTGTIWTTRMLDHEEKPSHRLLIRAVDGG----VPALSSEVMVLIDVMDLNDNTPVFSQNVYEATVSE-LAPRGHFVT-----QVQASDADISDSGKLEFSILSGNEGQNFAMDPNTGALVISNHRKPHMESLYNINVSVSDGVFRSSAIVKVNVISANFHNPTFNQVDY--VVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVNDIAKDKFSISENGEIFTLESLDRENALEKVIPISLIAKDGGGKVGFCT---VNVILTDINDNAPQFRAADYRVNVASDVSR-GTTILKIAASDMDEGSNADITYSIETDADN---VEENFEIHQFS--GVIVTKESLIGLENQMYTFLVRAKDGGNPTKSSVVPVYVKILAPEVPVPKFIE-------SHYRFAIEEDLSLGSEIDVIQAESDQPVFYSLVKGNTPESNQD-EVFVVDPSSGSLKLDKKLDHESTKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESN-------PYEAFVVENLPGGTSVIQVK------ATDLDSGTNGHVVYNLDPNQETRDIVELFAINSESGWITTLKELDRETRNKYTVSVLA 2888          

HSP 3 Score: 254.603 bits (649), Expect = 4.142e-67
Identity = 287/1062 (27.02%), Postives = 486/1062 (45.76%), Query Frame = 2
Query:  854 MIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNEYFAINETSGEIIIAM-IIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN------DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG---LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRV-KATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGD--VTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF----DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDA-GENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENG-NVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAV-DNGVPRLSNNCTVAVTIID 3958
            +I + L A+D    V      + + D+ D  P F+ + Y   +  ++   T ++ + A D D    + + YS++ D +   E F I++ SG I+    +I  E+Q    ++ F     +  +   +   SS   V ++IL        F +  Y+ ++ E+      + +GSEI V   + +    Y+L    N   S+  EV+ +V  +   L +  K    LD+E  K   ++++         +   S  D+SI + DVNDN P+F ++ Y   + EN P  T +  V ATD DSG  G ++Y+L+      D  + F I+S +G I T          LDRE   +  V  +ATD G    LM  T V + + D+NDNPP F    Y+  + E+  +   G + +   TD D +  N +I    Y ++ G P  L  F I  + G+  V++  P+DRE+  N +L +       ++ +     ++++ V D NDN+P+   + +  +VP++      IL ++ATDAD  +  Q  I+Y L+G  S +F +++    +TG +    P  R +  VH   V A D G       V   I V ++ND PP FT   ++F+ +EN +I   + ++ A+D DT  N ++ Y ++ +            + +F++       +  G+V +   LDRE  S  T + Q  D+ +   L   ++  T+ + ILD+NDNPP+F+   +  ++ ED      I  G     + A   D     +  Y     +   +F VD  +G +F+I+ LD ET      TV  +DG     S   TV+I + DVNDN P F   I    ISE  ++G      +A+D+D    N V       N  SPF +  + G + +   L       Y L +   DN  G+     S  + + V D+N+N PIFSQ  Y    I E   IG  + ++  +D+D   NG   ++ I+   + D F        ++  +G ++  ++L      F  +   V D+G P L +   V+V +I+
Sbjct: 2561 VIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNVASDVSRGTTILKIAASDMDEGSNADITYSIETDADNVEENFEIHQFSGVIVTKESLIGLENQ----MYTFL----VRAKDGGNPTKSSVVPVYVKILAPEVPVPKFIESHYRFAIEED------LSLGSEIDVIQAESDQPVFYSL-VKGNTPESNQDEVF-VVDPSSGSLKLDKK----LDHESTKWYQLTLQAQSEYEGSKVV--SAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGTNGHVVYNLDPNQETRDIVELFAINSESGWITT-------LKELDRETRNKYTVSVLATDRGDKVQLMASTRVDVTVVDVNDNPPKFTAEIYKGTVSED--DPPGGVIAILSTTDLDTEENNKQI---SYFITGGDP--LGQFAIEHTQGEWKVSVRKPLDREEKDNYLLNITA-----TDGTFTAKAVVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQ--ISYELLGPGSEHFSIDS----ETGELKTLLPLDREEEEVHKMKVRALDGGGRFCEAEV--EITVEDVNDNPPQFTTDPYTFTVFENTEINTPVARLYASDLDTGANAEILYSLLDS-----------ADGVFSI------EEETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHL---SSHTTVSVSILDINDNPPVFERREYTATVAED------IPVGTQVLRIHAASRDTEAGTEITYAIINGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVNDNSPVFNQDIYSAVISEDAELGKTVLTVMADDADGPSSNQVRFSIIDGNQGSPFTIDPVRGEVKVARLLDREKTSGYTLTVLASDN--GSPARSSSATINVDVSDINDNPPIFSQANYSII-IQENQPIGASVLQLTVSDRDASHNGPPFTFSIIRGNEGDFF--------RITPQGVLVSAATLSRQTQEFYLLQAQVTDSGRPPLVSTAFVSVRLIE 3536          

HSP 4 Score: 236.884 bits (603), Expect = 9.259e-62
Identity = 318/1237 (25.71%), Postives = 516/1237 (41.71%), Query Frame = 2
Query:  695 CNLTITSVTSGSISDFNITKISINQNKI--------GSVSLGYYSVFQLT----LTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDS-----YADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL----NDPFKKFVIDSSTGAIYTNVN----ANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVA--NNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCI-IQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEA-VYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT---NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQ--YLYFDP-SLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGV-FLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMD--NPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL-DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNI 4273
             +L+  SV   S+ + + T      NK+           S  Y+S+ + T     T  LD+E  P  +L ++A D       S     I V+D+ D  P+F  + Y +T++E  P    V  V A D D S    +++S+  GN   + FA++  +G ++I+      +    ++   +++ V  ++    +F SS   V++ ++  N ++  F+Q  Y   + ENS  G  +   +E    D D         S  Y   T   + +   +A +K  +    +NG     E +   N   K   + P+  I +D      +  V++ + D+NDN P F  + Y   +  +    T I  + A+D D G    I YS+    ++  + F I   +G I T  +     N  YT L R           A DGG     + V + +K L    P+ +         E+ Y F         ++ DV  A  +  + Y     +    N  + F ++ S+G + +   +D E       QL + A      S   + + I I V+DVNDN P+F  N +   V +N+   T+++ + ATD D        + Y L        IVE    N ++G I       R     +  +V A+DRG    L     + + V ++ND PP FT  ++  +  E+   G  I  ++ TD DT   N  ++YFI         + G P+         I   Q    V V+  LDRE+       I   D          TA A + +++LD NDN PI + S +  S+ ED         G     V ATD DI    Q  Y    P S  F +DS +G++  +  LDRE        V   DG      + V ITV DVNDN P F        + E T++ T  A+  A+D D G NA +++   +++   F +  + G + L  PL       Y L  +  D  +PR   H      V + ++D+N+N P+F +  Y  + + E   +GT +  + A  +D      ++Y I+   +   F     R+      G + V   L       F   V A D G P LS+  TV + + D+NDN P F   +  +  S       E   T++T++ A D D   + ++RF++ D   G    F I P+ G +   R  DRE    Y   VLA+D G+P+ +S+  I
Sbjct: 2288 ASLSEASVIGTSVLEVSATDADTGNNKVLFYQIVEDKDKSFDYFSIDRDTGTIWTTRMLDHEEKPSHRLLIRAVDGGVPALSSEVMVLIDVMDLNDNTPVFSQNVYEATVSELAPRGHFVTQVQASDADISDSGKLEFSILSGNE-GQNFAMDPNTGALVIS------NHRKPHMESLYNINVSVSD---GVFRSS-AIVKVNVISANFHNPTFNQVDYVVELLENSPVGTLV---AEAQATDDD---------SGTYGRLT---YHIVNDIAKDKFSIS---ENGEIFTLESLDRENALEK---VIPISLIAKDGGGKVGFCTVNVILTDINDNAPQFRAADYRVNVASDVSRGTTILKIAASDMDEGSNADITYSIETDADNVEENFEIHQFSGVIVTKESLIGLENQMYTFLVR-----------AKDGGNPTKSSVVPVYVKILAPEVPVPK-------FIESHYRFAIEEDLSLGSEIDVIQAESDQPVFYSLVKGNTPESNQDEVFVVDPSSGSLKLDKKLDHES--TKWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGTSVIQVKATDLDSGT--NGHVVYNLDPNQETRDIVELFAINSESGWITTLKELDRETRNKYTVSVLATDRGDKVQLMASTRVDVTVVDVNDNPPKFTAEIYKGTVSEDDPPGGVIAILSTTDLDTEENNKQISYFI---------TGGDPLGQF-----AIEHTQGEWKVSVRKPLDREEKDNYLLNITATDGTF-------TAKAVVEVKVLDANDNSPICEKSFYMESVPEDSP------AGRLILQVSATDADIRSNAQISYELLGPGSEHFSIDSETGELKTLLPLDREEEEVHKMKVRALDGGGRFCEAEVEITVEDVNDNPPQFTTDPYTFTVFENTEINTPVARLYASDLDTGANAEILYSLLDSADGVFSIEEETGVVRLDRPLDRELQSLYTLRAQATDRGSPR---HLSSHTTVSVSILDINDNPPVFERREYTAT-VAEDIPVGTQVLRIHAASRDTEAGTEITYAIINGNERGAF-----RVDP--QTGGVFVIEPLDYETAHEFYLTVEATDGGTPSLSDLATVNINLTDVNDNSPVFNQDIYSAVISEDA----ELGKTVLTVM-ADDADGPSSNQVRFSIIDGNQGSP--FTIDPVRGEVKVARLLDREKTSGYTLTVLASDNGSPARSSSATI 3425          

HSP 5 Score: 209.92 bits (533), Expect = 1.331e-53
Identity = 304/1190 (25.55%), Postives = 502/1190 (42.18%), Query Frame = 2
Query:  794 GYYSVFQLTLTTPLDYERFPMIQLQLQAQDSA--YHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYS-LKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA---PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDN--TPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND--PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVT-PVDREKIPNDILQLLVVAYD-PSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVP-------QNISTNTTILFLNATDADESNTPQSDITYRL-IGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRV---IILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF---DP-SL-SFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSP-ITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP--VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP 4249
            G+  VF      PLD E      L +   D       S     ++++D  D  P F   +YS  ++E   V T VI V A D D      V+YS L D     + FAI+  +G + +   +DRE Q +      F L + A + A   P L   S   ++I + D+NDN   F  P Y   V E+   G  I+    +   D D+  ++Q   S +  +     FEV     ++ A+ +++      LDYE+ +  +++ K        ++   S   + + ++DVN+N   P+F +      I E+ P  T +  +TA D+D G  G+I YS+ D      F ID  TG I T         LLD E     ++   ATD G   L +   V I ++D+NDN P      Y   + E+S       ++++A D D   +        Y ++ G P     F IN  TG VT  +  +DRE+    IL++ V     P+ S+   T  + + V D NDN+P F    + + +P       +       +  + A+D DE   P ++I+Y +  G +   F +E    PKTG +  K  ++ +   +   T++A D G P  ST     I  I   E +  P VF +  ++FS  E+  +   +G ++    DT     +F I         +G   +S F V       +  G + V   LD E+ S     +   D         ++    + I+++D N++ P F    ++  + ED  P++ +        + ATD D    L Y      DP SL  F +D  +G ++  + LD ET+     TV   D    V      V + V D NDN P+F     V  + E    G+   +  A D D G+NA +I+   + N ++ F +  + G +T+   L       ++L ++  D  +GT     +  V I V   +N  P F++   EFS  ++E    G  +  V A  +      +V Y+I   KD +V     F I   N    ++V  S+ +     ++ +      +  L++N T+ + + D NDN P F         + SSP  S+         +I A D D   N  + + +      H +F I   +G +  I   D E + +++F V  +D+G P
Sbjct:  770 GWLKVF-----APLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEISESSTVGTEVIQVEAKDKDLGDNGVVRYSILAD----TDQFAIDTETGIVTVKKPLDREVQPV------FVLKIAARDQATAEPQLV--STVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMW---LEAHDPDVGPSSQVRYSLI--DSGDGKFEVD---KLSGAVRIVQ-----NLDYEKKQVYSLTAKAKDKGKPISL--SSSCHIEVEVVDVNENLYRPLFPSFVDKGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGSGLGIFTIDEDTGVIRTQ-------ELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPK-DVSIIQIEAFDPDTKSSEKL----SYKITSGNPQGF--FSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKST---TVRVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEG--PNAEISYSIEEGDEQGKFFIE----PKTGMVYSKKLSSAVDYDI--LTIKAVDNGRPQKSTTCRLHIEWIPKPEPSTVPLVFDEPFYTFSVMESDTVSHMLGVISLEPVDTP---VWFEI---------TGGNSDSRFEV------GKASGTMIVAQALDAEQKSHYNLTVNATDGT-------RSVSTQVLIKVIDTNNHRPQFSKPKYEVDVSEDTPPETEV------LRITATDQDEKNKLTYTLLSSTDPFSLRKFRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNLVRVIVNVQDTNDNAPWFSGAPYVGRVFESAATGSAVLQVSALDKDKGQNAEIIYSIESGNVANSFAIDPVLGTITVAKELDRNNKNRFELTVKASD--KGTPPLSGTAAVDITVTISDNAIPKFAE--KEFSAEVSETVLPGAFVSLVTANSQ-----SSVFYQI---KDGNVN--GAFDI---NPNSGVVVTHSVLDYETIPSYKLTIQGTNMAGLASNTTLLIHLKDENDNAPVFIQDQFAGMVSESSPVNSVVLTKDNTPLVIRALDTDRDANSRLVYQIVEPFA-HNYFAIDSSTGAIRTISELDYEQRSVFRFSVQVHDMGIP 1853          

HSP 6 Score: 207.608 bits (527), Expect = 7.801e-53
Identity = 357/1457 (24.50%), Postives = 606/1457 (41.59%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDL---NANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI------LVIRVKNGS------FLDYE--------QIKSINVSI------KGLQIAPVF--NIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIY--SLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYP-PLSTRVIILINVTEINDE--PPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY----FDPSLSFYVDSISGQIFLI-KALDRETVSNLNFTVSCSD-GVFLVNSTVS--ITVLDVNDNEPYFVD--YIQVLNISEVTQVGTIFA-----KFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYK----------LIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFP-----IFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFIL-------QLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEF--FFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILST 4927
            +T   PL  +     +L++   D     ++    I VIDV +  P F+ +SY ++++E +P  T V+TV A D D      V YS+ + N  ++ F I+  SG     +I   E+ D   +   + L V A++          T V I + ++NDN   F+      +V  +   G  I   S I  ++  L      A  +L+    N +S +  +   ++  +A       L I   +G       FL+          Q+K ++  +      K LQ + V   + PED + D       VN   P F ++      + E+ P    I  ++A+D DSG  GK++Y  S  D   +F+ID  +G +         +  LDRE  +   +     D G     ++ ++ +K  D NDN P F    Y   + E+S   T G   ++   KD D+ +N ++   Y++        D F I+  TG VT+  P+DRE  P  +L++       +   +  T +++I ++DVNDN P F    + V V +++   T I++L A D D    P S + Y LI      F V+ +    +GA  I++     + Q  V++ T +A D+G P  LS+   I + V ++N+    P+F   +      E++ IG ++ ++ A D D   D     I+ +I   + SG+          +  +++  G++  Q +LD E        +   D+     + P ++F  + IE+ DVNDN P     ++  S+ E      +I        ++A D D   + +  Y     +P   F ++  +G +    + LDRE        ++ SD GV   ++TV   + VLD NDN P F++  Y   L + E  +           + +A+D D G NA + +               G    I P T  G+ Y K          L I+ +DN R     +KS    +++  +    P     +F + FY FS + E   +  ++G +                 L   DT V+           F + K +  G ++V  +L     + +   VNA D G   +S    V + +ID N++ P F+ P   V  S  + P+        T +  I+ATD+D     ++ + L S         F + P +G L      D ET   +   V+  D   P   + V + V V D +D            N   + G      +  S+ +G  +  V +A+D+D G NA I+Y      V   F +DP  G +   KE DR  K+ +  TV+A   S  G  P   LSG +         V I + I+DN     IP       +F+   S+ V    +V+   +V+ N+           QS +  Q+K+ N++  F +N  SG++ T
Sbjct:  418 ITTAAPLHADSVNKYELEVVTSDKK---AVTKVIIDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGENGYVTYSIANVN--SQPFVIDYFSG-----VISSSETLDYELMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDADELQLVRYRIKAGNDLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFH----SVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLVYVISGGDAESRFIIDMDSGWLKV-------FAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEISESS---TVGTEVIQVEAKDKDLGDNGVVR--YSILAD----TDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVG--PSSQVRYSLIDSGDGKFEVDKL----SGAVRIVQNLDYEKKQ--VYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVDKGFIKEDVPIGTSVMKITAQDEDKGRDGE---IRYSIR--DGSGL---------GIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRG----VVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSI------IQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEGPNAEISYSIEEGDEQ-------GKF-FIEPKT--GMVYSKKLSSAVDYDILTIKAVDNGRP----QKSTTCRLHIEWIPKPEPSTVPLVFDEPFYTFS-VMESDTVSHMLGVIS----------------LEPVDTPVWFEITGGNSDSRFEVGKAS--GTMIVAQALDAEQKSHYNLTVNATD-GTRSVSTQ--VLIKVIDTNNHRPQFSKPKYEVDVSEDTPPE--------TEVLRITATDQDE--KNKLTYTLLSSTDPFSLRKFRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNLVRVIVNVQDTND------------NAPWFSGAPYVGRVFESAATGSAVLQV-SALDKDKGQNAEIIYSIESGNVANSFAIDPVLGTITVAKELDRNNKNRFELTVKA---SDKGTPP---LSGTA--------AVDITVTISDN----AIPKFAEK--EFSAEVSETVLPGAFVS---LVTANS-----------QSSVFYQIKDGNVNGAFDINPNSGVVVT 1719          

HSP 7 Score: 198.749 bits (504), Expect = 3.736e-50
Identity = 290/1133 (25.60%), Postives = 499/1133 (44.04%), Query Frame = 2
Query:  947 PIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLSAVYNNKTSSIFEVYP---IVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK----FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNS-SMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDAD-ESNTPQSDITYRLIGVDSV-NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY--FDPSLS-FYVDSISGQIFLIKALDRETVSNLNFTVSCSDG----VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISAT--DKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            P F    Y   + E  PV T V    A D D      + Y + + +   + F+I+E +GEI     +DRE+     +     +++IA +    +   +   V + + DINDN+  F    Y+ +V  +   G  I+   +I   D D  +NA   Y++    +N   + FE++    ++   ++++ +  +  +FL       +     G       N  + S   V + IL      P F  S Y F I E+    + I V+ A + D  +F  ++   N P       FV+D S+G++  +   + + T    + Y+         +G  +++   + I +KD+NDN P+FE   Y+A++ EN    T   ++VKATD D    N  ++Y   + +    + ++ F IN+ +G +T +  +DRE    +   + V+A D  +   +  +  + + V DVNDN P F    +   V ++      I  L+ TD D E N  Q  I+Y + G D +  F +E        ++ K  P  R +   +   + A+D  +   + + ++ + V + ND  P+  +S +  S  E+   G  I QV+ATD D  +N  ++Y ++            P +  F++ +     +TG +  +   LDRE+      +++ +D         +   A + I + DVNDNPP F T  + F++FE+    + I+T     Y  A+D+D     + LY   D +   F ++  +G + L + LDRE  S        +D         ++TVS+++LD+NDN P F        ++E   VGT   +  A   D  E    I Y   N +      +D   G + +I PL       + L +E  D   GT        V I + DVN+N P+F+Q  Y  + I+E   +G  +  V+A D D   +  V + I+       F +   R       G++ V   L +   + +T  V A DNG P  S++ T+ V + DINDN P F    S +N S     I EN     +++  T  D+D+  NG   F    + G+  +FF I+P  G L +  +  R+T++ Y  +    D G P L S
Sbjct: 2488 PTFNQVDYVVELLENSPVGTLVAEAQATDDDSGTYGRLTYHIVN-DIAKDKFSISE-NGEIFTLESLDRENA----LEKVIPISLIAKDGGGKVGFCT---VNVILTDINDNAPQFRAADYRVNVASDVSRGTTIL---KIAASDMDEGSNADITYSIETDADNVEEN-FEIHQFSGVIVTKESLIGLENQMYTFL-------VRAKDGG-------NPTKSSVVPVYVKILAPEVPVPKFIESHYRFAIEEDLSLGSEIDVIQA-ESDQPVFYSLVKG-NTPESNQDEVFVVDPSSGSLKLDKKLDHEST----KWYQLTLQAQSEYEGSKVVSAVDISIQVKDVNDNRPLFESNPYEAFVVENLPGGT-SVIQVKATDLDSGT-NGHVVYNL-DPNQETRDIVELFAINSESGWITTLKELDRET--RNKYTVSVLATDRGDKVQLMASTRVDVTVVDVNDNPPKFTAEIYKGTVSEDDPPGGVIAILSTTDLDTEENNKQ--ISYFITGGDPLGQFAIEHTQGEWKVSVRK--PLDREEKDNYLLNITATDGTF---TAKAVVEVKVLDANDNSPICEKSFYMESVPEDSPAGRLILQVSATDADIRSNAQISYELLG-----------PGSEHFSIDS-----ETGELKTLLP-LDREEEEVHKMKVRALDGGG------RFCEAEVEITVEDVNDNPPQFTTDPYTFTVFEN----TEINTPVARLY--ASDLDTGANAEILYSLLDSADGVFSIEEETGVVRLDRPLDRELQSLYTLRAQATDRGSPRHLSSHTTVSVSILDINDNPPVFERREYTATVAEDIPVGTQVLRIHAASRDT-EAGTEITYAIINGNERGAFRVDPQTGGVFVIEPLDYETAHEFYLTVEATDG--GTPSLSDLATVNINLTDVNDNSPVFNQDIYS-AVISEDAELGKTVLTVMADDADGPSSNQVRFSIIDGNQGSPFTIDPVR-------GEVKVARLLDREKTSGYTLTVLASDNGSPARSSSATINVDVSDINDNPPIF----SQANYS---IIIQENQPIGASVLQLTVSDRDASHNGP-PFTFSIIRGNEGDFFRITP-QGVLVSAATLSRQTQEFYLLQAQVTDSGRPPLVS 3526          

HSP 8 Score: 193.741 bits (491), Expect = 1.348e-48
Identity = 317/1272 (24.92%), Postives = 532/1272 (41.82%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIID-RESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADV-SIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFD-TCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKY---PNARLQVRVHNFTVEASD---------------RGYPPLSTRVI----------ILINVTEIN--DEP--------------PVFTQSLFS-FSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVS-----ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNF--PIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGA-RFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPV-SPS-NGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNI-RSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLFGIK 4531
            IQV+D  D+ P+F  ++YS ++ E   + T V  V A D D        YS ++   + + F+++ TSG + +   +D  E++        ++L ++A +    L+ SS  F  +  L +  + AN   P+        S+          + VED D  AN +    +V        F+       +K   +  VK    +D++ Q    N++   LQ     N P+ S A V  +         P F  + Y   + E +P  T + +VTA  K    + ++ Y+      K  F I+  +G I T    + D       +  +  +  + +D   +   T VII + D+N+N P F+   Y+A L EN    T   + VKATD D    N  + Y   N++  P      F I+  +G ++    +D E +P  I  L V A D  +    +    + I++ ++NDN P+F        VP++      I  ++A DADE       + YR+   + +N       NP +G +  K         +V  H+  + ASD                 + P+  + +           L+  ++++   EP              P F  +  S     E+L +G  I  ++A+D D+  N  L Y I          SG    S F    +I ++   G + V + LDRE     T  I V D      +P +++   L ++ILD NDN P F    +   + E     S + T       K  D+   G ++Y     +  F +D+ +G + + K LDRE        ++  D        VS     IT+ DVNDN P F+     + + E   +GT+     A+D D G ++ V +   ++    F +  L G + ++  L       Y L  +  D  +  I    S  + + V+DVN N   P+F   F +   I E   IGT + ++ A D+D G +G + Y I      D   L +F I +  D G I     L +     +   V A D GV  LS+   V + + D+NDN P  + PV  PS   SSP+       +++I  I A D D+  + ++ + + S N    FF I+  +G ++   R  DRE +D +   +  +D G P+ ++ V + V VLD +DN P F      +   + E P    ++    +  +++     A D+D G NA I Y I  GD    F+++P +G ++  K
Sbjct:  135 IQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFRE---WTDMFSVHPTSGVVTLTGKLDYSETKQ-------YELEILAVDRGMKLYGSS-GFSSMAKLTVRVDQANDHAPVITAVTLAASETDKDPTYAV-VTVEDNDQGANGEIASLSVVAGDPLQQFKAMRTSPGSKEYQIKAVKQ---VDWDSQPFGYNLT---LQAKDKGNPPQFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAVPK----YPQLKYAFRHRLDKNHFAINPDSGLITTAAPLHAD-------SVNKYELEVVTSDKKAV---TKVIIDVIDVNNNGPEFKQTSYKASLDENMPTGT-SVLTVKATDLDSG-ENGYVTYSIANVNSQP------FVIDYFSGVISSSETLDYELMPR-IYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDADELQL----VRYRIKAGNDLNVF---EMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLVYVI----------SGGDAESRF----IIDMD--SGWLKVFAPLDRETTDHYTLNITVYDLG----IPQKSSSRLLDVKILDANDNSPQFLKETYSVEISE----SSTVGTEVIQVEAKDKDLGDNGVVRYSILADTDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGKFEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGK-PISLSSSCHIEVEVVDVNENLYRPLFPS-FVDKGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSI-----RDGSGLGIFTIDE--DTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPK------DVSIIQ-IEAFDPDTKSSEKLSYKITSGN-PQGFFSINQKTGLVTTTSRKLDREQQDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPV--YRV----IASDKDEGPNAEISYSIEEGDEQGKFFIEPKTGMVYSKK 1311          

HSP 9 Score: 189.119 bits (479), Expect = 3.165e-47
Identity = 347/1366 (25.40%), Postives = 552/1366 (40.41%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYH----VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLY-----QGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWL-----FENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDV---TIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQI--IVQDVNDNAPVF---GLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDS-VNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL----SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVSITV-LDVNDNE-PYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY--FPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGT--IHFKKSKEVGIYVIDVNNNFPIFSQ-----VFYEFSPITE--YTNIGT-IIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPR--LSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLIT-------IISATDKDSGLNGEIRFNLDSMNGD-HEFFFISPISG-----NLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSL-----SGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGI-KEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+  PLD E  P+  L++ A+D A      VS     I + DV D PP F   +Y   + E+LP+ T ++ + A D D    S V+YSL D    +  F +++ SG + I   +D E + +      + LT  A +    +  SS   + ++++D+N+   N  +PL+     +G + E+   G +++   +I  +D+D   + +   S + +     IF       +++   VIR +    LD+E +    +++       V   P  S+ +V I + DVNDN P      Y   + E+SP    I  + A D D+    K+ Y +   +P   F I+  TG + T          LDRE  +   +    +D G     TTV +I+K  D NDN P F  + Y+  L      E        PV RV A+DKD +  N  I Y     S+   +    F I   TG V    + + VD      DIL +  V  D        TC + I  I +      P+       TFSV     +S    ++ L   D     TP   + + + G +S   F V       +G +I        Q   +N TV A+D G   +ST+V  LI V + N+  P F++  +     E+      + ++ ATD D    L Y ++ +T              F++     L+   G++Y    LD E     T  + V D+     +P +     + + + D NDN P F  + +   +FE      + +TG+    V A D D     + +Y   S     SF +D + G I + K LDR   +    TV  SD G   ++ T ++ + + ++DN  P F +      +SE    G   +   AN   +      +FY     N +  F ++ + G +   + L    I  YKL I+      GT       +  + I++ D N+N P+F Q     +  E SP+     T   T ++   L TD+D   N  + Y+I+     + F    F I   +  G I   S L     + F F V   D G+PR        V + I+D+ND  P F+              +YE T+ + T        ++A+D DSG N  + +++  + G+  E F + P++G     N++ +RS        Y+ RV  +D G  S TS V I V                        E  L FT  S  +      S  K   V  AV   +  N  + Y        F +   SG L      FDRE +  +   V      +  D  H               V VII D+NDNPPVF
Sbjct:  875 VTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSG--DGKFEVDKLSGAVRIVQNLDYEKKQV------YSLTAKAKDKGKPISLSSSCHIEVEVVDVNE---NLYRPLFPSFVDKGFIKEDVPIGTSVM---KITAQDEDKGRDGEIRYS-IRDGSGLGIF------TIDEDTGVIRTQE--LLDHETVPHYWLTVYATDRGVV---PLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRK------LDREQQDEHILEITVSDQGVPAKSTTVRVIVKVLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKD-EGPNAEISY-----SIEEGDEQGKFFIEPKTGMVYSKKLSSAVDY-----DILTIKAV--DNGRPQKSTTCRLHIEWIPKPEPSTVPLVFDEPFYTFSVMESDTVSHMLGVISLEPVD-----TP---VWFEITGGNSDSRFEV----GKASGTMIVAQALDAEQKSHYNLTVNATD-GTRSVSTQV--LIKVIDTNNHRPQFSKPKYEVDVSEDTPPETEVLRITATDQDEKNKLTYTLLSST------------DPFSLRKF-RLDPGTGVLYTAERLDHETMHQHTLTVMVRDQD----IPVKRNLVRVIVNVQDTNDNAPWFSGAPYVGRVFE------SAATGSAVLQVSALDKDKGQNAEIIYSIESGNVANSFAIDPVLGTITVAKELDRNNKNRFELTVKASDKGTPPLSGTAAVDITVTISDNAIPKFAEKEFSAEVSETVLPGAFVSLVTANSQSS------VFYQIKDGNVNGAFDINPNSGVVVTHSVLDYETIPSYKLTIQ------GTNMAGLASNTTLLIHLKDENDNAPVFIQDQFAGMVSESSPVNSVVLTKDNTPLVIRALDTDRD--ANSRLVYQIV-----EPFAHNYFAID--SSTGAIRTISELDYEQRSVFRFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQ------------DLYETTVLVPTYKGVEVITVNASDADSGPNSRLFYSI--VEGNIGEKFKMDPVTGVITIQNVTQLRS-------RYELRVRVSD-GRFSKTSLVKINVRENK--------------------ESTLRFTQESYKAFVPENSSEKKTLAVIAAVGNQV--NEPLFYTILNPDKRFTISRTSGVLSSTGTPFDREEQGVFDIVVEVTRDDKSPDVAHVL-------------VTVIIEDVNDNPPVF 2079          

HSP 10 Score: 187.193 bits (474), Expect = 1.301e-46
Identity = 306/1271 (24.08%), Postives = 526/1271 (41.38%), Query Frame = 2
Query: 1136 AMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN----DPFKKF-VIDSSTGAIYTNVNA--NTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFE-NSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNY----------LD--NFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYP---PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLT-GQIQVIDKAAETPLPPQ-------TAFATLRIEILDVNDNPPIFQTSLFQFS----------LFEDFKP------------------KSNISTGATGFYVKATDVD--IVGTLQYLYF--DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNST--VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP-RLSNNCTVAVTIIDINDN-----YPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFY-LDPFSGHLFGI-KEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            + I++RE +D       + LTV A E   +    +RT VRIQ+LD ND    F    Y  S+ EN+    ++   +++M  D D+  N +Y  S     + + +F V+P       ++ +  K    LDY + K   + I    +G+++         S A +++ +   ND+ P+    +      +  P +    VVT  D D G  G+I  SL+    DP ++F  + +S G+    + A    D+   D + +     +  A D G                 NPP    +F  A +    S +F  GP +       V+V+    L+    M    P Y          LD  +F IN  +G +T   P+  + +    L+++      S+       II +I  DVN+N P F   ++  ++ +N+ T T++L + ATD D        +TY +  V+S  F+++      + +    Y    L  R++   V ASD G P    + T+V I++N   +ND  P+F       +   +  +G  I  V+A D D        +++  I A N             N+  +N + G++ ++  L   + + ++   +Q+I    E    P        TA   ++++ +D      +    L Q S           F+DF                    K ++  GA   ++ A+D D    G L Y+    D    F +D  SG + +   LDRET  +    ++  D G+   +S+  + + +LD NDN P F+     + ISE + VGT   +  A D D G+N VV +    ++   F +  + G +T+  PL       + L I   D          +  + I + DVN+N P F    Y    + E   IGT+I  + A D D G +  V Y ++   D        F + K++   +I+ N   +     ++    A D G P  LS++C + V ++D+N+N     +PSF +          +  I E+    T +  I+A D+D G +GEIR+++   +G    F I   +G +      D ET   Y   V A D G   L+S V + + V D++D            N      P+ + S+  SS     I  +  A D D   +  + Y I +G+   F+ ++  +G +    ++ DRE +D +   +  + +S  G           P   +  RV+V +LD NDN P F
Sbjct:  103 SAILNREVRD------HYILTVKAMEKNSNA--EARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSV---AKVMATDADIGTNGEYYYSF---REWTDMFSVHP----TSGVVTLTGK----LDYSETKQYELEILAVDRGMKLYGSSGF--SSMAKLTVRVDQANDHAPVITAVTLAASETDKDPTY---AVVTVEDNDQGANGEIA-SLSVVAGDPLQQFKAMRTSPGSKEYQIKAVKQVDW---DSQPFGYNLTLQ-AKDKG-----------------NPP----QFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAVPKYPQLKYAFRHRLDKNHFAINPDSGLITTAAPLHADSVNKYELEVVT-----SDKKAVTKVIIDVI--DVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGE--NGYVTYSIANVNSQPFVIDYFSGVISSSETLDY---ELMPRIYTLKVRASDWGSPYRREVETQVTIMLN--NLNDNKPLFENVDCDATVPRDHGVGDQITTVSAIDAD-----ELQLVRYRIKAGND-----------LNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAHKPVQVKCVDTG-VASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLVYVISGGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQFLKETYSVEISESSTVGTEVIQVEAKDKDLGDNGVVRYSILADTDQ-FAIDTETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPPNYHVR-VREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGK------FEVDKLSGAVRIVQNLDYEKKQV-YSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPSFVD----------KGFIKEDVPIGTSVMKITAQDEDKGRDGEIRYSIRDGSG-LGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVND------------NAPQTSEPVYYPSVMESSPKDVSIIQIE-AFDPDTKSSEKLSYKITSGNPQGFFSINQKTGLVTTTSRKLDREQQDEH---ILEITVSDQG----------VPAKSTTVRVIVKVLDENDNSPQF 1243          

HSP 11 Score: 181.03 bits (458), Expect = 8.666e-45
Identity = 337/1370 (24.60%), Postives = 563/1370 (41.09%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEI-IIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGS--VYENSQAGVAIIIGS--EIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE--QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD-PSNSSMFDTCIIQII--VQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGA-TGFYVKA--TDVDIVGTLQYLYFDPSLS--FYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GV---FLVNST-VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIF-YYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYE-FSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL---KNLGARFTFIVNAV-DNGVPRLSNNCTVAVTIIDINDNYPSFTN-PVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDL-YKFRVLANDLGTPSLTSAVNIEXXXXXXXXX-------XXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFT-GDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            LD+E  P   L + A D       +F   +I+V DV D  P      Y  ++ E  P D  +I + A D D      + Y +  GNP   +F+IN+ +G +   +  +DRE QD        ++TV + +  P+   + R  V+  +LD NDNS  F + +Y+    V E  +   A+       ++  DKD   NA+ + S    ++    F + P   M     V   K  S +DY+   IK+++            +I      + S   L       +F    YTF + E+     ++GV++    D+ ++ +I    +D   +F +  ++G +            LD E      +   ATDG   ++ T V+I + D N++ P F    Y+  + E++   T   +R+ ATD+D     N++ Y    +S   P  L  F+++  TG +     +D E +    L ++V   D P   ++     +++I  VQD NDNAP F    +   V ++ +T + +L ++A D D+     ++I Y    ++S N       +P  G I       R        TV+ASD+G PPLS    + I VT  ++  P F +  FS    E +  G  +  V A    +     ++ I++                NV     +N   G+V   S+LD E   +    IQ  + A         +  TL I + D NDN P+F    F   + E     S + T   T   ++A  TD D    L Y   +P     F +DS +G I  I  LD E  S   F+V   D G+   F   +  V+I +LDVND  P F   +    +   T  G       A+D+D+G N+  +FY     +      +D    +IT   +  +   Y+L + + D       F K+  V I V +   +   F+Q  Y+ F P  E ++    +  + A      E     +  +L  D      + F I + +    +L ++     +     F  +V    D+  P ++ +  V V I D+NDN P F N P            +  +   +IT ++A D D   N EI ++L  +N   EF  IS   G +S  +  D+++ +  +   V+A D G P+L+S+V + +LV++               P N  L+       P+     ++S                       IVY  T GD +  F ++  +G +  +K  D ET   Y  +VRA             L+G      +E  V +I+ D+NDNPPVF        + + +   + ++++S   TD D  +   L Y I
Sbjct: 1095 LDHETVPHYWLTVYATDRGVVPLSSFVEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAFDPDTKSSEKLSYKITSGNP-QGFFSINQKTGLVTTTSRKLDREQQD----EHILEITV-SDQGVPAKSTTVRVIVK--VLDENDNSPQFMEKVYKIKLPVREKPEKERALKRDPVYRVIASDKDEGPNAEISYSIEEGDEQGKFF-IEPKTGM-----VYSKKLSSAVDYDILTIKAVDNGRPQKSTTCRLHIEWIPKPEPSTVPL-------VFDEPFYTFSVMESDTVSHMLGVISLEPVDTPVWFEITGGNSD--SRFEVGKASGTMIV-------AQALDAEQKSHYNLTVNATDGTRSVS-TQVLIKVIDTNNHRPQFSKPKYEVDVSEDTPPET-EVLRITATDQD---EKNKLTYTL--LSSTDPFSLRKFRLDPGTGVLYTAERLDHETMHQHTLTVMVRDQDIPVKRNL-----VRVIVNVQDTNDNAPWFSGAPYVGRVFESAATGSAVLQVSALDKDKGQ--NAEIIY---SIESGNVANSFAIDPVLGTITVAKELDRNNKNRFELTVKASDKGTPPLSGTAAVDITVTISDNAIPKFAEKEFSAEVSETVLPGAFVSLVTANSQSS----VFYQIKDG---------------NVNGAFDINPNSGVVVTHSVLDYETIPSYKLTIQGTNMAG------LASNTTLLIHLKDENDNAPVFIQDQFAGMVSESSPVNSVVLTKDNTPLVIRALDTDRDANSRLVYQIVEPFAHNYFAIDSSTGAIRTISELDYEQRSVFRFSVQVHDMGIPRHFAEKAANVTIEILDVNDCPPQFSQDLYETTVLVPTYKGVEVITVNASDADSGPNS-RLFYSIVEGNIGEKFKMDPVTGVITIQNVTQLRSRYELRVRVSDG-----RFSKTSLVKINVRENKESTLRFTQESYKAFVP--ENSSEKKTLAVIAAVGNQVNEP---LFYTILNPD------KRFTISRTSG---VLSSTGTPFDREEQGVFDIVVEVTRDDKSPDVA-HVLVTVIIEDVNDNPPVFVNLPY------QALVQVDADVDHIITKVTAVDADINENAEINYHLQELN---EFVQIS-TDGEISLTKKLDKDSVNTEFIITVVARDGGEPALSSSVEVPILVVNKAMPVFEKAFYSLEIPENIQLLT------PIVHIQANDSE-------------------GPRIVYTITEGDPLNQFTINFNTGVIQVVKTLDFETHPAYKLSVRAT----------DSLTGAK----AEVFVDIILEDVNDNPPVFHTKLYNASLSEASVIGTSVLEVS--ATDADTGNNKVLFYQI 2320          

HSP 12 Score: 177.563 bits (449), Expect = 8.836e-44
Identity = 320/1321 (24.22%), Postives = 543/1321 (41.11%), Query Frame = 2
Query: 1292 FDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGS--FLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-------GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVD-------VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTC-IIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEIL--DVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLS-FYVDSISGQIFLIKAL---DRETVSNLNFTVSCSDG------------VFLVNSTVSITVLD--------------------------------VNDNEPYFVD-YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNL-DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXX--XXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRA-----VPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSD 4993
            F Q +Y  ++YENS A   +    ++ +   D     +Y + +  N    ++F+       + + L IR K GS   L+ E      +++K ++     N   ++   V I +LD ND  P+F  ++Y+  + EN+   T +  V ATD D G  G+  YS  +    F +  ++G +   +    DY+  + + YE   +  +A D G       G  +M  + + +   ND+ P+       A   E   + T+  V V+  D+  +       V     L QF  M   P +    ++I A       V  VD +  P     L + A D  N   F +  +I ++        P F    + VNV +    +T ++ + A        PQ    +R   +D  +F +    NP +G I    P     V  +   V  SD+      T+VI  I+V ++N+  P F Q+ +  S  EN+  G ++  V ATD D+  +  Y  +  +I  VNS    ++               G++     LD E    L  +I  +   A     P       ++ I+  ++NDN P+F+      ++  D      I+T      V A D D +  ++Y +     L+ F ++  SG + L + L   +   VS  +  +  SDG            V   +  V +  +D                                VN   P F D +  V+ + E   VG       A+DSD+G N  +++     ++ S F + +D G+L +  PL      +Y L I + D   G      S+ + + ++D N+N P F +  Y    I+E + +GT + +V A DKD G+NG V Y IL   DTD F +         + G + V   L + +   F   + A D     P+L +   + +T+ D+NDN P F  P       +    + E+    T+I  + A D D G + ++R++L DS +G    F +  +SG +  +++ D E K +Y     A D G P SL+S+ +IEV V+D+++N   P+FPS ++   F   + P+          S  KI    TA D D G +  I Y I  G  + +F +D  +G +   +  D ET   Y  TV A     VP+S +                    V + + D+NDN P  + P     +++ +  +  I+ I  +  D D  S   L+Y I +  P                 F++N  +G+++T      ++  D  I + I VSD
Sbjct:   32 FTQSVYNATIYENSAAKTYVESPVKMGIYITDPTWEIRYKIVSGDNE---NLFKAEDYHLGDFSFLRIRTKGGSSAILNREVRDHYILTVKAMEK----NSNAEARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFREWTDMFSVHPTSGVV--TLTGKLDYS--ETKQYE---LEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAA--SETDKDPTYAVVTVEDNDQGANGEIASLSVVAGDPLQQFKAMRTSPGS--KEYQIKA-------VKQVDWDSQPFG-YNLTLQAKDKGNPPQFSSAKVIHVMSPHFKVGPPKFIQAIYRVNVSEFAPLHTPVVMVTAV----PKYPQLKYAFRH-RLDKNHFAI----NPDSGLITTAAPLHADSVNKYELEVVTSDKK---AVTKVI--IDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSG-ENGY--VTYSIANVNSQPFVIDYF------------SGVISSSETLDYE----LMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDATVPRDHGVGDQITT------VSAIDADELQLVRYRIKAGNDLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLVYVISGGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYD--LGIPQKSSSRLLDVKILDANDNSPQFLKETYSVE-ISESSTVGTEVIQVEAKDKDLGDNGVVRYSIL--ADTDQFAID-------TETGIVTVKKPLDREVQPVFVLKIAARDQATAEPQLVSTVLLKITLEDVNDNPPKFIPP-------NYHVRVREDLPIGTVIMWLEAHDPDVGPSSQVRYSLIDSGDGK---FEVDKLSGAVRIVQNLDYEKKQVYSLTAKAKDKGKPISLSSSCHIEVEVVDVNENLYRPLFPS-FVDKGFIKEDVPI--------GTSVMKI----TAQDEDKGRDGEIRYSIRDGSGLGIFTIDEDTGVIRTQELLDHETVPHYWLTVYATDRGVVPLSSF------------------VEVYIEVQDVNDNAPQTSEPVYYPSVMESSPKDVSIIQIEAF--DPDTKSSEKLSYKITSGNP--------------QGFFSINQKTGLVTTTSRKLDREQQDEHI-LEITVSD 1217          

HSP 13 Score: 109.768 bits (273), Expect = 3.307e-23
Identity = 227/971 (23.38%), Postives = 386/971 (39.75%), Query Frame = 2
Query: 1970 PIFEVRFYQAWLFENSYNFTF--GPVR--VKATDKDVDV------ANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYP-----PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYS-TLTGQIQVIDKAAETPLPPQTAFATLRIEILDVN--DNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY---FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK-SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ----LFRIQKVNDKG----------QILVNSSLKNLGARFTFI----------VNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQF-----SIYENTITL-----ITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPI-SGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            P+F    Y A ++ENS   T+   PV+  +  TD   ++       +N  L++  +  +G  ++L   +I    G   I+    R+        +L V     NS+      ++I V D ND  P+F    +S+++P+N +  T++  + ATDAD     +   ++R        +      +P +G +         + + +   + A DRG         S+   + + V + ND  PV T    + S  +  D    +  V   D   N ++A   +         +G P+     +    G  +       Q   D + +   LT  +Q  DK      PPQ + A + I ++  +    PP F  ++++ ++ E F P            V  T V     L+Y +    D +  F ++  SG I     L  ++V+     V  SD   +  + V I V+DVN+N P F       ++ E    GT      A D D+GEN  V +   N +S PF +     +   +    Y +      +++  +  G+ + ++   +V I + ++N+N P+F  V  + + +     +G  I  V A D D  E   V Y+I    D +VF +     +  +++   +G          QI+ +         F  I          V  VD GV  +     +  + +                N  +PQF     S+ E    L     I  +SA+D DSG NG++ + +    GD E  FI  + SG L      DRET D Y   +   DLG P  +S+  ++V +LD +DN P F    L   +S+         IS SS  G ++  V  A D+D+G N ++ Y    DT  F +D  +G +   K  DRE +  +   + A   +              P   S   + + + D+NDNPP F  P
Sbjct:   30 PLFTQSVYNATIYENSAAKTYVESPVKMGIYITDPTWEIRYKIVSGDNENLFKAEDYHLGDFSFL---RIRTKGGSSAILNREVRDHY------ILTVKAMEKNSNAEARTRVRIQVLDTNDLRPLFSPTAYSISLPENTAIRTSVAKVMATDADIGTNGEYYYSFR-------EWTDMFSVHPTSGVVTLTGKLDYSETKQYELEILAVDRGMKLYGSSGFSSMAKLTVRVDQANDHAPVITAVTLAASETDK-DPTYAVVTVEDNDQGANGEIASLSV--------VAGDPLQQFKAMRTSPGSKEYQIKAVKQVDWDSQPFGYNLT--LQAKDKGN----PPQFSSAKV-IHVMSPHFKVGPPKFIQAIYRVNVSE-FAPLHTP-------VVMVTAVPKYPQLKYAFRHRLDKN-HFAINPDSGLITTAAPLHADSVNKYELEVVTSDKKAV--TKVIIDVIDVNNNGPEFKQTSYKASLDENMPTGTSVLTVKATDLDSGENGYVTYSIANVNSQPFVIDYFSGVISSSETLDYELMPRIYTLKVRASDWGSPYRREVETQVTIMLNNLNDNKPLFENVDCDAT-VPRDHGVGDQITTVSAIDAD--ELQLVRYRIKAGNDLNVFEMNPSSGVLSLKQTLSEGEAAKVSYHSLQIIASDGEHETQPMFLNITVVTAHKPVQVKCVDTGVASMLAEKLLQGSKVHTQSEPEDHFQDFHSVNRVAPQFADTFPSVIEVKEDLPVGARIVHLSASDSDSGFNGKLVYVIS--GGDAESRFIIDMDSGWLKVFAPLDRETTDHYTLNITVYDLGIPQKSSSRLLDVKILDANDNSPQF----LKETYSV--------EISESSTVGTEVIQVE-AKDKDLGDNGVVRYSILADTDQFAIDTETGIVTVKKPLDREVQPVFVLKIAARDQAT-----------AEPQLVSTVLLKITLEDVNDNPPKFIPP 928          
BLAST of Cadherin-23 vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 389.808 bits (1000), Expect = 5.053e-109
Identity = 460/1639 (28.07%), Postives = 729/1639 (44.48%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNE-ELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVY-ENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDG-----GGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVD---VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF-ATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTI---HFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS--NSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIIL-DINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVN--FISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFV---WMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTN 5548
            T   P D E+    +L +  +D       +    ++ ++D  D  P+F++  Y  T +E  L +++ ++T TA+D D      V YS+  GN   E F+IN  +G I +   +D E        G + L V AT+  P +    +S   V + + DINDN   F +P Y+G       Q G  +   +    +DKD   N Q   S V  +    +   + I ++   +   RV+    LD E I   N++I         N P  S A V I +LD+NDN PI  N      I EN+P  T I  + A+D D+G    + +++   +    F I+ +TG +Y N         LDRE      +     D          +   +I+ + D NDN P+F    Y A L ENS   T      GPV   A D D+    V + R+L    N+          F IN STG VT+     +DRE   N IL L +VA D     +  T  + + V D NDN P+F  ++ +V++ +N     +++ + ATDAD     Q  ++YR+       F+++A     TG I +      R +   +   V A+D+G  PLS  + + I + ++ND PP F   + + S  E+ ++G  + +V A D D N  L Y+II+       +S +P     N   +  +N   G V V+S L+RE  +T    I V D A+E      +A  A L + ILDVNDN P F+    + F   + E   P      G T   V A D D    G + Y   +   + Y+   D+++G+I   + +D E V  LNFTV  SD      S    V + ++D+NDN P F        + E  Q+G    +  A D+D+G  A++ +   +     FG++   G + +++ L      +Y L     DNP G I     + S +V I V+DVN+  P FS+  +  S + E    GT +  + ATD D G+NG V+Y  L    ++ F++         D G I     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R+NL    +   D E+F I   SG +      DRE + +Y   ++A DLG P    + + ++V + D+DDN P F             G L + ++S    S  G  +GNV+ AVD D G NA++ Y I TG+    +L    G L  +K  DRE +  YS  V+A     +  G +S    + P   S  + V + L DIND PP FT P    G+   A   S+++ +     D D+ + + + Y I  I      S+ + ++KN     +FA+  T+GI+ T       +PG F  D         I   D    N D  +V    +   Q++  VI   P  V      F   LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y ++D +  + +  P    +    + +A+     +L +   +F+   W Y +  +++ R F    +  M N+N     G N
Sbjct:  446 TRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGN-VQETFSINNATGLIRVVKELDYEV-----CLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP-YEGPFEITEGQPGPRV---ATFKADDKDSGLNGQVEYSIVGGD----LLGDFVISSVEGDL---RVRKDYELDRENIAFYNITIMAKDRG---NPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQ-------LDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVL--ALDNDIGSNAVVSYRLLGAQINL----------FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIG--KLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQ--LSYRIESGAQDRFLIDAF----TGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIP-----NQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP------GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-FGINPTTGDIYILSTLDREKKDHYTLTAIARDNP-GDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTS-VYENEPEGTSVITMSATDLDEGDNGVVTYN-LEGPGSEAFLID-------KDSGLITSRRLLQSF-ERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVF---VRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAF--------IRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLLIPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPG-NSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKV--LAVDADVGNNSLVFYSILGIRYIKLNSNDSVEVKN-----IFAIENTTGIVRTFDLFTAYSPGYFIVD---------IKAVDLAGHN-DTAVVGIYILRDDQRLKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDMLIHVVNRDTNRILDVERVIQMIDENKEQLRNLFRNYNVMDVQPATTAQAP----EDLSALQMAIIILAILLFLAAMLFIFMNWYYPTSDEIRNRGFM--DILDMPNTNKYSFEGAN 1979          

HSP 2 Score: 261.151 bits (666), Expect = 3.123e-69
Identity = 360/1385 (25.99%), Postives = 580/1385 (41.88%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNE---YFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG--SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-----QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGL---NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSV-NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKA---LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---KILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN-----NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS-NSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LT    LDYE      + + A D A   +  F   ++ +++  D    F + +Y + + E +   T V+ V A    RS+ +  Q S K D   + +    F I+E +G I +  ++DRE  D      F+ L V+A +  P         V I +LD NDNS  FD P      +V E+   G  + +   +   D D   N     S    N  S IFE             IR  N +  +   IKSI+  ++ L     Q +   + P  S   +++ + DVNDN P+F     Y   ++EN    T +  V ATDKD G+   + Y +    +   F +D  TG I T   A  D    +++++ +L V         L   TTV + + D NDN P+F+   Y+    E   +     +   A D+D +  N  + Y     S+   N  + F IN +TG + +V  +D E +      L+V A D        +  T  + + V D+NDN P F       F +   Q       +    A D D     Q  + Y ++G D + +F++ +V       + K Y   R  +  +N T+ A DRG PP S+  ++ I V +IND  P+      + S  EN  +   I ++ A+D DT  N  L + I                   N+ N   +N+  GIVYV   LDREK S     I V D   E     +  F  L + I D NDN P+F    +   L E+    + I+           D+     + Y      ++ +  + S  +  ++A   +DRE+  N  L+ T+   D +  +NST    +TVLD NDN P F      +++ E +  G    K  A D+D+G N  + +   + +   F +     +  +  +T+       YKLI+   D  +G +    S  V I + DVN+  P F       S + E   +GT++ EV A D+D   N  + Y   +IL   DT+  I     + ++N K G ++V S+L + L A +   ++  DN    +       N  + V I+D+NDN P F     P   ++    I E      T+I  SA D D G NG+I ++L ++           ++G +   R+ D E      F V A+D G+P  ++ V +          +     N  + + S Y+ P+ F  I   +++   K      A D D G  ALI Y        F ++P +G ++ +   DRE KD Y+ T  A       D P    S       +  +V++ +LD+ND  P F+       + +     + ++ +S   TD D      +TY +E
Sbjct:  125 LTTIDYLDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQA----RSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD------FYTLIVVADDGGPK---KDSAVVSITVLDENDNSPQFD-PTSDSVVNVPEDCPTGRRVAL---VQARDPDDGNNGLVTFSLTAGNP-SGIFE-------------IRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRP-APPDR---EKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQD-EGPNGTVTY-----SISAGNVQETFSINNATGLIRVVKELDYE-VCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQ---PGPRVATFKADDKDSGLNGQ--VEYSIVGGDLLGDFVISSVEGDL--RVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAG----------------NLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN-PENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAED-IGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATD--QGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVS-VLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRF----RPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPV-------YLQIVDINDNNPIFSQSSYQKPV-FEDIQLGATVLQIK------ATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDHYTLTAIA------RDNPGDIASNRRE---NSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMS--ATDLDEGDNGVVTYNLE 1408          

HSP 3 Score: 248.054 bits (632), Expect = 3.585e-65
Identity = 382/1381 (27.66%), Postives = 587/1381 (42.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSA-------YHVSINFTFIQVIDVEDVPPIFQNS-SYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNS--SMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSD--ITYRLIGVDSVNFIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-----LYFDPSLS--------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV--------NSTVSITVLDVNDNEPYFVDYIQVL---NISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTL--------ITPLTI--YGIFYYKLIIEIMDN--PRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDN----GVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS--IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIR---SFDRETKDLYKFRVLANDLGTPSL--TSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF------TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            L   +D E   +  L++QA DS        Y +++N     V DV D PP+F     Y+ ++ E +   T VI V A D D+ L S + Y +  GN  +  F ++  +GEI       DRE Q       F+ L V +  E  P+L  S+ T V + ILD NDNS  F  P+Y+ +  E   +  ++I+ +  + +D+  N    Y++SA    +T SI         N A  +IRV     LDYE  +    + +      P+      S A V + + D+NDN P F       F I E  P    +    A DKDSG+ G++ YS+   D    FVI S  G    ++    DY L DRE      +  +A D G     +T ++ ++  D+NDN PI         + EN+   T  P+ R+ A+D   D   N +L   +N++ G  N  + F IN +TG V +   +DREKI    L +  V  +P N+  S  D  ++ + + D NDN P+F   ++   + +N    T I  LN       N   S+  ++YRL+G     F +     V   + G +I +         + + T+ A D G   L++   +++ V + ND  P+F+ S  +    EN   G ++ +V ATD D+  N  L+Y I          SG     L +         TG I      +DRE+  T    +   D+ A     P +   T+ I I DVND PP F   +   S+ E      +   G     V A D D+   L+Y     L  D + S        F ++  +G + +   L+RE V+  + T+S  D    V        N+ +++ +LDVNDN P F  +        I E    GT      A D D G N  + +   N       L   GYL L        I   T+    + +    +   DN  PR      +S EV +Y  ++D+N+N PIFSQ  Y+  P+ E   +G  + ++ ATD D G    + Y ++  +         F I      G I + S+L +     +T    A DN       R  N+  V +T++D+ND  P F         S  QFS  +YEN    T +  +SATD D G NG + +NL+      E F I   SG +++ R   SF+R     +   V+A D G P L  T+ + ++V+ ++ +  + V P N  +++    E PL  T                 A D D G N  + Y        T D   F +D  SG +      DRE +  Y+  + A  + Q    P  + +   P         V + DI+DN P F  P
Sbjct:  340 LIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVN-----VNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNE-DLTFRMDRLTGEIATRPAPPDREKQ------SFYKLVVTVEDEGNPAL--SATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSI---------NNATGLIRVVKE--LDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPG-PRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEG----DLRVRKDYEL-DRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVST--PITRILASD--ADTGRNALLT--FNITAG--NLENAFSINENTGIVYVNRQLDREKISEYKLTI-TVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDR---ESFLNPILDLTLVAEDIGK--LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRI---------ESGAQDRFLIDAF-------TGVIRVANVTVDREEKDTYKLIVVATDQGAV----PLSGSITVSILIDDVNDCPPEFVNPIQTVSVLE------SAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHN-------LVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPR------RSAEVPVYLQIVDINDNNPIFSQSSYQ-KPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-------FGINPTT--GDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQF---------SKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPG--SEAFLIDKDSGLITSRRLLQSFER-----FNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIK-EEIPLKSTVYE------------VYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQ----PVPYET-MLPLQ-------VALDDIDDNEPAFIRP 1585          

HSP 4 Score: 214.542 bits (545), Expect = 5.556e-55
Identity = 317/1123 (28.23%), Postives = 495/1123 (44.08%), Query Frame = 2
Query: 1589 PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF-TLIGVVTATDKDSGIFGKIIYS-LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNM--TTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSL-FSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRE-TVSNLNFTVSCSDGVFLVN------STVSITVLDVNDNEPYFVD-YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNS-SSPFGL-SLDGYLTLIT--PLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNC-----TVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIIS----ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS---FDRET--KDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHL-FGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            P  S   V I + DVND  P+F    Y+ +    +    T + VV ATD+D+G  G + Y  ++    KF ID+STG + T      DY  LD E     ++   ATD     N    T+ + L +  D    F    Y+A + EN    T   VRV+A   D     N++ Y+F   +      L  FKI+  TG +T+   VDREK   D   L+VVA D       D+ ++ I V D NDN+P F   + S VNVP++  T   +  + A D D+ N     +T+ L  G  S  F +    N      + K  +  +Q  ++   V+ASD G PP  +   + +NV ++ND PPVF +   ++ S YEN+  G ++ +VNATD D   N  L+Y+I Q   +            F +  L     TG I    +  DREK S     + V D+      P  +A  T+ + ILD NDN P+F++ +++ +     + +  +S  +      A D D    GT+ Y     ++  +F +++ +G I ++K LD E  +      V+ +D   +V       +TV + V D+NDN P F   Y     I+E  Q G   A F A+D D+G N  V +          F + S++G L +     L    I +Y   I IM   RG   F  +  V I V+D+N+N PI   +    S I+E T + T I  +LA+D D G N  +++ I      + F +         + G + VN  L +   + +   +   DN  P  + N       + VTI D NDN P FT         S    + EN+   T IT+++    A D D G N  + + L  +      F I+  +G ++ +R+    DRE+    +    ++A D+G  + T+ + + VL  +               N  I+        +  +S  GF +  V TA D D G N  + Y I +G    F +D F+G +       DRE KDTY   V A               G  P + S   V ++I D+ND PP F  P     +++ A   + + +++    D+D+  +  L Y+I
Sbjct:   47 PMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKIISGADGKFDIDASTGLLTT-----IDY--LDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGT-EVVRVQARSID---NLNQLSYKFDQTTYA--QALALFKIDEITGAITVKGLVDREK--GDFYTLIVVADD--GGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGN--NGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQ-ELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLT----------FRMDRL-----TGEIATRPAPPDREKQSFYKLVVTVEDEGN----PALSATTTVYVTILDENDNSPVFKSPVYEVT-----RDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYN--ITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNIS-ISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN-------ENTGIVYVNRQLDREKISEYKLTITVKDN--PENARNSRRDFDVLIVTISDENDNRPLFTQ-------GSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVT-VRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDAND--------------NRPIFSPSSVTVHLRENSPPGFSVVKV-TATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQ------------GAVPLSGS-ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVT--AIDRDLNPR--LEYYI 1070          

HSP 5 Score: 186.808 bits (473), Expect = 1.563e-46
Identity = 271/971 (27.91%), Postives = 421/971 (43.36%), Query Frame = 2
Query: 2138 NFKINASTGDVTI-VTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIK-KYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN--DEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI----VGTLQYLYFDPSLSFYVDSIS---GQIFLIKALDRETVSNLNFTVSCSD-GVFLVNS--TVSITVLDVNDNEPYFVDYIQVLNISEVTQV--GTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYL-TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP----RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-TLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSF--DRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYV--TDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPG 4936
            NF+I+ +TG +   V P+DRE   N    L+V AY+     M  +  + I V+DVND  PVF    +S + + + +   T++  + ATD D  +     +TY++I      F ++A     TG +    Y +   +   +   V A+D+  P    R    I VT +N  DE   FT   +     EN+  G  + +V A   D    L+Y   Q T                   L  +++  G + V+ ++DREK    T  I V D        P+   A + I +LD NDN P F  TS    ++ ED        TG     V+A D D     + T      +PS  F + + +   G++FLIK++DRE        V  SD G     S  T+++ V DVNDN P F D     N+S    V  GT   +  A D D G N+V+ +Y    N    F +  L G + T   P       +YKL++ + D   G      +  V + ++D N+N P+F    YE +      ++ ++I    A D+D G NG V+Y I      + F +     L R+ K  D    L          R+T IV A D   P    RL++  TV V + DINDN+P+F  P          F I E      +    A DKDSGLNG++ +++    + GD   F IS + G+L   + +  DRE    Y   ++A D G P  +S   +E+ VLD++DN P+  +  L  N SI E     T I+              A D D G NAL+ +  T   +   F ++  +G ++  ++ DRE    Y  T+         D P +  +    F+     ++V I D NDN P+FT  + L  + + +   + I  ++  V   D DI S   ++Y +         L AQ+       +F +N ++G+++   G
Sbjct:    9 NFRIDVNTGLIMRGVQPLDRET--NSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGD--GGLVTYKIISGADGKFDIDA----STGLLTTIDYLDYETKT-TYYMNVSATDQAVP--FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQLSYKFDQTT-------------YAQALALFKIDEITGAITVKGLVDREKGDFYT-LIVVADDGG-----PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPED------CPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVF-DKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVED--EGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCL---------GRYTLIVTATDR-CPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGP------FEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGD---FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQNISISENTPVSTPITR-----------ILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITV------KDNPENARNSRRDFDV----LIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL---------LGAQIN------LFTINNSTGVVTVRAG 883          

HSP 6 Score: 179.874 bits (455), Expect = 2.024e-44
Identity = 278/1048 (26.53%), Postives = 439/1048 (41.89%), Query Frame = 2
Query: 1766 SLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDT-NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSL-FQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY--LYFDPSLSFYVDSISGQIFLIKA-LDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYI-QVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTI-YGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSG--HLFGIKEFDRET--KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIEN 4831
            S+ +    F ID +TG I   V        LDRE  +   L V A  +D G + +   VII ++D+ND  P+F  + Y       +         V+ATD+D       + Y+  + + G       F I+ASTG +T +  +D E        + V A D +       C I + + +  D    F   T+   + +NI+T T ++ + A   D  N     ++Y+         +     +  TGAI  K    R +   +   V A D G  P     ++ I V + ND  P F  +  S  +  E+   G  +  V A DPD  N  L  F    ++ A N SG+     F +      N T G V++   +DRE     T ++Q  D  +    PP+ +  TL + + DVNDNPP+F     +  S++E      N+  G +   V ATD D  +   L Y     +  L+F +D ++G+I    A  DRE  S     V+  D         +TV +T+LD NDN P F   + +V        + ++     A D D G N  V +     N    F + +  G + ++  L     +  Y LI+   D  P        +  V + V D+N+N+P F + +     ITE    G  +    A DKD G NG V Y I+        +L  F I  V    ++  +  L     A +   + A D G P  S+   V + ++DINDN P   N   P N      SI ENT   T IT I A+D D+G N  + FN+ + N ++  F I+  +G +   R  DRE    YK  +   D    +  S  + +VL++ + D     P    L     Y   LT  S   + ++   +     A+D DIG NA++ Y   G  + +F ++  +G   +   K  DRE+        T+ A  + +                 S AR+V+ +LD NDN P+F+  ++   + + + P   +V ++   TD D      L+Y IE+
Sbjct:    2 SIGNEKTNFRIDVNTGLIMRGVQP------LDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTG-DGGLVTYKIISGADG------KFDIDASTGLLTTIDYLDYET--KTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLN----QLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGG--PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTF----SLTAGNPSGI-----FEIRT---TNNTLGEVFLIKSIDREVQELYTLKVQASDSGS----PPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYE------NVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGD-----LLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQN-----ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENA-FSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRP----LFTQGSYLAELTENSPEGTPIT--VLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLN---------------STARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVT--ATDADSGINQQLSYRIES 969          
BLAST of Cadherin-23 vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 389.423 bits (999), Expect = 7.859e-109
Identity = 463/1641 (28.21%), Postives = 731/1641 (44.55%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNE-ELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVY-ENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDG-----GGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVD---VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF-ATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTI---HFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS--NSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIIL-DINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVN--FISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFV---WMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTN 5548
            T   P D E+    +L +  +D       +    ++ ++D  D  P+F++  Y  T +E  L +++ ++T TA+D D      V YS+  GN   E F+IN  +G I +   +D E        G + L V AT+  P +    +S   V + + DINDN   F +P Y+G       Q G  +   +    +DKD   N Q   S V  +    +   + I ++   +   RV+    LD E I   N++I         N P  S A V I +LD+NDN PI  N      I EN+P  T I  + A+D D+G    + +++   +    F I+ +TG +Y N         LDRE      +     D          +   +I+ + D NDN P+F    Y A L ENS   T      GPV   A D D+    V + R+L    N+          F IN STG VT+     +DRE   N IL L +VA D     +  T  + + V D NDN P+F  ++ +V++ +N     +++ + ATDAD     Q  ++YR+       F+++A     TG I +      R +   +   V A+D+G  PLS  + + I + ++ND PP F   + + S  E+ ++G  + +V A D D N  L Y+II+       +S +P     N   +  +N   G V V+S L+RE  +T    I V D A+E      +A  A L + ILDVNDN P F+    + F   + E   P      G T   V A D D    G + Y   +   + Y+   D+++G+I   + +D E V  LNFTV  SD      S    V + ++D+NDN P F        + E  Q+G    +  A D+D+G  A++ +   +     FG++   G + +++ L      +Y L     DNP G I     + S +V I V+DVN+  P FS+  +  S + E    GT +  + ATD D G+NG V+Y  L    ++ F++         D G I     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+     I E      T+  + ATD D GLNG +R+NL    +   D E+F I   SG +      DRE + +Y   ++A DLG P    + + ++V + D+DDN P F             G L + ++S    S  G  +GNV+ AVD D G NA++ Y I TG+    +L    G L  +K  DRE +  YS  V+A     +  G +S    + P   S  + V + L DIND PP FT P    G+   A   S+++ +     D D+ + + + Y I  I      S+ + ++KN     +FA+  T+GI+ T       +PG F  D         I   D    N D  +V    +   Q++  VI   P  V      F   LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y ++D +  + +  P    +    + +A+     +L +   +F+   W Y +  +++ R F    +  M N+N     G N
Sbjct:  446 TRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGN-VQETFSINNATGLIRVVKELDYEV-----CLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP-YEGPFEITEGQPGPRV---ATFKADDKDSGLNGQVEYSIVGGD----LLGDFVISSVEGDL---RVRKDYELDRENIAFYNITIMAKDRG---NPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQ-------LDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVL--ALDNDIGSNAVVSYRLLGAQINL----------FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIG--KLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQ--LSYRIESGAQDRFLIDAF----TGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIP-----NQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP------GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-FGINPTTGDIYILSTLDREKKDHYTLTAIARDNP-GDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTS-VYENEPEGTSVITMSATDLDEGDNGVVTYN-LEGPGSEAFLID-------KDSGLITSRRLLQSF-ERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVF---VRPPNGTI--LHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAF--------IRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLLIPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPG-NSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKV--LAVDADVGNNSLVFYSILGIRYIKLNSNDSVEVKN-----IFAIENTTGIVRTFDLFTAYSPGYFIVD---------IKAVDLAGHN-DTAVVGIYILRDDQRLKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDMLIHVVNRDTNRILDVERVIQMIDENKEQLRNLFRNYNVMDVQPATTAQAP----EDLSALQMAIIILAILLFLAAMLFIFMNWYYPTSDEIRNRGFM--DILDMPNTNKYSFEGAN 1979          

HSP 2 Score: 260.381 bits (664), Expect = 5.825e-69
Identity = 362/1387 (26.10%), Postives = 578/1387 (41.67%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNE---YFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG--SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-----QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGL---NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSV-NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKA---LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---KILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN-----NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS-NSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LT    LDYE      + + A D A   +  F   ++ +++  D    F + +Y + + E +   T V+ V A    RS+ +  Q S K D   + +    F I+E +G I +  ++DRE  D      F+ L V+A +  P         V I +LD NDNS  FD P      +V E+   G  + +   +   D D   N     S    N  S IFE             IR  N +  +   IKSI+  ++ L     Q +   + P  S   +++ + DVNDN P+F     Y   ++EN    T +  V ATDKD G+   + Y +    +   F +D  TG I T           DRE      +V    D G   L   TTV + + D NDN P+F+   Y+    E   +     +   A D+D +  N  + Y     S+   N  + F IN +TG + +V  +D E +      L+V A D        +  T  + + V D+NDN P F       F +   Q       +    A D D     Q  + Y ++G D + +F++ +V       + K Y   R  +  +N T+ A DRG PP S+  ++ I V +IND  P+      + S  EN  +   I ++ A+D DT  N  L + I                +  N+ N   +N+  GIVYV   LDREK S     I V D   E     +  F  L + I D NDN P+F    +   L E+    + I+           D+     + Y      ++ +  + S  +  ++A   +DRE+  N  L+ T+   D +  +NST    +TVLD NDN P F      +++ E +  G    K  A D+D+G N  + +   + +   F +     +  +  +T+       YKLI+   D  +G +    S  V I + DVN+  P F       S + E   +GT++ EV A D+D   N  + Y   +IL   DT+  I     + ++N K G ++V S+L + L A +   ++  DN    +       N  + V I+D+NDN P F     P   ++    I E      T+I  SA D D G NG+I ++L ++           ++G +   R+ D E      F V A+D G+P  ++ V +          +     N  + + S Y+ P+ F  I   +++   K      A D D G  ALI Y        F ++P +G ++ +   DRE KD Y+ T  A       D P    S       +  +V++ +LD+ND  P F+       + +     + ++ +S   TD D      +TY +E
Sbjct:  125 LTTIDYLDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQA----RSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD------FYTLIVVADDGGPK---KDSAVVSITVLDENDNSPQFD-PTSDSVVNVPEDCPTGRRVAL---VQARDPDDGNNGLVTFSLTAGNP-SGIFE-------------IRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPP------DREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQD-EGPNGTVTY-----SISAGNVQETFSINNATGLIRVVKELDYE-VCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQ---PGPRVATFKADDKDSGLNGQ--VEYSIVGGDLLGDFVISSVEGDL--RVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNI----------------TAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN-PENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAED-IGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATD--QGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVS-VLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRF----RPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPV-------YLQIVDINDNNPIFSQSSYQKPV-FEDIQLGATVLQIK------ATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDHYTLTAIA------RDNPGDIASNRRE---NSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMS--ATDLDEGDNGVVTYNLE 1408          

HSP 3 Score: 247.284 bits (630), Expect = 5.197e-65
Identity = 382/1381 (27.66%), Postives = 587/1381 (42.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSA-------YHVSINFTFIQVIDVEDVPPIFQNS-SYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNS--SMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSD--ITYRLIGVDSVNFIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-----LYFDPSLS--------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV--------NSTVSITVLDVNDNEPYFVDYIQVL---NISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTL--------ITPLTI--YGIFYYKLIIEIMDN--PRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDN----GVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS--IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIR---SFDRETKDLYKFRVLANDLGTPSL--TSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF------TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            L   +D E   +  L++QA DS        Y +++N     V DV D PP+F     Y+ ++ E +   T VI V A D D+ L S + Y +  GN  +  F ++  +GEI       DRE Q       F+ L V +  E  P+L  S+ T V + ILD NDNS  F  P+Y+ +  E   +  ++I+ +  + +D+  N    Y++SA    +T SI         N A  +IRV     LDYE  +    + +      P+      S A V + + D+NDN P F       F I E  P    +    A DKDSG+ G++ YS+   D    FVI S  G    ++    DY L DRE      +  +A D G     +T ++ ++  D+NDN PI         + EN+   T  P+ R+ A+D   D   N +L   +N++ G  N  + F IN +TG V +   +DREKI    L +  V  +P N+  S  D  ++ + + D NDN P+F   ++   + +N    T I  LN       N   S+  ++YRL+G     F +     V   + G +I +         + + T+ A D G   L++   +++ V + ND  P+F+ S  +    EN   G ++ +V ATD D+  N  L+Y I          SG     L +         TG I      +DRE+  T    +   D+ A     P +   T+ I I DVND PP F   +   S+ E      +   G     V A D D+   L+Y     L  D + S        F ++  +G + +   L+RE V+  + T+S  D    V        N+ +++ +LDVNDN P F  +        I E    GT      A D D G N  + +   N       L   GYL L        I   T+    + +    +   DN  PR      +S EV +Y  ++D+N+N PIFSQ  Y+  P+ E   +G  + ++ ATD D G    + Y ++  +         F I      G I + S+L +     +T    A DN       R  N+  V +T++D+ND  P F         S  QFS  +YEN    T +  +SATD D G NG + +NL+      E F I   SG +++ R   SF+R     +   V+A D G P L  T+ + ++V+ ++ +  + V P N  +++    E PL  T                 A D D G N  + Y        T D   F +D  SG +      DRE +  Y+  + A  + Q    P  + +   P         V + DI+DN P F  P
Sbjct:  340 LIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVN-----VNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNE-DLTFRMDRLTGEIATRPAPPDREKQ------SFYKLVVTVEDEGNPAL--SATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSI---------NNATGLIRVVKE--LDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPG-PRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEG----DLRVRKDYEL-DRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVST--PITRILASD--ADTGRNALLT--FNITAG--NLENAFSINENTGIVYVNRQLDREKISEYKLTI-TVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDR---ESFLNPILDLTLVAEDIGK--LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRI---------ESGAQDRFLIDAF-------TGVIRVANVTVDREEKDTYKLIVVATDQGAV----PLSGSITVSILIDDVNDCPPEFVNPIQTVSVLE------SAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHN-------LVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPR------RSAEVPVYLQIVDINDNNPIFSQSSYQ-KPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-------FGINPTT--GDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQF---------SKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPG--SEAFLIDKDSGLITSRRLLQSFER-----FNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIK-EEIPLKSTVYE------------VYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQ----PVPYET-MLPLQ-------VALDDIDDNEPAFIRP 1585          

HSP 4 Score: 214.542 bits (545), Expect = 5.765e-55
Identity = 317/1123 (28.23%), Postives = 495/1123 (44.08%), Query Frame = 2
Query: 1589 PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF-TLIGVVTATDKDSGIFGKIIYS-LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNM--TTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSL-FSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRE-TVSNLNFTVSCSDGVFLVN------STVSITVLDVNDNEPYFVD-YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNS-SSPFGL-SLDGYLTLIT--PLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNC-----TVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIIS----ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS---FDRET--KDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHL-FGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            P  S   V I + DVND  P+F    Y+ +    +    T + VV ATD+D+G  G + Y  ++    KF ID+STG + T      DY  LD E     ++   ATD     N    T+ + L +  D    F    Y+A + EN    T   VRV+A   D     N++ Y+F   +      L  FKI+  TG +T+   VDREK   D   L+VVA D       D+ ++ I V D NDN+P F   + S VNVP++  T   +  + A D D+ N     +T+ L  G  S  F +    N      + K  +  +Q  ++   V+ASD G PP  +   + +NV ++ND PPVF +   ++ S YEN+  G ++ +VNATD D   N  L+Y+I Q   +            F +  L     TG I    +  DREK S     + V D+      P  +A  T+ + ILD NDN P+F++ +++ +     + +  +S  +      A D D    GT+ Y     ++  +F +++ +G I ++K LD E  +      V+ +D   +V       +TV + V D+NDN P F   Y     I+E  Q G   A F A+D D+G N  V +          F + S++G L +     L    I +Y   I IM   RG   F  +  V I V+D+N+N PI   +    S I+E T + T I  +LA+D D G N  +++ I      + F +         + G + VN  L +   + +   +   DN  P  + N       + VTI D NDN P FT         S    + EN+   T IT+++    A D D G N  + + L  +      F I+  +G ++ +R+    DRE+    +    ++A D+G  + T+ + + VL  +               N  I+        +  +S  GF +  V TA D D G N  + Y I +G    F +D F+G +       DRE KDTY   V A               G  P + S   V ++I D+ND PP F  P     +++ A   + + +++    D+D+  +  L Y+I
Sbjct:   47 PMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKIISGADGKFDIDASTGLLTT-----IDY--LDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGT-EVVRVQARSID---NLNQLSYKFDQTTYA--QALALFKIDEITGAITVKGLVDREK--GDFYTLIVVADD--GGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGN--NGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQ-ELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLT----------FRMDRL-----TGEIATRPAPPDREKQSFYKLVVTVEDEGN----PALSATTTVYVTILDENDNSPVFKSPVYEVT-----RDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYN--ITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNIS-ISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN-------ENTGIVYVNRQLDREKISEYKLTITVKDN--PENARNSRRDFDVLIVTISDENDNRPLFTQ-------GSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVT-VRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDAND--------------NRPIFSPSSVTVHLRENSPPGFSVVKV-TATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQ------------GAVPLSGS-ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVT--AIDRDLNPR--LEYYI 1070          

HSP 5 Score: 187.193 bits (474), Expect = 1.393e-46
Identity = 271/971 (27.91%), Postives = 421/971 (43.36%), Query Frame = 2
Query: 2138 NFKINASTGDVTI-VTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIK-KYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN--DEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI----VGTLQYLYFDPSLSFYVDSIS---GQIFLIKALDRETVSNLNFTVSCSD-GVFLVNS--TVSITVLDVNDNEPYFVDYIQVLNISEVTQV--GTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYL-TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP----RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-TLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSF--DRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYV--TDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPG 4936
            NF+I+ +TG +   V P+DRE   N    L+V AY+     M  +  + I V+DVND  PVF    +S + + + +   T++  + ATD D  +     +TY++I      F ++A     TG +    Y +   +   +   V A+D+  P    R    I VT +N  DE   FT   +     EN+  G  + +V A   D    L+Y   Q T                   L  +++  G + V+ ++DREK    T  I V D        P+   A + I +LD NDN P F  TS    ++ ED        TG     V+A D D     + T      +PS  F + + +   G++FLIK++DRE        V  SD G     S  T+++ V DVNDN P F D     N+S    V  GT   +  A D D G N+V+ +Y    N    F +  L G + T   P       +YKL++ + D   G      +  V + ++D N+N P+F    YE +      ++ ++I    A D+D G NG V+Y I      + F +     L R+ K  D    L          R+T IV A D   P    RL++  TV V + DINDN+P+F  P          F I E      +    A DKDSGLNG++ +++    + GD   F IS + G+L   + +  DRE    Y   ++A D G P  +S   +E+ VLD++DN P+  +  L  N SI E     T I+              A D D G NAL+ +  T   +   F ++  +G ++  ++ DRE    Y  T+         D P +  +    F+     ++V I D NDN P+FT  + L  + + +   + I  ++  V   D DI S   ++Y +         L AQ+       +F +N ++G+++   G
Sbjct:    9 NFRIDVNTGLIMRGVQPLDRET--NSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDG--GLVTYKIISGADGKFDIDA----STGLLTTIDYLDYETKT-TYYMNVSATDQAVP--FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQLSYKFDQTT-------------YAQALALFKIDEITGAITVKGLVDREKGDFYT-LIVVADDGG-----PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPED------CPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVF-DKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVED--EGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCL---------GRYTLIVTATDR-CPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGP------FEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGD---FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQNISISENTPVSTPITR-----------ILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITV------KDNPENARNSRRDFDV----LIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL---------LGAQIN------LFTINNSTGVVTVRAG 883          

HSP 6 Score: 179.489 bits (454), Expect = 2.546e-44
Identity = 277/1040 (26.63%), Postives = 436/1040 (41.92%), Query Frame = 2
Query: 1790 FVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDT-NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSL-FQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY--LYFDPSLSFYVDSISGQIFLIKA-LDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYI-QVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTI-YGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSG--HLFGIKEFDRET--KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIEN 4831
            F ID +TG I   V        LDRE  +   L V A  +D G + +   VII ++D+ND  P+F  + Y       +         V+ATD+D       + Y+  + + G       F I+ASTG +T +  +D E        + V A D +       C I + + +  D    F   T+   + +NI+T T ++ + A   D  N     ++Y+         +     +  TGAI  K    R +   +   V A D G  P     ++ I V + ND  P F  +  S  +  E+   G  +  V A DPD  N  L  F    ++ A N SG+     F +      N T G V++   +DRE     T ++Q  D  +    PP+ +  TL + + DVNDNPP+F     +  S++E      N+  G +   V ATD D  +   L Y     +  L+F +D ++G+I    A  DRE  S     V+  D         +TV +T+LD NDN P F   + +V        + ++     A D D G N  V +     N    F + +  G + ++  L     +  Y LI+   D  P        +  V + V D+N+N+P F + +     ITE    G  +    A DKD G NG V Y I+        +L  F I  V    ++  +  L     A +   + A D G P  S+   V + ++DINDN P   N   P N      SI ENT   T IT I A+D D+G N  + FN+ + N ++  F I+  +G +   R  DRE    YK  +   D    +  S  + +VL++ + D     P    L     Y   LT  S   + ++   +     A+D DIG NA++ Y   G  + +F ++  +G   +   K  DRE+        T+ A  + +                 S AR+V+ +LD NDN P+F+  ++   + + + P   +V ++   TD D      L+Y IE+
Sbjct:   10 FRIDVNTGLIMRGVQP------LDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTG-DGGLVTYKIISGADG------KFDIDASTGLLTTIDYLDYET--KTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLN----QLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGG--PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTF----SLTAGNPSGI-----FEIRT---TNNTLGEVFLIKSIDREVQELYTLKVQASDSGS----PPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYE------NVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGD-----LLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQN-----ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENA-FSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRP----LFTQGSYLAELTENSPEGTPIT--VLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLN---------------STARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVT--ATDADSGINQQLSYRIES 969          

HSP 7 Score: 163.31 bits (412), Expect = 2.531e-39
Identity = 229/781 (29.32%), Postives = 340/781 (43.53%), Query Frame = 2
Query: 2444 IGVDSVNFIVEAVYNPKTGAIIKK-YPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDTNCD--LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY----FDPSLS-FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-VSITVLDVNDNEPYF-VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLSLD----GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR--FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK-DLYKFRVLAND---LGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVAT--AVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIK--EFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            IG +  NF ++      TG I++   P  R     H   VEA +    P+ + V ++I V ++NDE PVFTQ  +S     E + IG ++  V ATD DT     + Y II         SG   +  F++      + + G++     LD E  +T    +   D+A    +P    F T+ + +++  D    F +  ++  + E      NI+TG     V+A  +D +  L Y +    +  +L+ F +D I+G I +   +DRE        V   DG    +S  VSITVLD NDN P F      V+N+ E    G   A   A D D G N +V F     N S  F +       G + LI  +       Y L ++  D+  G+   +    + + V DVN+N P+F + F     + E    GT +  V ATDKD G N  +SY I  Q + D+     FR+ ++   G+I    +  +   +  +  +V   D G P LS   TV VTI+D NDN P F +PV          S+  N++ L T  +A D+D G NG + +++ + N   E F I+  +G +  ++  D E     Y   V A D   +    LTS   + V V D++DN P FP          YEGP   T        G     VAT  A D+D G N  + Y   G  ++  F +    G L   K  E DRE    Y+ T+ A               G  PF  S A V + +LDINDN P+ 
Sbjct:    3 IGNEKTNFRIDV----NTGLIMRGVQPLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKII---------SG--ADGKFDI------DASTGLLTTIDYLDYETKTTYYMNVSATDQA----VPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIE------NIATGTEVVRVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDS--GSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYI-TQGNEDL----TFRMDRLT--GEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSL--NSVILTT--TAVDQDEGPNGTVTYSISAGNV-QETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP--------YEGPFEIT-------EGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKD------------RGNPPF-SSTAVVEIRVLDINDNDPIL 710          
BLAST of Cadherin-23 vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 388.652 bits (997), Expect = 1.185e-108
Identity = 460/1639 (28.07%), Postives = 729/1639 (44.48%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNE-ELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVY-ENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDG-----GGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVD---VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF-ATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTI---HFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS--NSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIIL-DINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVN--FISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFV---WMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTN 5548
            T   P D E+    +L +  +D       +    ++ ++D  D  P+F++  Y  T +E  L +++ ++T TA+D D      V YS+  GN   E F+IN  +G I +   +D E        G + L V AT+  P +    +S   V + + DINDN   F +P Y+G       Q G  +   +    +DKD   N Q   S V  +    +   + I ++   +   RV+    LD E I   N++I         N P  S A V I +LD+NDN PI  N      I EN+P  T I  + A+D D+G    + +++   +    F I+ +TG +Y N         LDRE      +     D          +   +I+ + D NDN P+F    Y A L ENS   T      GPV   A D D+    V + R+L    N+          F IN STG VT+     +DRE   N IL L +VA D     +  T  + + V D NDN P+F  ++ +V++ +N     +++ + ATDAD     Q  ++YR+       F+++A     TG I +      R +   +   V A+D+G  PLS  + + I + ++ND PP F   + + S  E+ ++G  + +V A D D N  L Y+II+       +S +P     N   +  +N   G V V+S L+RE  +T    I V D A+E      +A  A L + ILDVNDN P F+    + F   + E   P      G T   V A D D    G + Y   +   + Y+   D+++G+I   + +D E V  LNFTV  SD      S    V + ++D+NDN P F        + E  Q+G    +  A D+D+G  A++ +   +     FG++   G + +++ L      +Y L     DNP G I     + S +V I V+DVN+  P FS+  +  S + E    GT +  + ATD D G+NG V+Y  L    ++ F++         D G I     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R+NL    +   D E+F I   SG +      DRE + +Y   ++A DLG P    + + ++V + D+DDN P F             G L + ++S    S  G  +GNV+ AVD D G NA++ Y I TG+    +L    G L  +K  DRE +  YS  V+A     +  G +S    + P   S  + V + L DIND PP FT P    G+   A   S+++ +     D D+ + + + Y I  I      S+ + ++KN     +FA+  T+GI+ T       +PG F  D         I   D    N D  +V    +   Q++  VI   P  V      F   LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y ++D +  + +  P    +    + +A+     +L +   +F+   W Y +  +++ R F    +  M N+N     G N
Sbjct:  446 TRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGN-VQETFSINNATGLIRVVKELDYEV-----CLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP-YEGPFEITEGQPGPRV---ATFKADDKDSGLNGQVEYSIVGGD----LLGDFVISSVEGDL---RVRKDYELDRENIAFYNITIMAKDRG---NPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQ-------LDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVL--ALDNDIGSNAVVSYRLLGAQINL----------FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIG--KLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQ--LSYRIESGAQDRFLIDAF----TGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIP-----NQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP------GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-FGINPTTGDIYILSTLDREKKDHYTLTAIARDNP-GDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTS-VYENEPEGTSVITMSATDLDEGDNGVVTYN-LEGPGSEAFLID-------KDSGLITSRRLLQSF-ERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVF---VRPPNGTILHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAF--------IRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLLIPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPG-NSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKV--LAVDADVGNNSLVFYSILGIRYIKLNSNDSVEVKN-----IFAIENTTGIVRTFDLFTAYSPGYFIVD---------IKAVDLAGHN-DTAVVGIYILRDDQRLKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDMLIHVVNRDTNRILDVERVIQMIDENKEQLRNLFRNYNVMDVQPATTAQAP----EDLSALQMAIIILAILLFLAAMLFIFMNWYYPTSDEIRNRGFM--DILDMPNTNKYSFEGAN 1979          

HSP 2 Score: 259.61 bits (662), Expect = 8.499e-69
Identity = 362/1387 (26.10%), Postives = 578/1387 (41.67%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNE---YFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG--SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-----QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGL---NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSV-NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKA---LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---KILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN-----NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS-NSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LT    LDYE      + + A D A   +  F   ++ +++  D    F + +Y + + E +   T V+ V A    RS+ +  Q S K D   + +    F I+E +G I +  ++DRE  D      F+ L V+A +  P         V I +LD NDNS  FD P      +V E+   G  + +   +   D D   N     S    N  S IFE             IR  N +  +   IKSI+  ++ L     Q +   + P  S   +++ + DVNDN P+F     Y   ++EN    T +  V ATDKD G+   + Y +    +   F +D  TG I T           DRE      +V    D G   L   TTV + + D NDN P+F+   Y+    E   +     +   A D+D +  N  + Y     S+   N  + F IN +TG + +V  +D E +      L+V A D        +  T  + + V D+NDN P F       F +   Q       +    A D D     Q  + Y ++G D + +F++ +V       + K Y   R  +  +N T+ A DRG PP S+  ++ I V +IND  P+      + S  EN  +   I ++ A+D DT  N  L + I                +  N+ N   +N+  GIVYV   LDREK S     I V D   E     +  F  L + I D NDN P+F    +   L E+    + I+           D+     + Y      ++ +  + S  +  ++A   +DRE+  N  L+ T+   D +  +NST    +TVLD NDN P F      +++ E +  G    K  A D+D+G N  + +   + +   F +     +  +  +T+       YKLI+   D  +G +    S  V I + DVN+  P F       S + E   +GT++ EV A D+D   N  + Y   +IL   DT+  I     + ++N K G ++V S+L + L A +   ++  DN    +       N  + V I+D+NDN P F     P   ++    I E      T+I  SA D D G NG+I ++L ++           ++G +   R+ D E      F V A+D G+P  ++ V +          +     N  + + S Y+ P+ F  I   +++   K      A D D G  ALI Y        F ++P +G ++ +   DRE KD Y+ T  A       D P    S       +  +V++ +LD+ND  P F+       + +     + ++ +S   TD D      +TY +E
Sbjct:  125 LTTIDYLDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQA----RSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD------FYTLIVVADDGGPK---KDSAVVSITVLDENDNSPQFD-PTSDSVVNVPEDCPTGRRVAL---VQARDPDDGNNGLVTFSLTAGNP-SGIFE-------------IRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPP------DREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQD-EGPNGTVTY-----SISAGNVQETFSINNATGLIRVVKELDYE-VCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQ---PGPRVATFKADDKDSGLNGQ--VEYSIVGGDLLGDFVISSVEGDL--RVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNI----------------TAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN-PENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAED-IGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATD--QGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVS-VLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRF----RPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPV-------YLQIVDINDNNPIFSQSSYQKPV-FEDIQLGATVLQIK------ATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDHYTLTAIA------RDNPGDIASNRRE---NSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMS--ATDLDEGDNGVVTYNLE 1408          

HSP 3 Score: 246.899 bits (629), Expect = 8.198e-65
Identity = 381/1381 (27.59%), Postives = 587/1381 (42.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSA-------YHVSINFTFIQVIDVEDVPPIFQNS-SYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNS--SMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSD--ITYRLIGVDSVNFIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-----LYFDPSLS--------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV--------NSTVSITVLDVNDNEPYFVDYIQVL---NISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTL--------ITPLTI--YGIFYYKLIIEIMDN--PRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDN----GVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS--IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIR---SFDRETKDLYKFRVLANDLGTPSL--TSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF------TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            L   +D E   +  L++QA DS        Y +++N     V DV D PP+F     Y+ ++ E +   T VI V A D D+ L S + Y +  GN  +  F ++  +GEI       DRE Q       F+ L V +  E  P+L  S+ T V + ILD NDNS  F  P+Y+ +  E   +  ++I+ +  + +D+  N    Y++SA    +T SI         N A  +IRV     LDYE  +    + +      P+      S A V + + D+NDN P F       F I E  P    +    A DKDSG+ G++ YS+   D    FVI S  G    ++    DY L DRE      +  +A D G     +T ++ ++  D+NDN PI         + EN+   T  P+ R+ A+D   D   N +L   +N++ G  N  + F IN +TG V +   +DREKI    L +  V  +P N+  S  D  ++ + + D NDN P+F   ++   + +N    T I  LN       N   S+  ++YRL+G     F +     V   + G +I +         + + T+ A D G   L++   +++ V + ND  P+F+ S  +    EN   G ++ +V ATD D+  N  L+Y I          SG     L +         TG I      +DRE+  T    +   D+ A     P +   T+ I I DVND PP F   +   S+ E      +   G     V A D D+   L+Y     L  D + S        F ++  +G + +   L+RE V+  + T+S  D    V        N+ +++ +LDVNDN P F  +        I E    GT      A D D G N  + +   N       L   GYL L        I   T+    + +    +   DN  PR      +S EV +Y  ++D+N+N PIFSQ  Y+  P+ E   +G  + ++ ATD D G    + Y ++  +         F I      G I + S+L +     +T    A DN       R  N+  V +T++D+ND  P F         S  QFS  +YEN    T +  +SATD D G NG + +NL+      E F I   SG +++ R   SF+R     +   V+A D G P L  T+ + ++V+ ++ +  + V P N  +++    E PL  T                 A D D G N  + Y        T D   F +D  SG +      DRE +  Y+  + A  + Q    P  + +           + V + DI+DN P F  P
Sbjct:  340 LIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVN-----VNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNE-DLTFRMDRLTGEIATRPAPPDREKQ------SFYKLVVTVEDEGNPAL--SATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSI---------NNATGLIRVVKE--LDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPG-PRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEG----DLRVRKDYEL-DRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVST--PITRILASD--ADTGRNALLT--FNITAG--NLENAFSINENTGIVYVNRQLDREKISEYKLTI-TVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDR---ESFLNPILDLTLVAEDIGK--LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRI---------ESGAQDRFLIDAF-------TGVIRVANVTVDREEKDTYKLIVVATDQGAV----PLSGSITVSILIDDVNDCPPEFVNPIQTVSVLE------SAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHN-------LVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPR------RSAEVPVYLQIVDINDNNPIFSQSSYQ-KPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-------FGINPTT--GDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQF---------SKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPG--SEAFLIDKDSGLITSRRLLQSFER-----FNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIK-EEIPLKSTVYE------------VYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQ----PVPYETMLP--------LQVALDDIDDNEPAFIRP 1585          

HSP 4 Score: 213.772 bits (543), Expect = 9.682e-55
Identity = 317/1123 (28.23%), Postives = 495/1123 (44.08%), Query Frame = 2
Query: 1589 PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF-TLIGVVTATDKDSGIFGKIIYS-LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNM--TTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSL-FSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRE-TVSNLNFTVSCSDGVFLVN------STVSITVLDVNDNEPYFVD-YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNS-SSPFGL-SLDGYLTLIT--PLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNC-----TVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIIS----ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS---FDRET--KDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHL-FGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            P  S   V I + DVND  P+F    Y+ +    +    T + VV ATD+D+G  G + Y  ++    KF ID+STG + T      DY  LD E     ++   ATD     N    T+ + L +  D    F    Y+A + EN    T   VRV+A   D     N++ Y+F   +      L  FKI+  TG +T+   VDREK   D   L+VVA D       D+ ++ I V D NDN+P F   + S VNVP++  T   +  + A D D+ N     +T+ L  G  S  F +    N      + K  +  +Q  ++   V+ASD G PP  +   + +NV ++ND PPVF +   ++ S YEN+  G ++ +VNATD D   N  L+Y+I Q   +            F +  L     TG I    +  DREK S     + V D+      P  +A  T+ + ILD NDN P+F++ +++ +     + +  +S  +      A D D    GT+ Y     ++  +F +++ +G I ++K LD E  +      V+ +D   +V       +TV + V D+NDN P F   Y     I+E  Q G   A F A+D D+G N  V +          F + S++G L +     L    I +Y   I IM   RG   F  +  V I V+D+N+N PI   +    S I+E T + T I  +LA+D D G N  +++ I      + F +         + G + VN  L +   + +   +   DN  P  + N       + VTI D NDN P FT         S    + EN+   T IT+++    A D D G N  + + L  +      F I+  +G ++ +R+    DRE+    +    ++A D+G  + T+ + + VL  +               N  I+        +  +S  GF +  V TA D D G N  + Y I +G    F +D F+G +       DRE KDTY   V A               G  P + S   V ++I D+ND PP F  P     +++ A   + + +++    D+D+  +  L Y+I
Sbjct:   47 PMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKIISGADGKFDIDASTGLLTT-----IDY--LDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGT-EVVRVQARSID---NLNQLSYKFDQTTYA--QALALFKIDEITGAITVKGLVDREK--GDFYTLIVVADD--GGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGN--NGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQ-ELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLT----------FRMDRL-----TGEIATRPAPPDREKQSFYKLVVTVEDEGN----PALSATTTVYVTILDENDNSPVFKSPVYEVT-----RDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYN--ITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNIS-ISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN-------ENTGIVYVNRQLDREKISEYKLTITVKDN--PENARNSRRDFDVLIVTISDENDNRPLFTQ-------GSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVT-VRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDAND--------------NRPIFSPSSVTVHLRENSPPGFSVVKV-TATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQ------------GAVPLSGS-ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVT--AIDRDLNPR--LEYYI 1070          

HSP 5 Score: 186.422 bits (472), Expect = 1.867e-46
Identity = 271/971 (27.91%), Postives = 421/971 (43.36%), Query Frame = 2
Query: 2138 NFKINASTGDVTI-VTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIK-KYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN--DEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI----VGTLQYLYFDPSLSFYVDSIS---GQIFLIKALDRETVSNLNFTVSCSD-GVFLVNS--TVSITVLDVNDNEPYFVDYIQVLNISEVTQV--GTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYL-TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP----RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-TLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSF--DRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYV--TDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPG 4936
            NF+I+ +TG +   V P+DRE   N    L+V AY+     M  +  + I V+DVND  PVF    +S + + + +   T++  + ATD D  +     +TY++I      F ++A     TG +    Y +   +   +   V A+D+  P    R    I VT +N  DE   FT   +     EN+  G  + +V A   D    L+Y   Q T                   L  +++  G + V+ ++DREK    T  I V D        P+   A + I +LD NDN P F  TS    ++ ED        TG     V+A D D     + T      +PS  F + + +   G++FLIK++DRE        V  SD G     S  T+++ V DVNDN P F D     N+S    V  GT   +  A D D G N+V+ +Y    N    F +  L G + T   P       +YKL++ + D   G      +  V + ++D N+N P+F    YE +      ++ ++I    A D+D G NG V+Y I      + F +     L R+ K  D    L          R+T IV A D   P    RL++  TV V + DINDN+P+F  P          F I E      +    A DKDSGLNG++ +++    + GD   F IS + G+L   + +  DRE    Y   ++A D G P  +S   +E+ VLD++DN P+  +  L  N SI E     T I+              A D D G NAL+ +  T   +   F ++  +G ++  ++ DRE    Y  T+         D P +  +    F+     ++V I D NDN P+FT  + L  + + +   + I  ++  V   D DI S   ++Y +         L AQ+       +F +N ++G+++   G
Sbjct:    9 NFRIDVNTGLIMRGVQPLDRET--NSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDG--GLVTYKIISGADGKFDIDA----STGLLTTIDYLDYETKT-TYYMNVSATDQAVP--FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQLSYKFDQTT-------------YAQALALFKIDEITGAITVKGLVDREKGDFYT-LIVVADDGG-----PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPED------CPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVF-DKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVED--EGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCL---------GRYTLIVTATDR-CPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGP------FEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGD---FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQNISISENTPVSTPITR-----------ILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITV------KDNPENARNSRRDFDV----LIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL---------LGAQIN------LFTINNSTGVVTVRAG 883          

HSP 6 Score: 179.104 bits (453), Expect = 3.357e-44
Identity = 277/1039 (26.66%), Postives = 435/1039 (41.87%), Query Frame = 2
Query: 1790 FVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDT-NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSL-FQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY--LYFDPSLSFYVDSISGQIFLIKA-LDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYI-QVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTI-YGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSG--HLFGIKEFDRET--KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            F ID +TG I   V        LDRE  +   L V A  +D G + +   VII ++D+ND  P+F  + Y       +         V+ATD+D       + Y+  + + G       F I+ASTG +T +  +D E        + V A D +       C I + + +  D    F   T+   + +NI+T T ++ + A   D  N     ++Y+         +     +  TGAI  K    R +   +   V A D G  P     ++ I V + ND  P F  +  S  +  E+   G  +  V A DPD  N  L  F    ++ A N SG+     F +      N T G V++   +DRE     T ++Q  D  +    PP+ +  TL + + DVNDNPP+F     +  S++E      N+  G +   V ATD D  +   L Y     +  L+F +D ++G+I    A  DRE  S     V+  D         +TV +T+LD NDN P F   + +V        + ++     A D D G N  V +     N    F + +  G + ++  L     +  Y LI+   D  P        +  V + V D+N+N+P F + +     ITE    G  +    A DKD G NG V Y I+        +L  F I  V    ++  +  L     A +   + A D G P  S+   V + ++DINDN P   N   P N      SI ENT   T IT I A+D D+G N  + FN+ + N ++  F I+  +G +   R  DRE    YK  +   D    +  S  + +VL++ + D     P    L     Y   LT  S   + ++   +     A+D DIG NA++ Y   G  + +F ++  +G   +   K  DRE+        T+ A  + +                 S AR+V+ +LD NDN P+F+  ++   + + + P   +V ++   TD D      L+Y IE
Sbjct:   10 FRIDVNTGLIMRGVQP------LDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTG-DGGLVTYKIISGADG------KFDIDASTGLLTTIDYLDYET--KTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQ----LSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGG--PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTF----SLTAGNPSGI-----FEIRT---TNNTLGEVFLIKSIDREVQELYTLKVQASDSGS----PPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYE------NVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGD-----LLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQN-----ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENA-FSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRP----LFTQGSYLAELTENSPEGTPIT--VLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLN---------------STARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVT--ATDADSGINQQLSYRIE 968          

HSP 7 Score: 162.925 bits (411), Expect = 3.231e-39
Identity = 229/781 (29.32%), Postives = 340/781 (43.53%), Query Frame = 2
Query: 2444 IGVDSVNFIVEAVYNPKTGAIIKK-YPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDTNCD--LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY----FDPSLS-FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-VSITVLDVNDNEPYF-VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLSLD----GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR--FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK-DLYKFRVLAND---LGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVAT--AVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIK--EFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            IG +  NF ++      TG I++   P  R     H   VEA +    P+ + V ++I V ++NDE PVFTQ  +S     E + IG ++  V ATD DT     + Y II         SG   +  F++      + + G++     LD E  +T    +   D+A    +P    F T+ + +++  D    F +  ++  + E      NI+TG     V+A  +D +  L Y +    +  +L+ F +D I+G I +   +DRE        V   DG    +S  VSITVLD NDN P F      V+N+ E    G   A   A D D G N +V F     N S  F +       G + LI  +       Y L ++  D+  G+   +    + + V DVN+N P+F + F     + E    GT +  V ATDKD G N  +SY I  Q + D+     FR+ ++   G+I    +  +   +  +  +V   D G P LS   TV VTI+D NDN P F +PV          S+  N++ L T  +A D+D G NG + +++ + N   E F I+  +G +  ++  D E     Y   V A D   +    LTS   + V V D++DN P FP          YEGP   T        G     VAT  A D+D G N  + Y   G  ++  F +    G L   K  E DRE    Y+ T+ A               G  PF  S A V + +LDINDN P+ 
Sbjct:    3 IGNEKTNFRIDV----NTGLIMRGVQPLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKII---------SG--ADGKFDI------DASTGLLTTIDYLDYETKTTYYMNVSATDQA----VPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIE------NIATGTEVVRVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDS--GSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYI-TQGNEDL----TFRMDRLT--GEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSL--NSVILTT--TAVDQDEGPNGTVTYSISAGNV-QETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP--------YEGPFEIT-------EGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKD------------RGNPPF-SSTAVVEIRVLDINDNDPIL 710          
BLAST of Cadherin-23 vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 387.882 bits (995), Expect = 1.956e-108
Identity = 451/1575 (28.63%), Postives = 705/1575 (44.76%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNE-ELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVY-ENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDG-----GGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVD---VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF-ATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTI---HFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS--NSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIIL-DINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVN--FISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTP 5359
            T   P D E+    +L +  +D       +    ++ ++D  D  P+F++  Y  T +E  L +++ ++T TA+D D      V YS+  GN   E F+IN  +G I +   +D E        G + L V AT+  P +    +S   V + + DINDN   F +P Y+G       Q G  +   +    +DKD   N Q   S V  +    +   + I ++   +   RV+    LD E I   N++I         N P  S A V I +LD+NDN PI  N      I EN+P  T I  + A+D D+G    + +++   +    F I+ +TG +Y N         LDRE      +     D          +   +I+ + D NDN P+F    Y A L ENS   T      GPV   A D D+    V + R+L    N+          F IN STG VT+     +DRE   N IL L +VA D     +  T  + + V D NDN P+F  ++ +V++ +N     +++ + ATDAD     Q  ++YR+       F+++A     TG I +      R +   +   V A+D+G  PLS  + + I + ++ND PP F   + + S  E+ ++G  + +V A D D N  L Y+II+       +S +P     N   +  +N   G V V+S L+RE  +T    I V D A+E      +A  A L + ILDVNDN P F+    + F   + E   P      G T   V A D D    G + Y   +   + Y+   D+++G+I   + +D E V  LNFTV  SD      S    V + ++D+NDN P F        + E  Q+G    +  A D+D+G  A++ +   +     FG++   G + +++ L      +Y L     DNP G I     + S +V I V+DVN+  P FS+  +  S + E    GT +  + ATD D G+NG V+Y  L    ++ F++         D G I     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+     I E      T+  + ATD D GLNG +R+NL    +   D E+F I   SG +      DRE + +Y   ++A DLG P    + + ++V + D+DDN P F             G L + ++S    S  G  +GNV+ AVD D G NA++ Y I TG+    +L    G L  +K  DRE +  YS  V+A     +  G +S    + P   S  + V + L DIND PP FT P    G+   A   S+++ +     D D+ + + + Y I  I      S+ + ++KN     +FA+  T+GI+ T       +PG F  D         I   D    N D  +V    +   Q++  VI   P  V      F   LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y ++D +  + +  P
Sbjct:  432 TRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGN-VQETFSINNATGLIRVVKELDYEV-----CLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP-YEGPFEITEGQPGPRV---ATFKADDKDSGLNGQVEYSIVGGD----LLGDFVISSVEGDL---RVRKDYELDRENIAFYNITIMAKDRG---NPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQ-------LDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVL--ALDNDIGSNAVVSYRLLGAQINL----------FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIG--KLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQ--LSYRIESGAQDRFLIDAF----TGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIP-----NQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP------GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-FGINPTTGDIYILSTLDREKKDHYTLTAIARDNP-GDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTS-VYENEPEGTSVITMSATDLDEGDNGVVTYN-LEGPGSEAFLID-------KDSGLITSRRLLQSF-ERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVF---VRPPNGTI--LHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAF--------IRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLLIPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPG-NSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKV--LAVDADVGNNSLVFYSILGIRYIKLNSNDSVEVKN-----IFAIENTTGIVRTFDLFTAYSPGYFIVD---------IKAVDLAGHN-DTAVVGIYILRDDQRLKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDMLIHVVNRDTNRILDVERVIQMIDENKEQLRNLFRNYNVMDVQPATTAQAP 1905          

HSP 2 Score: 260.381 bits (664), Expect = 5.639e-69
Identity = 362/1387 (26.10%), Postives = 577/1387 (41.60%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNE---YFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG--SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-----QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGL---NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSV-NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKA---LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---KILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN-----NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS-NSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LT    LDYE      + + A D A   +  F   ++ +++  D    F + +Y + + E +   T V+ V A    RS+ +  Q S K D   + +    F I+E +G I +  ++DRE  D      F+ L V+A +  P         V I +LD NDNS  FD P      +V E+   G  + +   +   D D   N     S    N  S IFE             IR  N +  +   IKSI+  ++ L     Q +   + P  S   +++ + DVNDN P+F     Y   ++EN    T +  V ATDKD G+   + Y +    +   F +D  TG I T           DRE      +V    D G   L   TTV + + D NDN P+F+   Y+    E   +     +   A D+D +  N  + Y     S+   N  + F IN +TG + +V  +D E +      L+V A D        +  T  + + V D+NDN P F       F +   Q       +    A D D     Q  + Y ++G D + +F++ +V       + K Y   R  +  +N T+ A DRG PP S+  ++ I V +IND  P+      + S  EN  +   I ++ A+D DT  N  L + I                   N+ N   +N+  GIVYV   LDREK S     I V D   E     +  F  L + I D NDN P+F    +   L E+    + I+           D+     + Y      ++ +  + S  +  ++A   +DRE+  N  L+ T+   D +  +NST    +TVLD NDN P F      +++ E +  G    K  A D+D+G N  + +   + +   F +     +  +  +T+       YKLI+   D  +G +    S  V I + DVN+  P F       S + E   +GT++ EV A D+D   N  + Y   +IL   DT+  I     + ++N K G ++V S+L + L A +   ++  DN    +       N  + V I+D+NDN P F     P   ++    I E      T+I  SA D D G NG+I ++L ++           ++G +   R+ D E      F V A+D G+P  ++ V +          +     N  + + S Y+ P+ F  I   +++   K      A D D G  ALI Y        F ++P +G ++ +   DRE KD Y+ T  A       D P    S       +  +V++ +LD+ND  P F+       + +     + ++ +S   TD D      +TY +E
Sbjct:  111 LTTIDYLDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQA----RSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD------FYTLIVVADDGGPK---KDSAVVSITVLDENDNSPQFD-PTSDSVVNVPEDCPTGRRVAL---VQARDPDDGNNGLVTFSLTAGNP-SGIFE-------------IRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPP------DREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQD-EGPNGTVTY-----SISAGNVQETFSINNATGLIRVVKELDYE-VCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQ---PGPRVATFKADDKDSGLNGQ--VEYSIVGGDLLGDFVISSVEGDL--RVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAG----------------NLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN-PENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAED-IGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATD--QGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVS-VLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRF----RPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPV-------YLQIVDINDNNPIFSQSSYQKPV-FEDIQLGATVLQIK------ATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDHYTLTAIA------RDNPGDIASNRRE---NSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMS--ATDLDEGDNGVVTYNLE 1394          

HSP 3 Score: 247.669 bits (631), Expect = 4.909e-65
Identity = 382/1381 (27.66%), Postives = 587/1381 (42.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSA-------YHVSINFTFIQVIDVEDVPPIFQNS-SYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYE-QIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV-RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNS--SMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSD--ITYRLIGVDSVNFIVE---AVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-----LYFDPSLS--------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLV--------NSTVSITVLDVNDNEPYFVDYIQVL---NISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTL--------ITPLTI--YGIFYYKLIIEIMDN--PRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDN----GVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS--IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIR---SFDRETKDLYKFRVLANDLGTPSL--TSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIF------TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP 4711
            L   +D E   +  L++QA DS        Y +++N     V DV D PP+F     Y+ ++ E +   T VI V A D D+ L S + Y +  GN  +  F ++  +GEI       DRE Q       F+ L V +  E  P+L  S+ T V + ILD NDNS  F  P+Y+ +  E   +  ++I+ +  + +D+  N    Y++SA    +T SI         N A  +IRV     LDYE  +    + +      P+      S A V + + D+NDN P F       F I E  P    +    A DKDSG+ G++ YS+   D    FVI S  G    ++    DY L DRE      +  +A D G     +T ++ ++  D+NDN PI         + EN+   T  P+ R+ A+D   D   N +L   +N++ G  N  + F IN +TG V +   +DREKI    L +  V  +P N+  S  D  ++ + + D NDN P+F   ++   + +N    T I  LN       N   S+  ++YRL+G     F +     V   + G +I +         + + T+ A D G   L++   +++ V + ND  P+F+ S  +    EN   G ++ +V ATD D+  N  L+Y I          SG     L +         TG I      +DRE+  T    +   D+ A     P +   T+ I I DVND PP F   +   S+ E      +   G     V A D D+   L+Y     L  D + S        F ++  +G + +   L+RE V+  + T+S  D    V        N+ +++ +LDVNDN P F  +        I E    GT      A D D G N  + +   N       L   GYL L        I   T+    + +    +   DN  PR      +S EV +Y  ++D+N+N PIFSQ  Y+  P+ E   +G  + ++ ATD D G    + Y ++  +         F I      G I + S+L +     +T    A DN       R  N+  V +T++D+ND  P F         S  QFS  +YEN    T +  +SATD D G NG + +NL+      E F I   SG +++ R   SF+R     +   V+A D G P L  T+ + ++V+ ++ +  + V P N  +++    E PL  T                 A D D G N  + Y        T D   F +D  SG +      DRE +  Y+  + A  + Q    P  + +   P         V + DI+DN P F  P
Sbjct:  326 LIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVN-----VNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNE-DLTFRMDRLTGEIATRPAPPDREKQ------SFYKLVVTVEDEGNPAL--SATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSI---------NNATGLIRVVKE--LDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITEGQPG-PRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEG----DLRVRKDYEL-DRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVST--PITRILASD--ADTGRNALLT--FNITAG--NLENAFSINENTGIVYVNRQLDREKISEYKLTI-TVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDR---ESFLNPILDLTLVAEDIGK--LNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRI---------ESGAQDRFLIDAF-------TGVIRVANVTVDREEKDTYKLIVVATDQGAV----PLSGSITVSILIDDVNDCPPEFVNPIQTVSVLE------SAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHN-------LVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPR------RSAEVPVYLQIVDINDNNPIFSQSSYQ-KPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-------FGINPTT--GDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQF---------SKSQFSTSVYENEPEGTSVITMSATDLDEGDNGVVTYNLEGPG--SEAFLIDKDSGLITSRRLLQSFER-----FNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVFVRPPNGTILHIK-EEIPLKSTVYE------------VYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQ----PVPYET-MLPLQ-------VALDDIDDNEPAFIRP 1571          

HSP 4 Score: 214.542 bits (545), Expect = 5.935e-55
Identity = 317/1123 (28.23%), Postives = 495/1123 (44.08%), Query Frame = 2
Query: 1589 PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF-TLIGVVTATDKDSGIFGKIIYS-LNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNM--TTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSL-FSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSL--SFYVDSISGQIFLIKALDRE-TVSNLNFTVSCSDGVFLVN------STVSITVLDVNDNEPYFVD-YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNS-SSPFGL-SLDGYLTLIT--PLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNC-----TVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIIS----ATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS---FDRET--KDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHL-FGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            P  S   V I + DVND  P+F    Y+ +    +    T + VV ATD+D+G  G + Y  ++    KF ID+STG + T      DY  LD E     ++   ATD     N    T+ + L +  D    F    Y+A + EN    T   VRV+A   D     N++ Y+F   +      L  FKI+  TG +T+   VDREK   D   L+VVA D       D+ ++ I V D NDN+P F   + S VNVP++  T   +  + A D D+ N     +T+ L  G  S  F +    N      + K  +  +Q  ++   V+ASD G PP  +   + +NV ++ND PPVF +   ++ S YEN+  G ++ +VNATD D   N  L+Y+I Q   +            F +  L     TG I    +  DREK S     + V D+      P  +A  T+ + ILD NDN P+F++ +++ +     + +  +S  +      A D D    GT+ Y     ++  +F +++ +G I ++K LD E  +      V+ +D   +V       +TV + V D+NDN P F   Y     I+E  Q G   A F A+D D+G N  V +          F + S++G L +     L    I +Y   I IM   RG   F  +  V I V+D+N+N PI   +    S I+E T + T I  +LA+D D G N  +++ I      + F +         + G + VN  L +   + +   +   DN  P  + N       + VTI D NDN P FT         S    + EN+   T IT+++    A D D G N  + + L  +      F I+  +G ++ +R+    DRE+    +    ++A D+G  + T+ + + VL  +               N  I+        +  +S  GF +  V TA D D G N  + Y I +G    F +D F+G +       DRE KDTY   V A               G  P + S   V ++I D+ND PP F  P     +++ A   + + +++    D+D+  +  L Y+I
Sbjct:   33 PMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKIISGADGKFDIDASTGLLTT-----IDY--LDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGT-EVVRVQARSID---NLNQLSYKFDQTTYA--QALALFKIDEITGAITVKGLVDREK--GDFYTLIVVADD--GGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGN--NGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQ-ELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLT----------FRMDRL-----TGEIATRPAPPDREKQSFYKLVVTVEDEGN----PALSATTTVYVTILDENDNSPVFKSPVYEVT-----RDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYN--ITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNIS-ISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSIN-------ENTGIVYVNRQLDREKISEYKLTITVKDN--PENARNSRRDFDVLIVTISDENDNRPLFTQ-------GSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL--LGAQINLFTINNSTGVVT-VRAGKVIDRESFLNPILDLTLVAEDIGKLNSTARLVLTVLDAND--------------NRPIFSPSSVTVHLRENSPPGFSVVKV-TATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQ------------GAVPLSGS-ITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVT--AIDRDLNPR--LEYYI 1056          

HSP 5 Score: 182.185 bits (461), Expect = 4.098e-45
Identity = 266/957 (27.80%), Postives = 412/957 (43.05%), Query Frame = 2
Query: 2177 VTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIK-KYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN--DEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI----VGTLQYLYFDPSLSFYVDSIS---GQIFLIKALDRETVSNLNFTVSCSD-GVFLVNS--TVSITVLDVNDNEPYFVDYIQVLNISEVTQV--GTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYL-TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP----RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI-TLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSF--DRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYV--TDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPG 4936
            V P+DRE   N    L+V AY+     M  +  + I V+DVND  PVF    +S + + + +   T++  + ATD D  +     +TY++I      F ++A     TG +    Y +   +   +   V A+D+  P    R    I VT +N  DE   FT   +     EN+  G  + +V A   D    L+Y   Q T                   L  +++  G + V+ ++DREK    T  I V D        P+   A + I +LD NDN P F  TS    ++ ED        TG     V+A D D     + T      +PS  F + + +   G++FLIK++DRE        V  SD G     S  T+++ V DVNDN P F D     N+S    V  GT   +  A D D G N+V+ +Y    N    F +  L G + T   P       +YKL++ + D   G      +  V + ++D N+N P+F    YE +      ++ ++I    A D+D G NG V+Y I      + F +     L R+ K  D    L          R+T IV A D   P    RL++  TV V + DINDN+P+F  P          F I E      +    A DKDSGLNG++ +++    + GD   F IS + G+L   + +  DRE    Y   ++A D G P  +S   +E+ VLD++DN P+  +  L  N SI E     T I+              A D D G NAL+ +  T   +   F ++  +G ++  ++ DRE    Y  T+         D P +  +    F+     ++V I D NDN P+FT  + L  + + +   + I  ++  V   D DI S   ++Y +         L AQ+       +F +N ++G+++   G
Sbjct:    9 VQPLDRET--NSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDG--GLVTYKIISGADGKFDIDA----STGLLTTIDYLDYETKT-TYYMNVSATDQAVP--FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQLSYKFDQTT-------------YAQALALFKIDEITGAITVKGLVDREKGDFYT-LIVVADDGG-----PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPED------CPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVF-DKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVED--EGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCL---------GRYTLIVTATDR-CPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGP------FEITEGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGD---FVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQNISISENTPVSTPITR-----------ILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQLDREKISEYKLTITV------KDNPENARNSRRDFDV----LIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRL---------LGAQIN------LFTINNSTGVVTVRAG 869          

HSP 6 Score: 176.022 bits (445), Expect = 3.084e-43
Identity = 270/1018 (26.52%), Postives = 428/1018 (42.04%), Query Frame = 2
Query: 1856 LDRE--AYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDT-NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSL-FQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY--LYFDPSLSFYVDSISGQIFLIKA-LDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYI-QVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYLTLITPLTI-YGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSG--HLFGIKEFDRET--KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIEN 4831
            LDRE  +   L V A  +D G + +   VII ++D+ND  P+F  + Y       +         V+ATD+D       + Y+  + + G       F I+ASTG +T +  +D E        + V A D +       C I + + +  D    F   T+   + +NI+T T ++ + A   D  N     ++Y+         +     +  TGAI  K    R +   +   V A D G  P     ++ I V + ND  P F  +  S  +  E+   G  +  V A DPD  N  L  F    ++ A N SG+     F +      N T G V++   +DRE     T ++Q  D  +    PP+ +  TL + + DVNDNPP+F     +  S++E      N+  G +   V ATD D  +   L Y     +  L+F +D ++G+I    A  DRE  S     V+  D         +TV +T+LD NDN P F   + +V        + ++     A D D G N  V +     N    F + +  G + ++  L     +  Y LI+   D  P        +  V + V D+N+N+P F + +     ITE    G  +    A DKD G NG V Y I+        +L  F I  V    ++  +  L     A +   + A D G P  S+   V + ++DINDN P   N   P N      SI ENT   T IT I A+D D+G N  + FN+ + N ++  F I+  +G +   R  DRE    YK  +   D    +  S  + +VL++ + D     P    L     Y   LT  S   + ++   +     A+D DIG NA++ Y   G  + +F ++  +G   +   K  DRE+        T+ A  + +                 S AR+V+ +LD NDN P+F+  ++   + + + P   +V ++   TD D      L+Y IE+
Sbjct:   12 LDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTG-DGGLVTYKIISGADG------KFDIDASTGLLTTIDYLDYET--KTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLN----QLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGG--PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTF----SLTAGNPSGI-----FEIRT---TNNTLGEVFLIKSIDREVQELYTLKVQASDSGS----PPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYE------NVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKPYEGPFEITE-GQPGPRVATFKADDKDSGLNGQVEYSIVGGD-----LLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQN-----ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENA-FSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRP----LFTQGSYLAELTENSPEGTPIT--VLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLN---------------STARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVT--ATDADSGINQQLSYRIES 955          

HSP 7 Score: 161.384 bits (407), Expect = 8.940e-39
Identity = 225/764 (29.45%), Postives = 333/764 (43.59%), Query Frame = 2
Query: 2495 TGAIIKK-YPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFS-FSTYENLDIGINIGQVNATDPDTNCD--LAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLY----FDPSLS-FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST-VSITVLDVNDNEPYF-VDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLSLD----GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR--FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK-DLYKFRVLAND---LGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVAT--AVDRDIGYNALIVYIFTGDTVM--FYLDPFSGHLFGIK--EFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            TG I++   P  R     H   VEA +    P+ + V ++I V ++NDE PVFTQ  +S     E + IG ++  V ATD DT     + Y II         SG   +  F++      + + G++     LD E  +T    +   D+A    +P    F T+ + +++  D    F +  ++  + E      NI+TG     V+A  +D +  L Y +    +  +L+ F +D I+G I +   +DRE        V   DG    +S  VSITVLD NDN P F      V+N+ E    G   A   A D D G N +V F     N S  F +       G + LI  +       Y L ++  D+  G+   +    + + V DVN+N P+F + F     + E    GT +  V ATDKD G N  +SY I  Q + D+     FR+ ++   G+I    +  +   +  +  +V   D G P LS   TV VTI+D NDN P F +PV          S+  N++ L T  +A D+D G NG + +++ + N   E F I+  +G +  ++  D E     Y   V A D   +    LTS   + V V D++DN P FP          YEGP   T        G     VAT  A D+D G N  + Y   G  ++  F +    G L   K  E DRE    Y+ T+ A               G  PF  S A V + +LDINDN P+ 
Sbjct:    2 TGLIMRGVQPLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKII---------SG--ADGKFDI------DASTGLLTTIDYLDYETKTTYYMNVSATDQA----VPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIE------NIATGTEVVRVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTLIVVADDGGPKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDS--GSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYI-TQGNEDL----TFRMDRLT--GEIATRPAPPDREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSL--NSVILTT--TAVDQDEGPNGTVTYSISAGNV-QETFSINNATGLIRVVKELDYEVCLGRYTLIVTATDRCPIVQRRLTSTATVLVNVNDINDNWPTFPKP--------YEGPFEIT-------EGQPGPRVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKD------------RGNPPF-SSTAVVEIRVLDINDNDPIL 696          
BLAST of Cadherin-23 vs. Ensembl Xenopus
Match: CDH23 (cadherin related 23 [Source:HGNC Symbol;Acc:HGNC:13733])

HSP 1 Score: 383.645 bits (984), Expect = 3.854e-107
Identity = 463/1608 (28.79%), Postives = 718/1608 (44.65%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSA-------YHVSINFTFIQVIDVEDVPPIFQNS-SYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIA-MIIDRESQDITNVFGFFDLTV-IATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKT-SSIFEVYPIVAMNKA-------------------ILV----------IRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDG-----GGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFT-----FGPVRVKATDKDVD---VANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTA-FATLRIEILDVNDNPPIFQ---TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTI---HFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNL---DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS--NSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIIL-DINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIY--PFQSDLAAQLKNLNIDTVFALNITSGILST-------APGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVN--FISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTP 5359
            L   +D E   +  L++QA DS        Y +++N     V DV D PP+F     Y+ ++ E +   T VI V A D D+ L S + Y +  GN  +  F ++  +GEI       DRE Q       F+ L V +  E  P+L  S+ T V + ILD NDNS  F  P+Y+ +  E   +  ++I+ +  + +D+  N    Y++SA    +T      +  +VA  KA                   +L           +RV+    LD E I   N++I         N P  S A V I +LD+NDN PI  N      I EN+P  T I  + A+D D+G    + +++   +    F I+ +TG +Y N         LDRE      +     D          +   +I+ + D NDN P+F    Y A L ENS   T      GPV   A D D+    V + R+L    N+          F IN STG VT+     +DRE   N IL L +VA D     +  T  + + V D NDN P+F  ++ +V++ +N     +++ + ATDAD     Q  ++YR+       F+++A     TG I +      R +   +   V A+D+G  PLS  + + I + ++ND PP F   + + S  E+ ++G  + +V A D D N  L Y+II+       +S +P     N   +  +N   G V V+S L+RE  +T    I V D A+E      +A  A L + ILDVNDN P F+    + F   + E   P      G T   V A D D    G + Y   +   + Y+   D+++G+I   + +D E V  LNFTV  SD      S    V + ++D+NDN P F        + E  Q+G    +  A D+D+G  A++ +   +     FG++   G + +++ L      +Y L     DNP G I     + S +V I V+DVN+  P FS+  +  S + E    GT +  + ATD D G+NG V+Y  L    ++ F++         D G I     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+     I E      T+  + ATD D GLNG +R+NL    +   D E+F I   SG +      DRE + +Y   ++A DLG P    + + ++V + D+DDN P F             G L + ++S    S  G  +GNV+ AVD D G NA++ Y I TG+    +L    G L  +K  DRE +  YS  V+A     +  G +S    + P   S  + V + L DIND PP FT P    G+   A   S+++ +     D D+ + + + Y I  I      S+ + ++KN     +FA+  T+GI+ T       +PG F  D         I   D    N D  +V    +   Q++  VI   P  V      F   LSN+    +  D V+   D +G +    T++  H V+  +N +++   ++ ++++      +L   Y ++D +  + +  P
Sbjct:  323 LIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVN-----VNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNE-DLTFRMDRLTGEIATRPAPPDREKQ------SFYKLVVTVEDEGNPAL--SATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFRYHLGIQHLVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRG---NPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENAFSINENTGIVYVNRQ-------LDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVL--ALDNDIGSNAVVSYRLLGAQINL----------FTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIG--KLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQ--LSYRIESGAQDRFLIDAF----TGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDLNPRLEYYIIEILATDDTNSLIP-----NQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTERIVEGATP------GTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQSSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSLVDGEGK-FGINPTTGDIYILSTLDREKKDHYTLTAIARDNP-GDIASNRRENSVQVLITVLDVNDCRPQFSKSQFSTS-VYENEPEGTSVITMSATDLDEGDNGVVTYN-LEGPGSEAFLID-------KDSGLITSRRLLQSF-ERFNLTVVATDKGRPPLWGTTMLKVDVIDVNDNRPVF---VRPPNGTI--LHIKEEIPLKSTVYEVYATDNDEGLNGAVRYNLLKTGAGTKDWEYFTIDSTSGLIQTALRLDREKQAMYNLIIVAYDLGQPVPYETMLPLQVALDDIDDNEPAF--------IRPPRGALQYQTLSVREHSKPGTVVGNVSGAVDVDEGSNAIVYYFIATGNQDNNFLLIPEGKLTVLKNLDREKEPYYSIIVKASSNRSWTPG-NSLGKKFDPATDSTLQEVRVYLEDINDQPPRFTKPEYTAGVATDAKVGSELIKV--LAVDADVGNNSLVFYSILGIRYIKLNSNDSVEVKN-----IFAIENTTGIVRTFDLFTAYSPGYFIVD---------IKAVDLAGHN-DTAVVGIYILRDDQRLKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDKKGRVNFAQTDMLIHVVNRDTNRILDVERVIQMIDENKEQLRNLFRNYNVMDVQPATTAQAP 1832          

HSP 2 Score: 251.136 bits (640), Expect = 3.377e-66
Identity = 357/1411 (25.30%), Postives = 585/1411 (41.46%), Query Frame = 2
Query:  830 PLDYERFPMIQLQLQA--QDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSS-TMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFM-IFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSST---GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMT--TVIIILKDLNDNPPIFEVRF-YQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDV-TIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQN-ISTNTTILFLNATDADESNTPQSDITYRL------------IGVDSV----------------------------NFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKA---LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTI--YGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSY---KILLQKDTDVFILQLFRIQKVNDK-GQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN-----NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSIS-NSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            PLD E      L ++A   D     S     I V DV D  P+F    YS   + E + + T V  V A D D      V Y +  G   +  F I+ ++G +     +D E++        + + V AT+ A   FN     + + +++  D    F  P Y+  + EN   G  ++    +     D      Y        +  ++F++  I        ++  + G F        I V+  G         P+   A VSI +LD NDN+P F  +S + + + E+ P    + +V A D D G  G + +SL   +P   F I ++    G ++           +DRE  E   +   A+D G     +  T+ + + D+NDNPP+F+  F Y   ++EN    T   +RV ATDKD  +  N +L   Y ++ G  +    F+++  TG++ T   P DREK      +L+V   D  N ++  T  + + + D NDN+PVF    + V   +  +S N+ IL   A D DE   P   +TY +            +G+  +                            +F++ +V       + K Y   R  +  +N T+ A DRG PP S+  ++ I V +IND  P+      + S  EN  +   I ++ A+D DT  N  L + I                   N+ N   +N+  GIVYV   LDREK S     I V D   E     +  F  L + I D NDN P+F    +   L E+    + I+           D+     + Y      ++ +  + S  +  ++A   +DRE+  N  L+ T+   D +  +NST    +TVLD NDN P F      +++ E +  G    K  A D+D+G N  + +   + +   F +     +  +  +T+       YKLI+   D  +G +    S  V I + DVN+  P F       S + E   +GT++ EV A D+D   N  + Y   +IL   DT+  I     + ++N K G ++V S+L + L A +   ++  DN    +       N  + V I+D+NDN P F     P   ++    I E      T+I  SA D D G NG+I ++L ++           ++G +   R+ D E      F V A+D G+P  ++ V +          +     N  + + S Y+ P+ F  I   +++   K      A D D G  ALI Y        F ++P +G ++ +   DRE KD Y+ T  A       D P    S       +  +V++ +LD+ND  P F+       + +     + ++ +S   TD D      +TY +E
Sbjct:    8 PLDRETNSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDGGLVTYKIISG--ADGKFDIDASTGLLTTIDYLDYETKTT------YYMNVSATDQAVP-FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVV---RVQARSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGDFYTL-----IVVADDGG--------PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPEDCPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFL-------IKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGT-SVIRVNATDKDKGL--NSVLS--YYITQGNEDL--TFRMDRLTGEIATRPAPPDREK--QSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEG--PNGTVTYSISAGNVQETFRYHLGIQHLVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDL--RVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLNLPQNISISENTPVSTPITRILASDADTGRNALLTFNITAG----------------NLENAFSINENTGIVYVNRQLDREKISEYKLTITVKDN-PENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAED-IGKLNSTARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATD--QGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVS-VLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRF----RPFGVTAFTERIVEGATPGTTLISVSAVDPDKGPNGQITYSLHNLVPAGYLQLEDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPV-------YLQIVDINDNNPIFSQSSYQKPV-FEDIQLGATVLQIK------ATDADSGRFALIQYSLVDGEGKFGINPTTGDIYILSTLDREKKDHYTLTAIA------RDNPGDIASNRRE---NSVQVLITVLDVNDCRPQFSKSQFSTSVYENEPEGTSVITMS--ATDLDEGDNGVVTYNLE 1321          

HSP 3 Score: 230.335 bits (586), Expect = 9.063e-60
Identity = 397/1494 (26.57%), Postives = 620/1494 (41.50%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK-DGNPFNE---YFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG--SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-----QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN------------------------SYNFTFGPVR---------------VKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVT--PVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNIS------TNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRV---IILINVTEINDEPPVFTQSLFSFSTYENLDIGINI----GQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQS--MLDREKYST----LTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS---FYVDSISGQIFLIK-ALDRETVSNLNFTVSCSD--GVFLVNS-TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN------------NSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSK---EVGIYVIDVNNNFPIFS----QVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARF-TFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND----LGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG-DTVMFYLDPFSGHLFG---IKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIP---TILGGIVKFATP-NSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTA 4930
            LT    LDYE      + + A D A   +  F   ++ +++  D    F + +Y + + E +   T V+ V A    RS+ +  Q S K D   + +    F I+E +G I +  ++DRE  D      F+ L V+A +  P         V I +LD NDNS  FD P      +V E+   G  + +   +   D D   N     S    N  S IFE             IR  N +  +   IKSI+  ++ L     Q +   + P  S   +++ + DVNDN P+F     Y   ++EN    T +  V ATDKD G+   + Y +    +   F +D  TG I T           DRE      +V    D G   L   TTV + + D NDN P+F+   Y+    E                         +Y+ + G V+                KA DKD  + N ++ Y      +     L +F I++  GD+ +     +DRE I      + ++A D  N     T +++I V D+NDN P+       +N+PQNIS       +T I  + A+DAD      + +T+ +   +  N       N  TG +       R ++  +  T+   D      ++R    ++++ +++ ND  P+FTQ  +     EN   G  I    G V A D D  +N  ++Y ++   IN                 L  +N + G+V V++  ++DRE +      LT   + I K   T        A L + +LD NDN PIF  S     L E+  P      G +   V ATD D     Q  Y   S +   F +D+ +G I +    +DRE        V  +D   V L  S TVSI + DVND  P FV+ IQ +++ E  +VGT+ A+  A D D   N  + +Y               N    F ++   G + + + L    +  Y + I + DN    +    S    ++ + ++DVN+N P F       F E   I E    GT +  V A D D G NG ++Y   L        LQL    + N  G+I+ N ++     ++  F V A DNG PR S    V + I+DINDN P F+        SS Q  ++E+     T+  I ATD DSG    I+++L  ++G+ +F  I+P +G++  + + DRE KD Y    +A D    + +    ++V + + VLD++D  P F  +    + S+YE     TS+   S           A D D G N ++ Y   G  +  F +D  SG +     ++ F+R     ++ TV A               G  P       + V ++D+NDN PVF  P   TIL   +K   P  S + ++  Y TD D     A+ Y +        D             F ++ TSG++ TA
Sbjct:  108 LTTIDYLDYETKTTYYMNVSATDQAVPFNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQA----RSIDNLNQLSYKFDQTTYAQALALFKIDEITGAITVKGLVDREKGD------FYTLIVVADDGGPK---KDSAVVSITVLDENDNSPQFD-PTSDSVVNVPEDCPTGRRVAL---VQARDPDDGNNGLVTFSLTAGNP-SGIFE-------------IRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVFDKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPP------DREKQSFYKLVVTVEDEGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFRYHLGIQHLVATFKADDKDSGL-NGQVEYSIVGGDL-----LGDFVISSVEGDLRVRKDYELDRENIA--FYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPIL------LNLPQNISISENTPVSTPITRILASDADTGR--NALLTFNITAGNLENAFS---INENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRPLFTQGSYLAELTENSPEGTPITVLNGPVLALDNDIGSNAVVSYRLLGAQIN-----------------LFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLNST--------ARLVLTVLDANDNRPIFSPSSVTVHLRENSPP------GFSVVKVTATDADSGINQQLSYRIESGAQDRFLIDAFTGVIRVANVTVDREEKDTYKLIVVATDQGAVPLSGSITVSILIDDVNDCPPEFVNPIQTVSVLESAEVGTVVAEVTAIDRDL--NPRLEYYIIEILATDDTNSLIPNQQGVFEINFKTGSVMVKSNLNRELVATYDITISVYDNASEVVDRSVSAPNAKLTVNILDVNDNTPRFRPFGVTAFTER--IVEGATPGTTLISVSAVDPDKGPNGQITYS--LHNLVPAGYLQL----EDNMAGKIIANRTVDYEQVQWLNFTVRASDNGSPRRSAEVPVYLQIVDINDNNPIFSQ-------SSYQKPVFEDIQLGATVLQIKATDADSGRFALIQYSL--VDGEGKFG-INPTTGDIYILSTLDREKKDHYTLTAIARDNPGDIASNRRENSVQVLITVLDVNDCRPQFSKSQF--STSVYENEPEGTSVITMS-----------ATDLDEGDNGVVTYNLEGPGSEAFLIDKDSGLITSRRLLQSFER-----FNLTVVATD------------KGRPPL-WGTTMLKVDVIDVNDNRPVFVRPPNGTILH--IKEEIPLKSTVYEV--YATDNDEGLNGAVRYNLLKTGAGTKDWE----------YFTIDSTSGLIQTA 1449          

HSP 4 Score: 157.532 bits (397), Expect = 1.140e-37
Identity = 255/947 (26.93%), Postives = 397/947 (41.92%), Query Frame = 2
Query: 2177 VTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFS-VNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIK-KYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEIN--DEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ-TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI----VGTLQYLYFDPSLSFYVDSIS---GQIFLIKALDRETVSNLNFTVSCSD-GVFLVNS--TVSITVLDVNDNEPYFVDYIQVLNISEVTQV--GTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLDGYL-TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVF-----ILQLFRIQKVNDK------------------GQILVNSSLKNLGAR------------FTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT--ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSG--HLFGIKEFDRET--KDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIEN 4831
            V P+DRE   N    L+V AY+     M  +  + I V+DVND  PVF    +S + + + +   T++  + ATD D  +     +TY++I      F ++A     TG +    Y +   +   +   V A+D+  P    R    I VT +N  DE   FT   +     EN+  G  + +V A   D    L+Y   Q T                   L  +++  G + V+ ++DREK    T  I V D        P+   A + I +LD NDN P F  TS    ++ ED        TG     V+A D D     + T      +PS  F + + +   G++FLIK++DRE        V  SD G     S  T+++ V DVNDN P F D     N+S    V  GT   +  A D D G N+V+ +Y    N    F +  L G + T   P       +YKL++ + D   G      +  V + ++D N+N P+F    YE +      ++ ++I    A D+D G NG V+Y I      + F     I  L    K +DK                  G  +++S   +L  R            +   + A D G P  S+   V + ++DINDN P   N   P N      SI ENT   T IT I A+D D+G N  + FN+ + N ++  F I+  +G +   R  DRE    YK  +   D    +  S  + +VL++ + D     P    L     Y   LT  S   + ++   +     A+D DIG NA++ Y   G  + +F ++  +G   +   K  DRE+        T+ A  + +                 S AR+V+ +LD NDN P+F+  ++   + + + P   +V ++   TD D      L+Y IE+
Sbjct:    6 VQPLDRET--NSSHVLVVEAYNSDQGPMRSSVRVIIYVEDVNDEVPVFTQQQYSRLGLRETVGIGTSVTVVRATDRDTGDG--GLVTYKIISGADGKFDIDA----STGLLTTIDYLDYETKT-TYYMNVSATDQAVP--FNRGFCTIYVTLMNEPDEVVQFTSPTYKAVIIENIATGTEVVRVQARSIDNLNQLSYKFDQTT-------------YAQALALFKIDEITGAITVKGLVDREKGDFYT-LIVVADDGG-----PKKDSAVVSITVLDENDNSPQFDPTSDSVVNVPED------CPTGRRVALVQARDPDDGNNGLVTFSLTAGNPSGIFEIRTTNNTLGEVFLIKSIDREVQELYTLKVQASDSGSPPRRSEYTLTVNVNDVNDNPPVF-DKPFGYNVSVYENVGGGTSVIRVNATDKDKGLNSVLSYYITQGNEDLTFRMDRLTGEIATRPAPPDREKQSFYKLVVTVED--EGNPALSATTTVYVTILDENDNSPVFKSPVYEVTRDEGPLSLNSVILTTTAVDQDEGPNGTVTYSISAGNVQETFRYHLGIQHLVATFKADDKDSGLNGQVEYSIVGGDLLGDFVISSVEGDLRVRKDYELDRENIAFYNITIMAKDRGNPPFSSTAVVEIRVLDINDNDPILLN--LPQN-----ISISENTPVSTPITRILASDADTGRNALLTFNITAGNLENA-FSINENTGIVYVNRQLDREKISEYKLTITVKDNPENARNSRRDFDVLIVTISDENDNRP----LFTQGSYLAELTENSPEGTPIT--VLNGPVLALDNDIGSNAVVSYRLLGAQINLFTINNSTGVVTVRAGKVIDRESFLNPILDLTLVAEDIGKLN---------------STARLVLTVLDANDNRPIFSPSSVTVHLRENSPPGFSVVKVT--ATDADSGINQQLSYRIES 882          
BLAST of Cadherin-23 vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 412.535 bits (1059), Expect = 5.703e-116
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 343.969 bits (881), Expect = 1.536e-94
Identity = 397/1341 (29.60%), Postives = 595/1341 (44.37%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+DL  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1418          

HSP 3 Score: 255.758 bits (652), Expect = 1.661e-67
Identity = 362/1388 (26.08%), Postives = 578/1388 (41.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1271 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2549          

HSP 4 Score: 235.343 bits (599), Expect = 2.929e-61
Identity = 394/1430 (27.55%), Postives = 597/1430 (41.75%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1385          

HSP 5 Score: 234.572 bits (597), Expect = 4.282e-61
Identity = 342/1303 (26.25%), Postives = 556/1303 (42.67%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD D+  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1209          

HSP 6 Score: 197.593 bits (501), Expect = 7.304e-50
Identity = 279/1055 (26.45%), Postives = 457/1055 (43.32%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L      ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLL--GTHSDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGT-TLIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2886          

HSP 7 Score: 122.094 bits (305), Expect = 7.310e-27
Identity = 162/582 (27.84%), Postives = 240/582 (41.24%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYEN-----TITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F       N S    +I E       + L   +   D+D GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEF-------NSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 412.535 bits (1059), Expect = 6.611e-116
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1585 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3121          

HSP 2 Score: 339.732 bits (870), Expect = 3.111e-93
Identity = 399/1341 (29.75%), Postives = 592/1341 (44.15%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +   I V DKD   N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLF--IQVVDKDEGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1416          

HSP 3 Score: 255.758 bits (652), Expect = 1.747e-67
Identity = 362/1388 (26.08%), Postives = 578/1388 (41.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1269 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2547          

HSP 4 Score: 239.965 bits (611), Expect = 9.753e-63
Identity = 394/1428 (27.59%), Postives = 597/1428 (41.81%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDSGIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1383          

HSP 5 Score: 229.95 bits (585), Expect = 1.231e-59
Identity = 340/1303 (26.09%), Postives = 555/1303 (42.59%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD  + +   +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNS---MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1207          

HSP 6 Score: 197.593 bits (501), Expect = 8.148e-50
Identity = 279/1055 (26.45%), Postives = 457/1055 (43.32%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L      ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1906 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLL--GTHSDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGTT-LIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2884          

HSP 7 Score: 126.716 bits (317), Expect = 2.531e-28
Identity = 162/577 (28.08%), Postives = 239/577 (41.42%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 606          
BLAST of Cadherin-23 vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 412.149 bits (1058), Expect = 7.332e-116
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 343.584 bits (880), Expect = 1.745e-94
Identity = 397/1341 (29.60%), Postives = 595/1341 (44.37%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+DL  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1418          

HSP 3 Score: 255.373 bits (651), Expect = 1.956e-67
Identity = 362/1388 (26.08%), Postives = 578/1388 (41.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1271 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2549          

HSP 4 Score: 234.958 bits (598), Expect = 3.014e-61
Identity = 394/1430 (27.55%), Postives = 597/1430 (41.75%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQI---KSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1385          

HSP 5 Score: 234.572 bits (597), Expect = 4.597e-61
Identity = 342/1303 (26.25%), Postives = 556/1303 (42.67%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD D+  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1209          

HSP 6 Score: 197.593 bits (501), Expect = 8.832e-50
Identity = 279/1055 (26.45%), Postives = 457/1055 (43.32%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L      ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLL--GTHSDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGTT-LIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2886          

HSP 7 Score: 122.094 bits (305), Expect = 7.419e-27
Identity = 162/582 (27.84%), Postives = 240/582 (41.24%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYEN-----TITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F       N S    +I E       + L   +   D+D GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEF-------NSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 412.149 bits (1058), Expect = 7.408e-116
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1586 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3122          

HSP 2 Score: 332.413 bits (851), Expect = 4.672e-91
Identity = 393/1341 (29.31%), Postives = 590/1341 (44.00%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+    N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A        GP                V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA-----DDGGP----------KVDSTVVYITVLDENDNSPRF 1417          

HSP 3 Score: 256.144 bits (653), Expect = 1.322e-67
Identity = 364/1388 (26.22%), Postives = 576/1388 (41.50%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P +     T V I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1271 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKV---DSTVVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2548          

HSP 4 Score: 236.498 bits (602), Expect = 1.302e-61
Identity = 395/1430 (27.62%), Postives = 598/1430 (41.82%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKD--SGIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD  SG+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1385          

HSP 5 Score: 231.491 bits (589), Expect = 3.414e-60
Identity = 341/1303 (26.17%), Postives = 556/1303 (42.67%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD +V+    +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKD-EVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1209          

HSP 6 Score: 197.593 bits (501), Expect = 8.287e-50
Identity = 279/1055 (26.45%), Postives = 458/1055 (43.41%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L   +  ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1907 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGT-TLIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2885          

HSP 7 Score: 122.865 bits (307), Expect = 3.607e-27
Identity = 163/579 (28.15%), Postives = 240/579 (41.45%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKD--SGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD  SGLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 608          
BLAST of Cadherin-23 vs. Ensembl Mouse
Match: Cdh23 (cadherin 23 (otocadherin) [Source:MGI Symbol;Acc:MGI:1890219])

HSP 1 Score: 412.149 bits (1058), Expect = 8.735e-116
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1589 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3125          

HSP 2 Score: 327.02 bits (837), Expect = 2.551e-89
Identity = 393/1344 (29.24%), Postives = 590/1344 (43.90%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPV---DTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P     T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+    N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A        GP                V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPVSPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA-----DDGGP----------KVDSTVVYITVLDENDNSPRF 1420          

HSP 3 Score: 255.758 bits (652), Expect = 1.598e-67
Identity = 364/1388 (26.22%), Postives = 576/1388 (41.50%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P +     T V I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1274 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKV---DSTVVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2551          

HSP 4 Score: 231.106 bits (588), Expect = 4.763e-60
Identity = 395/1433 (27.56%), Postives = 598/1433 (41.73%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENS---QAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQI---KSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKD--SGIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S     G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD  SG+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPVSPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1388          

HSP 5 Score: 226.868 bits (577), Expect = 1.027e-58
Identity = 341/1306 (26.11%), Postives = 556/1306 (42.57%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF---TLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP     T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD +V+    +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPVSPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKD-EVSGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1212          

HSP 6 Score: 197.208 bits (500), Expect = 1.046e-49
Identity = 279/1055 (26.45%), Postives = 458/1055 (43.41%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L   +  ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1910 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTH--SDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGTT-LIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2888          

HSP 7 Score: 120.939 bits (302), Expect = 1.325e-26
Identity = 165/584 (28.25%), Postives = 239/584 (40.92%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIF-----SQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKD--SGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF     S   YE SP     + GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD  SGLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSP---PVSPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDEVSGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 611          
BLAST of Cadherin-23 vs. UniProt/SwissProt
Match: sp|Q99PF4|CAD23_MOUSE (Cadherin-23 OS=Mus musculus OX=10090 GN=Cdh23 PE=1 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 3.989e-115
Identity = 460/1631 (28.20%), Postives = 717/1631 (43.96%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNG--DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +ITV A+D D      V Y++  GN  N  F IN+ +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + +  DRE      L+LL++A D     +  T  + I + D NDN P F   T++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y II           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP  +     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D +   YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G +++++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G N  ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATD D GLNG +R++     G  D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y I  GD    F+L P  G L  +++ DRET+ T+S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINKHTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED--IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVP-----DQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASD--LPEHSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNSQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQP-DGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFRA-LANDSED--VGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 343.969 bits (881), Expect = 1.074e-93
Identity = 397/1341 (29.60%), Postives = 595/1341 (44.37%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + D++D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D+DL  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   I    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P F+   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST+++ VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN  G +  +++    ++  V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          +V A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATDKD+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIH------------PPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDN--GPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRER---NSS-------HVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDKDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1418          

HSP 3 Score: 255.758 bits (652), Expect = 1.162e-66
Identity = 362/1388 (26.08%), Postives = 578/1388 (41.64%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I    V +  +   LD+  +K +  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D +  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E    GTII  V A D D   N  + Y I+    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G V    TA D D G  ALI Y        F ++P +G +  +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S + LTY +E
Sbjct: 1271 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVV-ASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINKHTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAED-IGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTIIANVTAIDLDL--NPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNSQLTYSLE 2549          

HSP 4 Score: 235.343 bits (599), Expect = 2.049e-60
Identity = 394/1430 (27.55%), Postives = 597/1430 (41.75%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDH-EFFFISPISGNL-SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +  +PF   FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  S     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  I E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + + V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F I   SG L    R  DRE    +   V A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A D+D G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPSPF---FAIDSARGIVTVIQELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1385          

HSP 5 Score: 234.572 bits (597), Expect = 2.995e-60
Identity = 342/1303 (26.25%), Postives = 556/1303 (42.67%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF--YFPN-----NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S     P  A++ A  ++ V     LDYE  ++  +++           P  + A+++I I D+ D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD D+  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++  + PN     NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + I E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ V ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE  +        S+   K      A D D G    + Y I  G+    F +   SG L  G +  DRE   ++   V A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPS-----PFFAIDSARGIVTVIQE--LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISIYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFRNLPF-VAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNG-----PVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQLK------ATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPLDRERNSSHVLMVEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1209          

HSP 6 Score: 197.593 bits (501), Expect = 5.109e-49
Identity = 279/1055 (26.45%), Postives = 457/1055 (43.32%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L      ++ F I+ ++G + +   +IIDRE+      F   F +L ++A +    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   ++   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y   +++  PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++I+  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A           F+V      +   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    +    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLL--GTHSDLFVIDNSTGVVTVRSGIIIDREA------FSPPFLELLLLAEDIG-QLNGTAHLF--ITILDDNDNWPTFSPPTYTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLD--LNPKLEYHIISIVAKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGT-TLIAVAAVDPDKGL-NGLITYTLLDLT--PPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEA-----------FSV------DMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2886          

HSP 7 Score: 122.094 bits (305), Expect = 5.113e-26
Identity = 162/582 (27.84%), Postives = 240/582 (41.24%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL--SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYEN-----TITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F     SPF    S  G +T+I  L       Y+L +   D  + T        + I + D+ +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F       N S    +I E       + L   +   D+D GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF--QPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDMQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEF-------NSSEYSVAITELAQVGFALPLFIQVVDKDEDLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 608          
BLAST of Cadherin-23 vs. UniProt/SwissProt
Match: sp|Q9H251|CAD23_HUMAN (Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2)

HSP 1 Score: 412.149 bits (1058), Expect = 5.806e-115
Identity = 454/1630 (27.85%), Postives = 717/1630 (43.99%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLSFYV---DSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG--DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L    +D       +    ++ ++D  D  P+FQ   Y   ++E    ++T +IT+ A+D D      V Y++  GN  N  F I+   G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G  +E ++      + +  +  D+D   N Q   S + +      F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG   ++ +++   +  + F I+++TG +  N         LDRE      +     D          +   ++I L D NDN P+F    YQA + ENS   T      GP+     D+D+      + YQ      G       F IN+STG VT+ + V  DRE     IL+LL++A D     +  T  + I + D NDN P F   T +V++ +N     ++L + ATD D       ++ YR+       F++  V    TG I  +  NA   R +   +  TV A+DRG  PLS   I+ I + +IND  P F   + + S  E+ + G  I  + A D D N  L Y I+           VP     N  +   +N   G V V+S ++RE  +T    + VID A++  LP ++     A L + +LDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D     YV   DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGTI     A D+D+G N  +I Y   +  S F ++   G + +++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  ++ATD+D G NG ++Y  L     + F + +       D G +     L++   +F+  V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATDKD GLNG +R++    + N D EFF I PISG +   +  DRE++ +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y      +   F+L P  G L  +++ DRE +  +S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F++ LA   ++  +  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F + LSN+    +  D+V+   D +G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1587 TRPAPPDRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLDEGPNGTVTYAIVAGNIVNT-FRIDRHMGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGP-FEVTEGQPGPRVWT-FLAHDRDSGPNGQVEYS-IMDGDPLGEFVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGMP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAV---VTYQLLGAQSG------LFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED--IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGL--NGELVYRIEAGAQDRFLIHLV----TGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVP-----NQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASD--LPERSVSVPNAKLTVNVLDVNDNTPQFKPFGITYYMERILEGATP------GTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSG-NFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMMATDQDEGPNGELTYS-LEGPGVEAFHVDM-------DSGLVTTQRPLQSY-EKFSLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQP-DGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYSILAIHYFRA-LANDSED--VGQVFTMGSMDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHVDKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVRLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTVHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3123          

HSP 2 Score: 343.584 bits (880), Expect = 1.388e-93
Identity = 401/1340 (29.93%), Postives = 594/1340 (44.33%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFP-NNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDN-PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIF-----TGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TAID D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE      PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +  +++ +D++L  N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D+G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN+I Y   + S  G  +Y D   +    G +++  P+D E+I N ++ L V+A D  N  +  T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +N+T  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I    +MLDRE       ++  +++    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E       I  G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y LI+E +DN P G  H   +  V + V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F +      L R  +  D+ +   NSS          IV A ++ +  + ++  V V + DIND  P FT       G      I     T + ++ ATD+DSG  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D   P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F     T    +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V + +LD NDN P F
Sbjct:  187 VTVIRELDYETTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGN-TNSIFALDYISGVLTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRTPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTIIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNQITYSIVSASAFG--SYFD-ISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--STQFRI----NARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNGPVGKRH-TGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSILQLKATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRER---NSS-------HVLIVEAYNHDLGPMRSSVRVIVYVEDINDEAPVFTQQQYSRLGLRETAGIG----TSVIVVQATDRDSGDGGLVNYRI--LSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQAPP-----------------FNQGFCSVYITLLNELDEA----VQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYITVLDENDNSPRF 1418          

HSP 3 Score: 257.684 bits (657), Expect = 2.648e-67
Identity = 357/1393 (25.63%), Postives = 576/1393 (41.35%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAI---LVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFK--KFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYK---ILLQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLM-----NFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE--NIYPFQSDLAAQL 4867
            LDYE      + + A D A   +  F   +I +++  D    F N+SY + + E L + T ++ V A   D   +   +++          F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +  I +LD NDNS  FD       S+ E+   G  +   + +   D D  +N Q     V++  + +I   + IV  N +I    V R  +   LD+  I  +  S +G         P      + + ILD+NDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  K   F +D  +G I T           DRE      +VA   D G   L   T V + + D NDN P+F+   Y+  L E         + ++A D D +  N  + Y     ++   N ++ F+I+   G +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+        T N   ++G    + F       +N T GIV V   LDRE+       I V D   E P   +  +  L I + D NDN P+F  S +Q  + E+    + ++           D DI   + Y L    S  F ++S +G + +     +DRE  S   L   +   D + L+NST    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F + L   +  +   TI         + ++   RGT+    +  V I + D+N++ P F       S + E    GT+I  + A D D   N  + Y    I+ + DTD  +        VN + G ++V S + + L A +   ++ +DN   +P  S    N  + V ++D+NDN P F     P   +     I E     T +  ++A D D GLNG + + L  +            +G +   R+ D E      F V A+D G+P   + + +                 YL +     N  I++ P    S   +      +G +    TA D D G  ALI Y        F ++P +G ++ +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D      LTY +E   +  F  D+ + L
Sbjct: 1271 LDYETKTSYMMNVSATDQAPPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDAITGVITVQGLVDREKGD------FYTLTVVADDGGPKVDSTVKVY--ITVLDENDNSPRFDFTSDSAVSIPEDCPVGQRV---ATVKAWDPDAGSNGQ----VVFSLASGNIAGAFEIVTTNDSIGEVFVARPLDREELDH-YILQVVASDRGTP-------PRKKDHILQVTILDINDNPPVIESPFGYNVSVNENVGGGTAVVQVRATDRDIGINSVLSYYITEGNKDMAFRMDRISGEIATRPAPP------DRERQSFYHLVATVEDEGTPTLSATTHVYVTIVDENDNAPMFQQPHYEVLLDEGPDTLNTSLITIQALDLD-EGPNGTVTY-----AIVAGNIVNTFRIDRHMGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFEVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSIMDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGMPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNARL-----TFNI--TAGNRERAFF-------INATTGIVTVNRPLDRERIPEYKLTISVKDN-PENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQSGLFDINSSTGVVTVRSGVIIDREAFSPPILELLLLAED-IGLLNSTAHLLITILDDNDNRPTFSPATLTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEAGAQDRFLIHLVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDINDSRPEFLNPIQTVS-VLESAEPGTVIANITAIDHDL--NPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNVLDVNDNTPQF----KPFGITYYMERILEGATPGTTLIAVAAVDPDKGLNGLVTYTLLDLVPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPV-----------------YLEIVDINDNNPIFDQP----SYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDGESKFAINPTTGDIYVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMMATDQDEGPNGELTYSLEGPGVEAFHVDMDSGL 2564          

HSP 4 Score: 236.498 bits (602), Expect = 8.096e-61
Identity = 383/1431 (26.76%), Postives = 594/1431 (41.51%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDS--GIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR--VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSN------LNFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN---------NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGV--PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAV------DRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E+         + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + I + I   D+D         + V  N T+SIF +  I      +L +   NG  LD E         +++KG ++      P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD   G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD D           F  +S    +  D F ++  TG + ++  +D E I      L ++A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL++ V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      Q +I         + SL   T    +N   G +   S+LDRE  S     ++ +D         +T  AT+ I +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I    A LDRE              VS +D G   + +T S TV    LD+NDN+P F +   V  + E    G    + VA D D G N +V +  P          NSSS       G +   T L    I  Y+L +   D   GT     +  + I+V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I     T   +   F +   +   + +V    +   A +  I+ A+DNG    R +   TV VT++D+NDN P F         SS + S+ E+     +I  + ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +   V A  +DLG   + S+V +                  ++    I +    FT    S L   +   + T+V      DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A   +              PFN     V + +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  + Q K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYETTQA------YQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAI---DQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGVLTL---NG-LLDRENPLYSHGFILTVKGTELND-DRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNISLYE---NVTVGTSVLTVLATDNDAGT--------FGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTIIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYG----QESI---------IYSLEGSTQF-RINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQ--KTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS-------GVVVTTTELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFI-----TGGNVDGKFSVGYRDAVVRTVVGLDRETTAA-YMLILEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSILQLKATDADEGEFGRVWYRI--LHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAYNHDLG--PMRSSVRV------------------IVYVEDINDEAPVFTQQQYSRLGLRETAGIGTSVIVVQATDRDSGDGGLVNYRILSGAEGKFEIDESTGLIITVNYLDYETKTSYMMNVSATDQA-------------PPFNQGFCSVYITLLNELDEAVQFSNASYEAAILENLALGTEIVRVQAYSID----NLNQITYR------FNAYTSTQAKALFKIDAITGVITVQGLVDREKGDFY 1385          

HSP 5 Score: 230.72 bits (587), Expect = 4.459e-59
Identity = 335/1303 (25.71%), Postives = 553/1303 (42.44%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + ++TA D+D G    I Y++   +    F +D  +G +  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD ++  N  +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    +++++ +N++  T++L + ATD D       +++Y     D   F ++      TG I+     ARL    ++    T+ A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I+         S     S F+    I L +  G++ V   LD E+ S   G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET S     V   DG    N     +TV+IT+LD+NDN P + D    +N+ E+T   +     VA D D GEN  +++       ++  NS++    +    L    P         K+++ + D  R  +    S  V + ++D+N+N P F  + +  + + E    G  I +V+A D D G NG VSY++ +      F++        +  G ++  + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + +   N D + F +      +  +   DRET   Y   + A D G                +   +     N  +   S YE      S+      G  I  +  A D D G    + Y I  G+    F +   +G L  G +  DRE   ++   V A     +  GP            S  RV+V + DIND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLAQDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYETTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGVLTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNS-MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVLTVLATDNDAGTF--GEVSY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTIIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIV---------SASAFGSYFD----ISLYEGYGVISVSRPLDYEQIS--NGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLIN-------SSSGVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITGGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYMLILEAIDNG-----PVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSILQLK-ATDADEGEFGRVWYRILHGNHGNNFRIHVSNGLLMRGPRPLDRERNSSHVLIVEAY---NHDLGPMR----------SSVRVIVYVEDINDEAPVFT 1209          

HSP 6 Score: 187.193 bits (474), Expect = 7.528e-46
Identity = 281/1058 (26.56%), Postives = 460/1058 (43.48%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKD---------SGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDR-EKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG---TIHFKKS---KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   I + D  D  P+F  S+Y + + E  P  T +      + A+D D+ + + V Y L      +  F IN ++G + +   +IIDRE+      F     +L ++A +    L NS+   + I ILD NDN   F        + EN   G +++   ++   D+D  LN    Y + A   ++    F ++ +        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  +TA D D          GI  K       P ++  F ++ +TG++      N +        YE  L V+  A+D       + N    + +L D+NDN P F+   + +Y   + E +   T   + V A D D  + N  + Y    + + PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V +++   T IL + ATDAD  N   + I Y L G     F +    NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D   N +L Y        ++   GV     F+V      +   G+V  Q  L   EK+S     + V+  A +   PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE+ +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    N    F L  DG L ++  L       +  I++   N     PRG   T+        +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1908 VTVNRPLDRERIPEYKLTISVKDNPENPRIARRDYDLLLIFLSDENDNHPLFTKSTYQAEVMENSPAGTPLTVLNGPILALDADQDIYAVVTYQLLGAQ--SGLFDINSSTGVVTVRSGVIIDREA------FSPPILELLLLAEDIG--LLNSTAHLL-ITILDDNDNRPTFSPATLTVHLLENCPPGFSVL---QVTATDEDSGLNGELVYRIEAGAQDR----FLIHLVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTVIANITAIDHDLNPKLEYHIVGIVAKDDTDRLVPNQEDAFAVNINTGSVMVKSPMNRELV----ATYEVTLSVIDNASDLPERSVSVPNAKLTVNVL-DVNDNTPQFKPFGITYYMERILEGATPGTT-LIAVAAVDPDKGL-NGLVTYTL--LDLVPPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNF--ALIEYSL-GDGESKFAI----NPTTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMMATDQDEGPNGELTY--------SLEGPGV---EAFHV------DMDSGLVTTQRPLQSYEKFS-----LTVV--ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNV------YEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQTAQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEEKNFHLQPDGCLLVLRDLDREREAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYSIL 2886          

HSP 7 Score: 138.658 bits (348), Expect = 4.183e-31
Identity = 154/578 (26.64%), Postives = 260/578 (44.98%), Query Frame = 2
Query:  779 GSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQD--SAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSR---TFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGN--SSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLM---NMTTVIIILKDLNDNPPIFEVR----FYQAWLFENSYNFTFGPVRVKATDK-DVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVA-----YDPSN--SSMFDTCI------IQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESN 2413
            G V L   S  ++     +DYE    +   ++A D  S    +    +++++D+ D  PIF   SY   + E++PV T ++TVTA D D    + ++YSL DG      FAIN T+G+I +   +DRE +D       + LT +A +    + ++ R     V IQ+LD+ND    F +P +  SVYEN  AG ++I    +M  D+D   N +      Y+ +   +   +  V M+  ++  +    S   YE+     V+  G +  P++         + + ++DVNDN P+F    +     I E  P  + +  V ATDKD G+ G + YS      N  ++ F+ID  +G I T          LDRE+     ++ +A+D G  +    M  + + L+D++DN P+F VR      Q  L     +   G +    T   D D   N I+Y F    +   N   NF +    G + ++  +DRE+    I   +V A     + P    S   D         ++++++D+ND  P F    ++  V  +    + ++ + A DAD  N
Sbjct: 2342 GYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQPSYQEAVFEDVPVGTIILTVTATDADSGNFALIEYSLGDG---ESKFAINPTTGDIYVLSSLDREKKD------HYILTALAKDNPGDVASNRRENSVQVVIQVLDVNDCRPQFSKPQFSTSVYENEPAGTSVIT---MMATDQDEGPNGEL----TYSLEGPGVEAFH--VDMDSGLVTTQRPLQS---YEKFSLTVVATDGGE-PPLWGT-----TMLLVEVIDVNDNRPVFVRPPNGTILHIREEIPLRSNVYEVYATDKDEGLNGAVRYSFLKTAGNRDWEFFIIDPISGLIQT-------AQRLDRESQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLF-VRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYF----IAAGNEEKNFHLQPD-GCLLVLRDLDRER--EAIFSFIVKASSNRSWTPPRGPSPTLDLVADLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN 2877          

HSP 8 Score: 117.472 bits (293), Expect = 1.227e-24
Identity = 160/578 (27.68%), Postives = 238/578 (41.18%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDS--GLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD   GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D G    + Y F+ D   F LD  +G +  I   D E    ++ T+    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I +   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYETTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYSTN-IYEHSPPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNISLYENVTVGTSVL-----------TVLATDNDAGTFGEVSYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTI----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNQITYSIVSASAFGS 608          
BLAST of Cadherin-23 vs. UniProt/SwissProt
Match: sp|P58365|CAD23_RAT (Cadherin-23 OS=Rattus norvegicus OX=10116 GN=Cdh23 PE=2 SV=1)

HSP 1 Score: 407.912 bits (1047), Expect = 1.361e-113
Identity = 455/1631 (27.90%), Postives = 710/1631 (43.53%), Query Frame = 2
Query:  818 TLTTPLDYERFPMIQLQLQAQDSAYHV--SINFTFIQVIDVEDVPPIFQNSSYSSTMNEEL-PVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSV-YENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSI----KGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG-----GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTF-----GPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPV--DREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNA---RLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAF---ATLRIEILDVNDNPPIFQT---SLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFD---PSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKK--SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG--DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYG--DGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNF--ISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIY 5554
            T   P D ER     L +  +D       +    ++ ++D  D  P+FQ   Y   ++E    V+T +ITV A+D D      V Y++  GN  N  F IN  +G I  A  +D E        G + L V AT+  P L +  +S T V + + DINDN   F +  Y+G       Q G  +      +  D+D   N Q   S V  +     F + P+        V+RV+    LD E I   N++I    +G+        P  S   V I +LD+NDN P+  N      I ENSP  + +  V A+D DSG    + +++   +  + F I+++TG +  N         LDRE      +     D          +   +++ L D NDN P+F    YQA + ENS   T      GP+     D+DV      + YQ          + D F I+ STG VT+ + V  DRE      L+LL++A D     +  T  + I + D NDN P F    ++V++ +N     ++L + ATD D       ++ YR+       F++    +P TG I  +  NA   R +   +  TV A+DRG  PLS    + I + +IND  P F   + + S  E+ + G  I  V A D D N  L Y I+           VP     +  +   +N   G V V+S L+RE  +T    + VID A++  LP ++     A L + ILDVNDN P F+    + +   + E   P      G T   V A D D  + G + Y   D   P      DS +G++   + +D E V  LNFTV  SD      +    V + ++D+NDN P F        + E   VGT+  +  A D+D+G N  +I Y   +    F ++ + G + +++ L      +Y L     DNP      ++  S +V I V+DVN+  P FS+  +  S + E    GT +  +LATD+D G NG ++Y  L     + F + +       D G +     L++   RF   V A D G P L     + V +ID+NDN P F   V P NG+           + +  + ATDKD GLNG +R++    + N D E+F I PISG +   +  DRE + +Y   ++A+DLG P     V  E +         +  +  L +            ++   S  G  +GNV  AVD D G NA++ Y      +   F+L P  G L  +++ DRET+  +S  V+A     +    GP   L   +     E RVV  + DIND PP FT      G+   A   S+++ +     D DI + + + Y I  I+ F+   A    + ++  VF +    GIL T     F     G+  + I   D    N D  I+    +   Q+V  VI   P  V      F   LSN+    +  D V+   D++G +    T L  H V+  +N +++   ++ ++++      +L   Y +LD +   +   P  +    +  +I L+   F+  ++  +  W YR+ ++ KL+A    S       + + +P TN Y
Sbjct: 1585 TRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTVNTSLITVQALDLDEGPNGTVTYAIVAGNIINT-FRINRRTGVITAAKELDYEIS-----HGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRD-YEGPFDVTEGQPGPRVWT---FLAHDRDSGPNGQVEYSVVDGDPLGE-FVISPVEG------VLRVRKDVELDRETIAFYNLTICARDRGVP-------PLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVN-------RPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAV---VTYQLLG------THSDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLLAEDVGQ--LNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQITATDEDSGL--NGELVYRIEAGAQDRFLI----HPVTGVI--RVGNATIDREEQESYRLTVVATDRGTVPLSGTATVTILIDDINDSRPEFLNPIQTVSVLESTEPGTVIANVTAIDLDLNPKLEYHILSIVAKDDTDRLVP-----DQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASD--LPERSVSVPNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATP------GTTLIAVAAVDPDKGLNGLITYTLLDLIPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQLSYQEAVFEDVAVGTVILRVTATDADSG-NFALIEYSLVDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTS-VYENEPAGTSVITMLATDQDEGSNGQLTYS-LEGPGMEAFSVDM-------DSGLVTTQRPLQSY-ERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVF---VRPPNGTILHIKEEIPLRSNVYEVYATDKDEGLNGAVRYSFLKSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQP-----VPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEDKNFHLQP-DGRLLVLRDLDRETEAIFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVV--LEDINDQPPRFTKAEYTAGVATDAKVGSELIQV--LALDADIGNNSLVFYGILAIHYFR---ALANDSEDVGQVFTMGSVDGILRTFD--LFMAYSPGYFVVDIVARDLAGHN-DTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAISVQLPD-DMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFIDIMDMPNTNKY 3121          

HSP 2 Score: 339.347 bits (869), Expect = 2.835e-92
Identity = 401/1339 (29.95%), Postives = 588/1339 (43.91%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQA--QDSAYHVSI--NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATE----TAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSM-GPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNT-PQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVT--EINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQI--QVIDKAAETPLPP--QTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLY--FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQ-----LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVA--TAVDRDIGYNA----LIVYIFTGDT-----VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            +T+   LDYE     QL + A  QD    +S   N   I + DV+D+ PIF N  YS+ + E  P  T V  +TA+D D+     + Y++  GN  N  FA++  SG + +  ++DRE+   ++  GF  LTV  TE     +PS    + TF  I ++DINDN+  F+   Y  ++ E +Q G A+ +   I V DKD   N+ + +  V NN  S  F + P     KA + IRV     LDYE +   +  +   +  P        YA V I +++ NDN PIF    Y   ++EN    T +  V ATD D G FG++ Y  +D   +F +D  TG I   + A  DY L+     +R  +  IA DGGG      V I + D+NDN P F+   Y   L EN  + T   VR++ATD+D    NN I Y   N S  G  +Y D   +    G +++  P+D E+IPN ++ L V+A D  N  ++ T  + I V D NDN P F    + V+V +NI    T+LFLNATD D S    Q  I Y L G  S  F +    N ++G I       R     +   V A D G        I  +NVT  +IND  P +  + +  +  E      ++  V A DPD   N  L Y I             P N  +++      + TG I     MLDRE    +  ++  ++I    +   PP   T+ AT+ + +LD+NDN P FQ   F   + E          G + + V A D+D  + G + Y      P + F ++S SG +     LDRE ++     V  SD         ST++I VLDVND  P F   +  +++SE              D+D G NA + ++    N    F +   D  +  +  L       Y L++E +DN         +  V + V+DVN+N PIF Q  YE S + E    G  I ++ ATD D GE G V Y+IL     + F L      L R  +  D+ +   NSS          +  A ++ +  + ++  V V + D+ND  P FT       G      I     T + ++ ATD+D+G  G + + +  ++G    F I   +G +  +   D ETK  Y   V A D G P                     F S Y+ +   + E        SN+S     + N+A  T + R   Y+      I Y F   T      +F +D  +G +      DRE  D Y+ TV A       DG         P   S  +V V +LD NDN P F
Sbjct:  187 VTVIRELDYEVTQAYQLTVNATDQDKTRPLSTLANLAII-ITDVQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYISGALTLNGLLDRENPLYSH--GFI-LTVKGTELNDDRSPSDATVTTTF-NILVIDINDNAPEFNSSEYSVAITELAQVGFALPLF--IQVVDKDEGLNSMFEVYLVGNN--SHHFIISPTSVQGKADIRIRV--AIPLDYETVDRYDFDLFANESVP----DHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIM--LIARLDYELI-----QRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVT-QLVRLRATDED-SPPNNLITYSIVNASAFG--SYFD-ISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEG--SSQFRI----NARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGKNGTLVYSI------------QPPNKFYSLN-----STTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLE------GTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGTATVFVTVLDVNDNRPIFLQSSYEAS-VPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRLHVSSGLLVRGPRPLDRER---NSS-------HVLMAEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG----TSVIVVRATDRDTGDGGLVNYRI--LSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSATD-GAPPFNQG----------------FCSVYVTLLNELDEA----VQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVA------DDG--------GPKVDSTVKVYVTVLDENDNSPRF 1416          

HSP 3 Score: 254.988 bits (650), Expect = 1.704e-66
Identity = 367/1381 (26.57%), Postives = 584/1381 (42.29%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQG-SVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ----IKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNS-SYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK--FVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT-VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPS---NSSMFDTCIIQIIVQDVNDNAPVFGLN---TFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGA--IIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQY-LYFDPSLSFYVDSISGQIFLIKA--LDRETVSN--LNFTVSCSDGVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLITPLTIYGIFY-------------YKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL---LQKDTDVFILQLFRIQKVN-DKGQILVNSSL-KNLGARFTFIVNAVDNG--VPRLS---NNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIE 4828
            LDYE      + + A D A   +  F   ++ +++  D    F N+SY + + E L + T ++ V A   D   +   ++           F I+  +G I +  ++DRE  D      F+ LTV+A +  P + ++ + +V   +LD NDNS  FD       SV E+   G  +   + +   D D  +N Q     V++  + +I   + I+  N +I  + V     LD E+    I  I  S +G         P      + + ILDVNDN P+  +   Y   + EN    T +  V ATD+D GI   + Y + +  +   F +D  +G I T   A  D    +R+ +  L VV +  +G   ++ TT V + + D NDN P+F+   Y+  L E         + V+A D D +  N  + Y     ++   N ++ F+IN  TG +T    +D E I +    L+V A D     +  +  T  + + V D+NDN P F  +    F V   Q      T L   A D D    P   + Y ++  D +    E V +P  G   + K     R  +  +N T+ A DRG PPLS+ +++ I V +IND  PV      + +  EN  +   +  V A+D D+ C+    ++   I A N       + F       +N T GIV V   LDRE+       + V D   E P   +  F  L + + D NDN P+F    +Q  + E+    + ++           D D+   + Y L    S  F +D+ +G + +     +DRE  S   L   +   D V  +N T    IT+LD NDN P F      +++ E    G    +  A D D+G N  +++     +   F         LI P+T  G+               Y+L +   D  RGT+    +  V I + D+N++ P F       S + E T  GT+I  V A D D   N  + Y IL    + DTD  +        VN + G ++V S L + L A +   ++ +DN   +P  S    N  + V I+D+NDN P F  P   +  +           TLI  ++A D D GLNG I + L  +            +G +   R+ D E      F V A+D G+P   + + + + ++D++DN P+F  + L    +++E     T I              TA D D G  ALI Y        F ++P +G ++ +   DRE KD Y  T  A       D P    S       +  +VV+ +LD+ND  P F+ P     + +     + +  I+   TD+D  S   LTY +E
Sbjct: 1269 LDYETKTSYLMNVSATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNLNQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGD------FYTLTVVADDGGPKVDSTVKVYV--TVLDENDNSPRFDFTSDSAISVPEDCPVGQRV---ATVKARDPDAGSNGQ----VVFSLASGNIAGAFEIITSNDSIGEVFVAKP--LDREELDHYILKIVASDRGTP-------PRKKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMDRISGEIATR-PAPPDR---ERQNFYHL-VVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPHYEVVLDEGPDTVNTSLITVQALDLD-EGPNGTVTY-----AIVAGNIINTFRINRRTGVITAAKELDYE-ISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTEGQPGPRVWTFL---AHDRDSG--PNGQVEYSVVDGDPLG---EFVISPVEGVLRVRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNITISENSPVSSFVAHVLASDADSGCNA---LLTFNITAGNRE----RAFF-------INATTGIVTVNRPLDRERIPEYRLTVSVKDN-PENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGVIIDREAFSPPFLELLLLAED-VGQLNGTAYLFITILDDNDNWPTFSPPAYTVHLLENCPPGFSVLQITATDEDSGLNGELVYRIEAGAQDRF---------LIHPVT--GVIRVGNATIDREEQESYRLTVVATD--RGTVPLSGTATVTILIDDINDSRPEFLNPIQTVS-VLESTEPGTVIANVTAIDLDL--NPKLEYHILSIVAKDDTDRLVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNILDVNDNTPQF-KPFGITYYTERVLEGATPGTTLIA-VAAVDPDKGLNGLITYTLLDLIPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIF--DQLSYQEAVFEDVAVGTVILR-----------VTATDADSGNFALIEYSLVDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALA------KDNPGDVASNRRE---NSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSV--ITMLATDQDEGSNGQLTYSLE 2547          

HSP 4 Score: 235.728 bits (600), Expect = 1.270e-60
Identity = 391/1429 (27.36%), Postives = 598/1429 (41.85%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQ---IKSINVSIKGLQIAPVFNIPEDSYADVS--IAILDVNDNTPIFGNSSYTFMIFENSP-NFTLIGVVTATDKDSGIFGKI-IYSLNDPFKKFVIDSST----GAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGP--VRVKATDKDVDVANNRILYQFYNMSMGPPNYL-----DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV--RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKA-LDRETVSNL------NFTVSCSD-GVFLVNSTVSITV----LDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY---------FPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVP---RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITII--SATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--SNIRSFDRETKDLYKFRVLA--NDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNL-NIDTVFALNITSGILSTAPGVFF 4945
            L  PLD E      ++    D    ++     IQV DV D  P F N  YS  + E  PV T +  V A D D      V YS +   P +++FAI+   G + +   +D E      V   + LTV AT+   +   S+   + I I D+ D    F    Y  ++YE+S  G  + +   I   D+D         + V  N T+SIF +  I       L +   NG  LD E         +++KG ++    + P D+    +  I ++D+NDN P F +S Y+  I E +   F L   +   DKD G+     +Y + +    F+I  ++      I   V    DY  +DR  ++ LF      D  G      V I L + NDN PIF    Y   L+E   N T G   + V ATD DV              + G  NY      D F ++  TG + ++  +D E I      L V+A D        T  ++I V DVNDN P F  + +   + +N  + T ++ L ATD D  + P + ITY ++   +     +       G I    P    Q+   +   TV A D G PPL + V + I V + ND PP F++  +  S  EN+  G  +  +NATD D + +      ++ I ++  S     S F +      N   G +   S+LDRE  +     ++ +D         +T  AT+ + +LD+NDN P ++ + +  +L E   P S+++T      V A D D+   GTL Y    P+  + ++S +G+I      LDRE    +         VS +D G   + +T S TV    LD+NDN+P F +   V  + E T  G    + VA D D G N +V +          F  NS+S       G +T    L    I  Y+L +   D   GT     +  + I V+DVN+  P F    Y  S ++E       +  +  TD D G N  +SY I        F +  +R   V       V    +   A +T ++ A+DN VP   R +   TV VT++D+NDN P F         SS + S+ E+     +I+   ATD D G  G + + +  ++G+H   F   +S  L     R  DRE    +     A  +DLG   + S+V + V V D++D  PVF +        + E     TS+            V  A DRD G   L+ Y I +G    F +D  +G +  +   D ETK +Y   V A               G  PFN     V V +L+  D    F+  +    I++     ++IV +  Y  D    + N +TY       F +  +AQ K L  ID +  +    G++    G F+
Sbjct:   89 LRQPLDRETKSEFTVEFSVSDHQGVITRKVN-IQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQ---PPSQFFAIDSARGIVTVIRELDYE------VTQAYQLTVNATDQDKTRPLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRV---ITAVDQDKGRPRGIGYTIVSGN-TNSIFALDYI----SGALTL---NG-LLDRENPLYSHGFILTVKGTELNDDRS-PSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFD-LFANESVPDHVGYAK---VKITLINENDNRPIFSQPLYNVSLYE---NITVGTSVLTVLATDNDVG-------------TFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQR--FTLTVIARDGGGEET--TGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDED--SPPNNLITYSIVNASAFGSYFDISVYEGYGVISVSRPLDYEQIPNGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQ---ESIIYSLEGS-----SQFRI------NARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQ--KTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTT------VVAVDPDLGKNGTLVYSIQPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPFVAEVLEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVINSTS-------GVVTTTAELDRERIAEYQLRVVASD--AGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVS-VSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVG-YRDAVVR-----TVVGLDRETTAAYTLVLEAIDN-VPVGKRRTGTATVFVTVLDVNDNRPIFLQ-------SSYEASVPEDIPEGHSIVQLKATDADEGEFGRVWYRI--LHGNHGNNFRLHVSSGLLVRGPRPLDRERNSSHVLMAEAYNHDLG--PMRSSVRVIVYVEDVNDEAPVF-TQQQYNRLGLRETAGIGTSVI-----------VVRATDRDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVSAT-------------DGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSID----NLNQITYR------FDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFY 1383          

HSP 5 Score: 224.557 bits (571), Expect = 3.335e-57
Identity = 338/1306 (25.88%), Postives = 557/1306 (42.65%), Query Frame = 2
Query:  947 PIFQNSSYSSTM--NEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQ-DITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDRE--AYERLFVVAIATDGGGLMN----------MTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTI--VTPVDREKIPNDILQLLVVAYDPSNSSMFDT---CIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQ---VRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI---VGTLQYLY-FDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN-----STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIF-------YFPNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNP---VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLAND---LGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTV-MFYLDPFSGHLF-GIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFT 4705
            P F N  + + +  +E+ PV + V  + A D D     P+ + +  G   + +FA+   +G + +   +DRE++ + T  F   D   + T             V IQ+ D+NDN+  F    Y   + EN+  G  I I   +   D DL A      S +Y+ +  S F  + I +    + VIR      LDYE  ++  +++           P  + A+++I I DV D  PIF N  Y+  I+E+SP  T + V+TA D+D G    I Y++   +    F +D  +GA+  N        LLDRE   Y   F++ +    G  +N           TT  I++ D+NDN P F    Y   + E +      P+ ++  DKD  + +   +++ Y +     +++ +        D+ I    P+D E +      L       +N S+ D      ++I + + NDN P+F    ++V++ +NI+  T++L + ATD D       ++ Y     D   F ++      TG I+     ARL    ++    TV A D G    + RV   INV ++ND  P F +  +  +  EN      + ++ ATD D+  N  + Y I       VN+S     S F+++   G     G++ V   LD E+     G I +   A +   PP  +   + IE+ D NDNPP F    +  S+ E      NI  GAT  ++ ATD+D     G    +Y  + S  F +++ SG+I     LDRET +     V   DG    N     +TV++T+LD+NDN P + D    +N+ E+T   +     VA D D G+N  +++       ++  NS++    +    L    P  +      K+I+ + D  R  +    S  V + ++D+N+N P F  + +  + + E T  G  + +V+A D D G NG VSY++ +      F++        +  G +   + L +   A +   V A D G P  S+  T+ + ++D+ND  P+F      VS S     +F         +  ++ TD D GLN E+ + + + N D + F +      +  +   DRET   Y   + A D   +G     +A         +   +     N  +   S YE      S+      G  I  +  A D D G    + Y I  G+    F L   SG L  G +  DRE   ++     A     +  GP            S  RV+V + D+ND  PVFT
Sbjct:   29 PFFTNHFFDTYLLISEDTPVGSSVTQLLARDMDND---PLVFGVS-GEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRK-----------VNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFI---VNATDPDLGAGG----SVLYSFQPPSQF--FAIDSARGIVTVIRE-----LDYEVTQAYQLTVNATDQDKTR--PLSTLANLAIIITDVQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLN-------GLLDRENPLYSHGFILTVK---GTELNDDRSPSDATVTTTFNILVIDINDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDEGLNS---MFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLF------ANESVPDHVGYAKVKITLINENDNRPIFSQPLYNVSLYENITVGTSVLTVLATDNDVGTF--GEVNY-FFSDDPDRFSLDK----DTGLIMLI---ARLDYELIQRFTLTVIARDGGGEETTGRV--RINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNLITYSI-------VNASA--FGSYFDISVYEGY----GVISVSRPLDYEQIP--NGLIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVVE------NIMAGATVLFLNATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKAEYILIVRAVDGGVGHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGKNGTLVYSIQPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKATSSATVFVNLLDLNDNDPTFQNLPF-VAEVLEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQVGMPRMDFVIN-------STSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTIRVLDVNDETPTFFPAVYNVSVSEDVPREFR--------VVWLNCTDNDVGLNAELSYFITAGNVDGK-FSVGYRDAVVRTVVGLDRETTAAYTLVLEAIDNVPVGKRRTGTAT--------VFVTVLDVNDNRPIFLQSSYEA-----SVPEDIPEGHSIVQLK-ATDADEGEFGRVWYRILHGNHGNNFRLHVSSGLLVRGPRPLDRERNSSHVLMAEAY---NHDLGPMR----------SSVRVIVYVEDVNDEAPVFT 1207          

HSP 6 Score: 196.438 bits (498), Expect = 1.202e-48
Identity = 279/1055 (26.45%), Postives = 454/1055 (43.03%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSI-----NFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVIT----VTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIII--AMIIDRESQDITNVFG--FFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTG-AIYTNVNANTDYTLLDRE---AYE-RLFVVAIATD----GGGLMNMTTVIIILKDLNDNPPIFE---VRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTR----VIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIF--QTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD----GVFLVNSTVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFV-ANDSDAGENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDN-----PRG------TIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKIL 3769
            +T+  PLD ER P  +L +  +D+  +  I     +   + + D  D  P+F   +Y + + E  P  T +      + A+D D  + + V Y L      ++ F I+ ++G + +   +IIDRE+      F   F +L ++A E    L  ++  F  I ILD NDN   F  P Y   + EN   G +++   +I   D+D  LN    Y + A   ++    F ++P+        VIRV N + +D E+ +S  +++          +P    A V+I I D+ND+ P F N   T  + E++   T+I  VTA D D  +  K+ Y +      D   + V D     A+  N  +    + L+RE    YE  L V+  A+D       + N    + IL D+NDN P F+   + +Y   + E +   T   + V A D D  + N  I Y    + + PP Y+     ++S G V     VD E++    L   V A D  +        + + + D+NDN P+F   ++   V ++++  T IL + ATDAD  N       + LI    V+   +   NP TG I       R +   +  T  A D      S R    V ++I V ++ND  P F++  FS S YEN   G ++  + ATD D  +N  L Y +    + A                   ++   G+V  Q  L  + Y      +   D       PP      L +E++DVNDN P+F    +     + E+   +SN+      + V ATD D  + G ++Y +   + +     F +D ISG I   + LDRE  +  +  +  SD      +     + + + D++DNEP FV         Q+L + E +  GT+      A D+D G NA+V ++    N    F L  DG L ++  L       +  I++   N     PRG       +     +EV + + D+N+  P F++  Y     T+   +G+ + +VLA D D G N  V Y IL
Sbjct: 1906 VTVNRPLDRERIPEYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADEDVYAVVTYQLL--GTHSDLFVIDNSTGVVTVRSGVIIDREA------FSPPFLELLLLA-EDVGQLNGTAYLF--ITILDDNDNWPTFSPPAYTVHLLENCPPGFSVL---QITATDEDSGLNGELVYRIEAGAQDR----FLIHPVTG------VIRVGNAT-IDREEQESYRLTVVATDRG---TVPLSGTATVTILIDDINDSRPEFLNPIQTVSVLESTEPGTVIANVTAIDLD--LNPKLEYHILSIVAKDDTDRLVPDQEDAFAVNINTGSVIVKSPLNRELVATYEVTLSVIDNASDLPERSVSVPNAKLTVNIL-DVNDNTPQFKPFGITYYTERVLEGATPGTT-LIAVAAVDPDKGL-NGLITYTL--LDLIPPGYVQ--LEDSSAGKVIANRTVDYEEV--HWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQLSYQEAVFEDVAVGTVILRVTATDADSGN-------FALIEYSLVDGEGKFAINPNTGDIYVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEPAGTSVITMLATDQDEGSNGQLTYSLEGPGMEA-----------------FSVDMDSGLVTTQRPL--QSYERFNLTVVATDGGE----PPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNV------YEVYATDKDEGLNGAVRYSFLKSTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEGPNAIVYYFIAAGNEDKNFHLQPDGRLLVLRDLDRETEAIFSFIVKASSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATD-AKVGSELIQVLALDADIGNNSLVFYGIL 2884          

HSP 7 Score: 125.176 bits (313), Expect = 5.879e-27
Identity = 162/576 (28.12%), Postives = 239/576 (41.49%), Query Frame = 2
Query: 3167 FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKN----LGARFTFIVNAVDNGVPRLSNNCTVAVT----IIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPIS-GNLSNIR-----SFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQS 4849
            F V+  +G ++L + LDRET S      S SD   ++   V+I V DVNDN P F +    + I E T VGT      A D D G    V++ F    S  F + S  G +T+I  L       Y+L +   D  + T        + I + DV +  PIF  + Y  + I E++  GT +  + A D+D G    + Y I+      +F L           G + +N  L          F   V   +    R  ++ TV  T    +IDINDN P F +    S  S     + +    L   I   DKD GLN      L   N  H  F ISP S    ++IR       D ET D Y F + AN+   P       +++ +++ +DN P+F  +  L N S+YE     TS+               A D D+G    + Y F+ D   F LD  +G +  I   D E    ++ TV    +++ G G             +  RV + +LD+NDN P F     +G + +     +Q+V +    TD+D    N +TY I N   F S
Sbjct:   78 FAVEPDTGVVWLRQPLDRETKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSF-QPPSQFFAIDSARGIVTVIRELDYEVTQAYQLTVNATDQDK-TRPLSTLANLAIIITDVQDMDPIFINLPYSTN-IYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTNSIFALDYI-------SGALTLNGLLDRENPLYSHGFILTVKGTELNDDRSPSDATVTTTFNILVIDINDNAPEFNS----SEYSVAITELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHH--FIISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANE-SVPDHVGYAKVKITLINENDNRPIF--SQPLYNVSLYENITVGTSVL-----------TVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIMLIARLDYELIQRFTLTV----IARDGGGEE-----------TTGRVRINVLDVNDNVPTFQKDAYVGALRENEPSVTQLVRLR--ATDEDSPPNNLITYSIVNASAFGS 606          
BLAST of Cadherin-23 vs. UniProt/SwissProt
Match: sp|Q2PZL6|FAT4_MOUSE (Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2)

HSP 1 Score: 344.354 bits (882), Expect = 9.471e-94
Identity = 376/1386 (27.13%), Postives = 616/1386 (44.44%), Query Frame = 2
Query:  794 GYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAY-----HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKD-GNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSA-----NFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSA-VYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIK---GLQIAPVFNI-PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIF-EVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD--IVGTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVL--DVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLSLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPR-LSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI--ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNV---ATAVDRDIGYNALIVYIFTG--DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYP 4840
            G  +   L     LD E  P  QL ++ +D        ++ +N T   V D+ D PP+F +S Y + + E+  V + V+ V A D D    + ++Y L+D G PF     ++  +G I +   +D E++        + LTV AT+   PSL   +  F  IQ+LD+NDN        F       SV EN+Q G  + +   + V D D  A A  N+S  +        FEV      N ++    +K  S LD E+I S N+++         P   +    S A + I + D+ND+ P+F    Y   + E  P  + +  V+ATD DSG+   + YS+   +    F I   +G + T+         LDRE   ++ +   A D G    ++   +++ + D+ND  P+F +   Y+  + EN+   T   V + ATD+D+   N  + +          N    F+++  +G ++  + +DRE+       L ++A D  +     T  + + + D+NDN+PVF    +  ++ +N    + +  ++ATD D    P   + Y +   D   F + A    K+G I  K    R +   +   V A+D G      + I+ + V +  D PPVF+Q+ +SF  +EN+ +G ++G V+AT  D N +++Y I                   +   +  +N   G +   S++DRE+ S    Q++++           T    + I + D+NDN P F  ++   +  E+++   +I      F  KA D D  + G + Y L  +P   F ++  +G I L+ ALD    S     V+   GV  ++S++ +TV   DVNDN P F      + +SE   V + F K  A+D D+G N  + +   + N+   FG+  DG L + + L       Y L++   D  R       +  V + + DVN+N P+F+   Y F    E    G+ +G+V A DKDFG NG V Y   + +    F L      ++    +    S ++  G A F+F V A+D G+P+ L +  TV V + DINDN P F            Q ++ E    L  +  +SA+D D G NG I +++   N + + F I   SG ++ +   D E    Y   + A D G   L S   + + +LD +DN P FP + L ++                 L   +IG +    TA D D G NA + Y  TG  +   F + P +G +F  K+ D ET+  Y   + A      G  P S          S   VV+ + D NDNPP F    I   IV+     + ++ ++ +  D DI  Q  L+Y I    P
Sbjct:  195 GEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVT---VQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQ----MDPETGLITVREPLDFEARRQ------YSLTVQATDRGVPSLTGRAEAF--IQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVAL---LTVTDADSPA-ANGNISVQILGGNEQRHFEVQRSKVPNLSL----IKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGG-----LDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLV-LGATDRDLG-DNGTVRFSLQEAE----NDQRLFRLDPVSGRLSTASSLDREE--QAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMG--PNGTVKYSISAGDRSRFQIHA----KSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNANISYLITTG----------------DQRGMFAMNPVTGQLTTASVIDREEQSFY--QLKIVASGGAV-----TGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSI------FQAKAVDPDEGVNGRVLYSLKQNPKNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASD--RAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFY-FEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPN--FELHAV-TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFY-------QATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQ-FAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDV----------------LENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITA---KDQGRPPRS----------STMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQ--LSYAIIQQMP 1464          

HSP 2 Score: 285.034 bits (728), Expect = 1.725e-75
Identity = 362/1377 (26.29%), Postives = 603/1377 (43.79%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFP--MIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLK--DGNPFNEYFAINET---SGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKD--LNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE-DSYADVSIAILDVNDNTPI-----FGNSSYTFMIFENSPNFTLIGVVTATDKDS----GIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGL---------MNMTTVIIILKDLNDNPPIFEVRFYQAWLFEN--SYNFTFGPVRVKATDKDVDV-ANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTP--VDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGL-NTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF--DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRET------KDLYKFRVLANDLGTPS-LTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTG-DTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKD 4792
            S   L  T  +D E  P  ++ L + +    Y   +    + V D+ D  P+F + S   T  E+      VI  TA D D        +S +   GN     F ++ T   SGE     ++ +   D      +  L  +  +  P      +  V +Q  DINDN   F    YQ  V E++  G +++   ++   D D   NA+ +Y L         + F++ P       ++ +R      LD+E  +  +++++    A    +P     A+  I +LDVNDN P+     F  +S    + EN+   T++ ++T TD DS    G     I   N+  + F +  S      N++     + LDRE      +    +D  G           ++ +++I + D+ND+PP+FE + Y+  L E     ++  G   V ATD D  + AN R     Y++  G  N L  F I+  +G VT      +DRE     +L   + A D           + + V DVND  PVF     + V+V +N  T T +L L ATD D  +      + +    D   F ++    P +G +       R +   +  ++ A+D G PP S+   + +++ +IND  PVF    +     EN   G  +  V+ATDPD   +     ++ +I+A + S   +++              G++  +  LDRE+ +    Q+QV+         P  A  T  + +LD  DNPP+F  + + F +FE      N++ G     V AT +D+   + YL    D    F ++ ++GQ+     +DRE  S     +  S G    ++ V+ITV D+NDN P+F+  ++ +N  E  Q G    +  A D D G N  V++    N  + F +   +G ++L+  L ++   Y    +EI+ +  G      S  + +YV DVN+N P+F Q+ YE + ++E   + +   +V A+DKD G NG ++Y I    + D F         +   GQ+ + S L + L  R+  +V A D  V  LS    V V + D+NDN P F      S   +  F   +   + +  +SA DKD G NGE+R+  +    +   F +  ++G +++   FDRE+        ++ F V A D G P  L     + V + D++DN P F     L +F  Y+  ++ T+ + + +   ++    +A D D G N LI Y I  G +   F +D FSG +  + + D E    YS  ++AV             SG  P N S   + + ILD NDN P F   T+   +++    N +I ++   VT  D
Sbjct:   86 STGALYTTATIDRESLPSDVVNLVVLSSSPTYPTEVR---VLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGR-FRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQ--DINDNPPVFGSSHYQAGVPEDAVVGSSVL---QVAAADADEGTNADIRYRL-----QDEGTPFQMDP----ETGLITVREP----LDFEARRQYSLTVQ----ATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQ-RHFEVQRSK---VPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSG---VSATDGDSGLNANLR-----YSIVSG--NGLGWFHISEHSGLVTTSAAGGLDRELASQIVLN--ISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLD----PVSGRLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPN---GTVKYSISAGDRSRFQIHA------------KSGVISTKMALDREEKTAY--QLQVVATDGGNLQSPNQAIVT--VTVLDTQDNPPVFSQAAYSFVVFE------NVALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKNLFTINEQNGNISLLGALDVHAGSYQ---VEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVT-LSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAF--------GIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFN-----STNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPN---FELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKF-----LKDF--YQATVSETATNLTQV--LRV----SASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVD------------SGAIPLN-STCTLSIDILDENDNTPSFPKSTLFVDVLE----NMRIGELVSSVTATD 1341          

HSP 3 Score: 278.87 bits (712), Expect = 1.184e-73
Identity = 368/1340 (27.46%), Postives = 576/1340 (42.99%), Query Frame = 2
Query:  788 SLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSAYH---VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTT--VIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQF-YNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYD---PSNSSMFDTCIIQIIVQDVNDNAPVF-GLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDP-DTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTL-TGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGLSL-DGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIY--VIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGAR----FTFIVNAVDNGVP---RLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFS-IYENTI--TLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVM-FYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTI 4708
            + G +   QL + + LD E      L + A D A      ++N T + + DV D  P+F +++Y+    EE    + V  V+A+D D      V+Y+ +   P    F ++  +GEI      DRES         F  TV A +         +  V + + DINDN+  F +  YQ +V E +     ++    +   D D  +N   + S +  N+       + I + +  + ++       LDYE   + ++ I+ +       IP +S   +SI ILD NDNTP F  S+    + EN     L+  VTATD DSG+   + Y++  ++    F I  +TG+I+           LD E      +   A D G     +T  V+I ++D NDNPP F        + EN        + V A D D D+ N ++ Y     M  G     ++F I+   G +     +DRE    ++ +L V A D   P  +  +    + I+V D+NDN P+F   N  + +    I +  T +   A D DE      ++ Y ++  D+  F V+  Y+          P+      ++N  V A+D G  P   +    + V     + PVFTQ+ +     E   IG N+  + A  P  +   + Y+I+     +V      V  LF +    G+ QT  I      LDRE+ + L    +  I+K++  P   +T  A + I + D+NDNPP+F T     ++ E      NI  G+    + A D D        Y        SF +D  SG +   K LDRE  S  +  V   DG+   +  ++IT+ DVND+ P F   +   +I E T  G++ A  +A D D+G N  + +    ++    F L+L  G   L   L      YY L +   D         +S  +  Y  ++DVN+N P+FS   Y  S + E   +G+ +     TD D G N  +SY I        F +         DK  +L   +LK L       +  ++   D   P   R ++   V++ ++D+NDN P F          SP+ + I ENT   T++    ATD DSG N  I + L + +G+   F I  I G +      DRE    Y   V+A D G P L+S+  + V+VLD++DN PVF     +    I E  LT T I   S           A D D G N  + Y I  G+T   F +D  +G +   K  DRET   Y+ TV+A   +  G  P +        +C+   V + +LD+ND  PVF +
Sbjct: 1043 AFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVL-LEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQP---NFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVL---RVSASDVDEGSNGLIHYSILKGNEERQ----FAIDSFSGQVTLV-----GKLDYEATSAYSLLIQAVDSGA---IPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKK-------LDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVEN-IPLGTSVISVTAHDPDADI-NGQLSYAIIQQMPRG-----NHFSIDEVKGTIYTSAEIDREFA--NLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIM--AADPDEG--ANGEVEYEILNGDTDTFTVDR-YSGDLRVASALVPSQL----IYNLIVSATDLG--PERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIV-----SVRCEEKTVGRLFTIGRQTGVIQTAAI------LDREQGACLYLVDVYAIEKSSAFP---RTQRAEVEITLQDINDNPPVFPTDTLDLTVEE------NIGDGSKIMQLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRADDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDG------GGQSTTIRAYFNILDVNDNPPVFSMSSYSTS-LMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAV---------DKHGVL--KTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFL---------SPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNK--FSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQ--AMYRVQIKENILTGTDIIQVS-----------AADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQA---TDRGSSPRT-------DSCT---VAITLLDMNDFVPVFEL 2261          

HSP 4 Score: 268.855 bits (686), Expect = 1.285e-70
Identity = 399/1504 (26.53%), Postives = 648/1504 (43.09%), Query Frame = 2
Query:  821 LTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITN-VFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGG--LMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRG-YPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITL------ITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNL--------SNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-------SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHA 5221
            LT  LDYE      L ++A+D     +    +  ++DV D PP+F  SSYS+++ E LP+ + V+     D D  + S + YS+  G+   + FA+++  G +     +DRESQ   N V    DL    T    S F S+   V I +LD+NDN   F  P     + EN+     ++  ++    D   N+  +Y L     NK       + I  ++  + +        LD E++ + ++++           P  S  +V + +LD+NDN P+F  + Y   I EN    T I  V+A D D G  G++ Y +   +  ++F IDS TGAI       T    LDRE      +   ATD G     +  TV I L D+ND  P+FE+  Y   + EN        ++V A D D    N+++ Y     +       DN  +  ++G++ +   +DRE    D   L+V A D  + ++  T  I IIV D+NDN P F  N +  ++ ++  T T +L +NA+DAD +    + I+Y +IG +S  F +    NP TG II      R     +   V ASD G    LS+   +L+ +T++ND PP F    +          G  +  V  TD D  +N +L Y     +++  NS        F++  L G     G +           S +T  + V D  +     P+T   T+ +   +  D P +      Q  +F + +P   + T  TG  ++        TL Y     +L  +F +D ++GQ+ + + LD E +      +   DG F   S+   + ITVLD+NDN P F +   V  I E      I     A D D+G N  + +   N N  S F ++   G +  I PL    I +Y+L ++  D  +G+     S +V I ++D N+N P FSQ+F  +  ++E + +G  +  V  +D+D G N    Y I+   DT +     F I    + G I+++  L +    R+   V+A D+G   +S + T+ VT  DINDN P F+ P           S Y +   L      +T +SATD D G NG++ + + S +   E+F I+  +G +         N+  F     + + F V A+D G PSL S    E  V     +    P  +L   +        FT ++ +   G K+  V    D+D G N+ + Y F  D          G+  G  + D +T     A+     ++Q      +FL        G  P + S+A V + + + N + P F+   I   I +  +  S +  +S    D+D      ++Y I               + N + +FA+N ++G+++ A  + ++  +    +M+I  +DG +         + S T  VI V  N P FV                        E F  V  N PSG T +  +A
Sbjct: 1900 LTRALDYETQQYYILTVRAEDGGGQSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQ-FAVDK-HGVLKTLKALDRESQSFYNLVIQVHDLPQPPT----SRFTSTAQ-VSIILLDVNDNPPMFLSPKLT-YIPENTPIDT-VVFKAQATDPDSGPNSYIEYTLLNPSGNK-------FSIGTIDGEVHLT-----GELDREEVSNYSLTVVATDKG---QPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAI-------TVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDD-QGPNSQLSYVLLGGNE------DNAFVLTASGELRVTQSLDREA--RDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAAN--AVISYSIIGGNS-QFTI----NPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHY-----SLSGRNSEK------FHIDPLRGAIMAAGPL--------SGASEVTFSVHVKDGGSF----PKTDSTTVTVRFANKADFPKVRAKE--QTFMFPENQPVGTLVTTITGSSLRGE------TLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILT-VSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSD--KGSPSQSTSVKVIISILDENDNAPRFSQIFSAY--VSENSPLGYTVTRVTTSDEDIGINAISRYSIV---DTSL----PFTINP--NTGDIVISRPLNREDTDRYRIRVSAHDSGW-TVSTDVTIFVT--DINDNTPRFSRP-----------SYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQS---EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLS----ETTVTINTVDSNDNPPQFLQNKY--------FTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEY-FVSD----------GNHLGKFKLDNDTGWISIASSLVSDLNQ------NFLIRVTAKDKGNPPLS-SQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVS--ARDRDTAMNGLISYNI--------------ISGNEEGIFAINSSTGVVTLAKALDYE--MSSKHEMTISATDGGWV----ARTGYCSLTVSVIDVNDNSPVFVPD----------------------EFFPTVMENAPSGTTVIHLNA 3220          

HSP 5 Score: 265.388 bits (677), Expect = 1.392e-69
Identity = 383/1411 (27.14%), Postives = 598/1411 (42.38%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQD--SAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN-DPFKKFVIDSSTGAIYTNVNANTDYTLLDR-EAYERLFVVAIATDGGGLMNMTTVIII---LKDLNDNPPIFEVRFYQAWLFENS-YNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAII--KKYPNARLQVR----VHNFTVEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS-----FYVDSISGQIFLIKALDRETVSNLNFTVSCSD-GVFLVNSTVS--ITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYL-TLITPLTIYGIF--YYKLIIEIMDN--PRGTIHFKKSKEVGIYVIDVNNNFPIF-SQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT----ITLITIISATDKDSGLNGEIRFNLDSMNGDHE----FFFISPISGNLSNIRSFDRETKD-LYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGI 4918
            +L+  + LD E      L + A D  S    S     + ++D+ D  P+F    Y + + E  P  ++V TV+A D D      V+YS+  G+     F I+  SG I   M +DRE +        + L V+AT+   +L + ++  V + +LD  DN   F Q  Y   V+EN   G  +     +     DLNAN  Y    +       +F + P+        VI  +  SF   + + S   ++ G  +             V+I + D+NDN P F  +  +    EN      I    A D D G+ G+++YSL  +P   F I+   G I          +LL   + +   + V I     G+  +++ I++   + D+NDNPP+F+   Y+  L E+   N  F   +V+A+DKD   AN  I Y   + + G     D F I    G + I + +DRE    D   LLVVA D +   +  T  + ++++DVNDN P+F    ++    +     + +  ++A D D    P  ++ Y    V   NF + AV    TG I    K+    L  R    V +FTV A DRG P PL  +  + + + +IND  P F +  +  +  E       + +V+A+D D  +N  + Y I++                 N      ++   G V +   LD E  S  +  IQ +D  A     P  +  TL I+ILD NDN P F  S     + E+ +    +S+      V ATD D  G    L++  + S     F +   +G IFL K LD ET S     ++  D G    +ST+S  I V D NDN P F       +I E   +GT      A+D DA  N  + +            S+D    T+ T   I   F   ++L ++  D   P  T  +   K V I V D+N+N P+F SQ      P      IG+++  ++A D D G NG V Y+IL   DTD F +  +        G + V S+L      +  IV+A D G  R     T  +T+I    + P FT         +   +I +        +I+I +A+ +  G    + + + S+  + +     F I   +G +      DRE    LY   V A +  +    T    +E+ + D++DN PVFP++ L +            ++  +   G KI  + TA+D D G NAL+ Y + +G    F +DP SG L   K  DRE +  YS  VRA       DG             S+ R+ + I D+ND+ P F+ P     I +  TP S +  I    TD D      ++Y +E                + D VF LN+ +G+
Sbjct:  640 RLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGD--RSRFQIHAKSGVISTKMALDREEKTA------YQLQVVATDGG-NLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHV---GSVSATTMDLNANISY---LITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVAS-GGAVTGDTV-------------VNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKNLFTINEQNGNI----------SLLGALDVHAGSYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRF--FKVQASDKDSG-ANGEIAYTITDGNNG-----DAFGIFPD-GQLYIKSELDREL--QDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFG--PNGEVRYAF-EVTQPNFELHAV----TGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKG----------------NEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAI----PLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSS------VTATDSD-SGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYAL-KNVTILVTDLNDNVPMFISQNALAADP---SAMIGSVLTTIMAADPDEGANGEVEYEIL-NGDTDTFTVDRY-------SGDLRVASALVPSQLIYNLIVSATDLGPER--RKSTTELTVILQGLDGPVFTQ--------TKYITILKEGEPIGTNVISIEAASPR--GSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDL------------TVEENIGDGSKIMQL-TAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRA------DDG----------LQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAI--LATDDDSGVNGEISYVVEED--------------DGDGVFFLNLVTGV 1897          

HSP 6 Score: 248.44 bits (633), Expect = 2.124e-64
Identity = 316/1150 (27.48%), Postives = 506/1150 (44.00%), Query Frame = 2
Query:  923 VIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVY---ENSQAG--VAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIA-PVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFEN-SPNFTLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPN----ARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT---NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY--LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS---TVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNP-RGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSN--NCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNLDSMNG-DHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNI 4273
            + DV D PP FQ+  Y + +    P  + V  VT  D D    S + YSL   N  +E F I+   G I+ A  +   S+ +T     F + V    + P   +S+   VR        N A+F +   +   +   EN   G  V  I GS +  E         Y +++         F++ P+          +V     LD+E+I+   V I+      P F+    SY  + I +LD+NDN P F    +   I EN SP   L   V+ATDKDSG  G++ Y +   +    F I+ +TG I +          LDRE      +   ++D G     T+V +I+   D NDN P F  + + A++ ENS    +   RV  +D+D+ + N    Y   + S+        F IN +TGD+ I  P++RE    D  ++ V A+D   +   D   + I V D+NDN P F   ++ ++ P+     + +  ++ATD DE +  Q    +  I   S  F + A         + KY N    + + +  H+F V ASDRG P L +   + IN  + ND PP F Q+ +     +N+ +G  + +V A D      N ++ YF+         S G       N      L+   G + + S L  +       ++   DK      PP ++ A + I + + N + P F  +    ++     P+S+ S G+    V A D D    G + Y  +  +    F ++S +G + L KALD E  S    T+S +DG ++  +   +++++V+DVNDN P FV       + E    GT      A D+D+G NAV+ +   ++ S  F +  + G +T    L       Y L ++  + P      F     V I +   N   P F    Y F  ++E  + GT +GEV A+D+D G +G V Y I           + F+I K+   GQI V+  L +    R +  V A + G  R ++    TV +T++D ND  P F+        S+ +  I E     T +T +SA D DS +    RF+    +G ++  F I+P +G ++     DRE+  +Y   VLA D GTPS T + ++
Sbjct: 2458 ITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRN--SEKFHIDPLRGAIMAAGPLSGASE-VT-----FSVHVKDGGSFPKT-DSTTVTVRFA------NKADFPKVRAKEQTFMFPENQPVGTLVTTITGSSLRGE------TLSYYIAS---GNLGDTFQIDPLTG--------QVSISQPLDFEKIQKYVVWIEARDGGFPPFS----SYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKIL--TVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRS-------IRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFS-QIFSAYVSENS-PLGYTVTRVTTSDEDIGI-NAISRYSIVDTSL-------PFTINPNTGDIVISRPLNRED--TDRYRIRVSAHDSGWTVSTD---VTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQ---VFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFV---------SDG-------NHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGN----PPLSSQAVVHITVTEENYHTPEFSQNHISATI-----PESH-SIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFAT---VDIQLKGTNEYVPRFVSKLYYFE-VSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRK-----KGFQINKMT--GQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDP-PVFSL-------STYRVQISEGVPIGTHVTFVSAFDSDS-IPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASL 3498          

HSP 7 Score: 248.054 bits (632), Expect = 3.078e-64
Identity = 361/1344 (26.86%), Postives = 557/1344 (41.44%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRES--QDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKA------ILVIRVKNGSFLDYEQIKSINVSIKGL--QIAPVFNI----------PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSY--NFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINAST----GDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQ---------IIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADE---SNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQ-SLFSFSTYENLDIGINIGQVNATDPD-TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQY-LYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVN---STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLIT-------IISATDKDSGLNGEIRFNL-DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL-----SGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            EE P  T V T+         R    Y L + +     FAIN ++G +     IDRES   D+ N+     + + ++ T P       T VR+ + D+NDN+  F  P    +  E+S +G  +I+ +     D D+ +N   + S             Y IV+ N+A      I +     G+FL         VS  GL  ++ P + +              Y  V++ + D+NDN P+FG+S Y   + E++   + +  V A D D G    I Y L D    F +D  TG I       T    LD EA  +  +   ATD G   L       I L D+NDN P+ + R++ A     S   N   G V   +  TD D   AN  I  Q         N   +F++  S       + + + +DRE+IP+    L V   D  NS    T  +Q         I V D+ND+ PVF    + VN+ + +   + +  ++ATD D    +N   S ++   +G   ++     V     G + ++  +  +        + A D+G  P  +   +++ V ++NDE PVF+Q   +  S  EN   G  +  + ATD D  +     F +Q   N                 L  L+   G +   S LDRE+ +     I   D  +    PPQ++ A + + +LD+NDN P+F    + F+  ++ +P  +  T      V ATD D+   GT++Y +       F + + SG I    ALDRE  +     V  +DG  L +   + V++TVLD  DN P F        + E   +G       A   D   N +       +    F ++ + G LT  + +      +Y+L I       G +       V I V D+N+N P F Q     + +  +   G  I +  A D D G NG V Y +            LF I + N  G I +  +L      +   + A D GVP+LS++  + V + D+NDN P F            Q S YE T++           + A+DKDSG NGEI + + D  NGD   F I P  G L      DRE +D Y   V+A+D     L++ VN+ VL+ D++DN P+F S     N++ Y              +G  +G V +AVD+D G N  + Y F      F L   +G +    +FDRE+            M + G    SF       G       +A V V + DINDN P F        + + AT  +Q++ +S   +D D  S   + Y I
Sbjct:   53 EEQPPGTLVGTIPT-------RPGFTYRLSESHAL---FAINSSTGALYTTATIDRESLPSDVVNL-----VVLSSSPTYP-------TEVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDT---ATDSDIGSNGVDHHS-------------YRIVSGNEAGRFRLDITLNPSGEGAFLHL-------VSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLI-------TVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGG-----NEQRHFEVQRSKVPNLSLIKVASALDRERIPS--YNLTVSVSD--NSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIV------LNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAEND--------------QRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGS----PPQSSTAQVNVSLLDINDNSPVFYPVQY-FAHIQENEPGGSYVT-----TVSATDPDMGPNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNAN-ISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASG---GAV--TGDTVVNITVKDLNDNAPHFLQAVESINAVENW-QAGHSIFQAKAVDPDEGVNGRVLYSLKQNPK------NLFTINEQN--GNISLLGALDVHAGSYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFD-----------QIS-YEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGD--AFGIFP-DGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNS----TNYTFY--------FEEEQRAGSFVGKV-SAVDKDFGPNGEVRYAFEVTQPNFELHAVTGEITSTHKFDRESL-----------MRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVS--ASDVDEGSNGLIHYSI 1249          

HSP 8 Score: 247.284 bits (630), Expect = 4.537e-64
Identity = 364/1390 (26.19%), Postives = 588/1390 (42.30%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYH--VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQI-APVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIII---LKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDP-SNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNV------PQNISTNTTILFLNATD-----ADE------SNTPQSDITYRLIG-----------VDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYL--------TLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLAT-DKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRA--VPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWI 4825
            ++ LT  LD E      L + A D       S     + V+D+ D  P+F  + Y   + E +   T +I V+A D D      V+Y +  GN   E F I+  +G I +A  +DRE+         + LTV AT+   S    S T V I +LD+ND    F+   Y  +V EN       I+  +++  D D   N+Q +   +  N+ ++    + + A  +    +RV     LD E      + +      +P           ++I + D+NDN P F N+ Y   I E++   T + +V A+D D+     I YS+     +F I+ STG I T+        LLDRE  +   +V +A+D G   ++++   +   + D+NDNPP F+   Y   +   +   +F       T  D D+ +N  L+  Y++S                         + EK   D L+  ++A  P S +S                        TFSV+V      P+  ST  T+ F N  D     A E       N P   +   + G           + S N       +P TG +    P    +++ +   +EA D G+PP S+   + I V +IND  P F +  F     ENL     I  V+ATD D+  N  L Y I+                  N  +   +N   G +     LDREK S     ++  DK +    P Q+    + I ILD NDN P F + +F   + E+    S +    T       D+ I    +Y   D SL F ++  +G I + + L+RE        VS  D  + V++ V+I V D+NDN P F      L+  E+ ++G+   +  A D D G N  V FYF  + S  F + +  G +          ++  +   I  +  I+   D  RG         V I  +D N+N P F Q  Y F+P+T+   +GT + +V A  DKDFG N  V Y +     +D   L  F++   ND G I + SSL  +L   F   V A D G P LS+   V +T+ + N + P F+      N  S       +  +++  +SA D+D+ +NG I +N+ S N +   F I+  +G ++  ++ D E    ++  + A D G  + T   ++ V V+D++DN PVF P  +             F ++  ++ SG  + ++  A D D G NA+I Y + + D+ +F +DP  G +      D ETK +Y  TV+A  VP  +                CS A V + +   N+  P F        + + A+  + + ++  + +D+D+ +   + Y I
Sbjct: 2105 EVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQE-FRIDSVTGAITVAKSLDRETTPA------YTLTVQATDRGSSPRTDSCT-VAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAIL--QVVARDDDQGPNSQLSYVLLGGNEDNA----FVLTASGE----LRVTQS--LDREARDHFVLVVTAADAGSPALT----GTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNSQFTINPSTGQIITSA-------LLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSF---VFAVTVTDADIGSNSELH--YSLSG-----------------------RNSEKFHIDPLRGAIMAAGPLSGASEV----------------------TFSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSP-RKILTVSATDKDSGPNGQLDYEIVNG----------------NQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGS----PSQSTSVKVIISILDENDNAPRF-SQIFSAYVSEN----SPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQV-FYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASD--RGNPSLLSETTVTINTVDSNDNPPQFLQNKY-FTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFV-----SDGNHLGKFKLD--NDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQ-----NHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGN-EEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEF-------------FPTVMENAPSGTTVIHL-NATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEE---------------KCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEV--FASDRDMGADGEVHYLI 3339          

HSP 9 Score: 230.335 bits (586), Expect = 7.821e-59
Identity = 285/1085 (26.27%), Postives = 483/1085 (44.52%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAYH--VSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAI-------YTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKAT---DKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVY--NPKTGAI-IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL--SFYVDSISGQIFLIKALDRETVSNLNFTVSCSD-----GVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLD---GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGEN-GNVSYKIL-LQKDTDVFILQ---LFRIQKVNDKGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDN 3970
            Q++++ PLD+E+     + ++A+D  +    S     I V+D+ D  P F+   + S + E L     ++TV+A D D      + Y + +GN     F IN  +GEI     +DRE          ++LTV +++   S   S+   V I ILD NDN+  F Q ++   V ENS  G  +   + +   D+D+  NA    S V    TS  F + P       I++ R  N    D  +I+ ++    G  ++           DV+I + D+NDNTP F   SY     E     + +  V+ATD D G  G++ Y +    + F I+++TG I       Y NV+  ++  +       R   +  A+D G   L++ TTV I   D NDNPP F       +    + N   G   +K T   DKD  + N+ + Y    +S G  N+L  FK++  TG ++I + +  +   N +++  V A D  N  +    ++ I V + N + P F  N  S  +P++ S  + +  ++A D D +      I+Y +I  +      E ++  N  TG + + K  +  +  + H  T+ A+D G+   +    + ++V ++ND  PVF    F  +  EN   G  +  +NATD D+    A  +I  T+ + +S            +L  ++   G++  Q  LD E   +      +  KA   P   + +FAT+ I++   N+  P F + L+ F + E     ++  T     +    D+   G + YL F  S    F ++ ++GQI++   LDRE    ++  V   +     G  +   TV+ITVLD ND  P F      + ISE   +GT      A DSD+  +     YF  + +     S++   G +T+ + L    +  Y L +  +D+  GT     S  + + + D+N+N P+ +    E   + E    GT++  + +TD D   N G  +Y +L     T+ F L    +    +  D+ QI          A F   V   D+G P++S+  TV +T++D NDN
Sbjct: 2622 QVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENL-SPRKILTVSATDKDSGPNGQLDYEIVNGNQ-ESSFTINHATGEIRSIRPLDREK------ISHYELTVKSSDKG-SPSQSTSVKVIISILDENDNAPRFSQ-IFSAYVSENSPLGYTV---TRVTTSDEDIGINAISRYSIV---DTSLPFTINPNTG---DIVISRPLNREDTDRYRIR-VSAHDSGWTVS----------TDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNI------NRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQF---LQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGL-NSEVEY---FVSDG--NHLGKFKLDNDTGWISIASSLVSDLNQNFLIR--VTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAM--NGLISYNIISGNE-----EGIFAINSSTGVVTLAKALDYEMSSK-HEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSG---ANAVIAYTVQSSDS------------DLFVIDPNMGVITTQGFLDFETKQSY----HLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSE----AASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDS--GTPSATGSASLVVTLEDINDNGPVLTVSEGE---VLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQI----------ADFYLSVVTRDSGAPQMSSTGTVHITVLDQNDN 3612          

HSP 10 Score: 204.912 bits (520), Expect = 3.923e-51
Identity = 307/1129 (27.19%), Postives = 473/1129 (41.90%), Query Frame = 2
Query:  986 EELPVDTHVITVTAIDGDRSLRSP-VQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFN--SSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFY---QAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPN------DILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNF--TVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVD------IVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSC---SDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFY-FPNNSSSPFGLSLDGYLTLITPLTIYGIF----YYKLIIEIMDNPRGTIHFKKSKEV--GIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKD-FGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLKNLG-ARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLN-GEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTS 4261
            E  PV T V T+T      SLR   + Y +  GN   + F I+  +G++ I+  +D         F      V+  E     F   SS   + I +LDINDN+  F++  +   + EN      + + +     DKD   N Q +   V  N+ SS         +N A   IR      LD E+I    +++K        +  + +   V I+ILD NDN P F +  ++  + ENSP    +  VT +D+D GI     YS+ D    F I+ +TG I  +         L+RE  +R  +   A D G  ++ T V I + D+NDN P F    Y      L E     T    +V ATD D + +N ++ Y   + S       + F+INA+TG++     +  + +        +    +V A D  N S+     + I   D NDN P F  N +   V +N+   T ++ + A D D+     S++ Y    V   N + +   +  TG I     ++ +     NF   V A D+G PPLS++ ++ I VTE N   P F+Q+  S +  E+  IG  +  V+A D DT  N  ++Y II                  N   +  +N + G+V +   LD E  S     I   D         +T + +L + ++DVNDN P+F    F  ++ E      N  +G T  ++ ATD D      I  T+Q    D    F +D   G I     LD ET  + + TV      D      +TV I +   N+  P FV  +    +SE    GT   +  A+D D G +  V +  F N+    F ++      +   + + G+       ++ ++++    G I      EV   I V+D N+  P+FS   Y    I+E   IGT +  V A D D        SY I    +   F +           GQI V S L       +   V AVD+G P  + + ++ VT+ DINDN P  T  VS       +  + EN    TL+  + +TD D   N G   + L S      +F +S  +G LS  R  DRE    +   V+  D G P ++S
Sbjct: 2580 ENQPVGTLVTTITG----SSLRGETLSYYIASGN-LGDTFQIDPLTGQVSISQPLD---------FEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSAT----DKDSGPNGQLDYEIVNGNQESSF-------TINHATGEIRSIRP--LDREKISHYELTVKSSDKG---SPSQSTSVKVIISILDENDNAPRF-SQIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVIS-------RPLNREDTDRYRIRVSAHDSGWTVS-TDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVT----QVSATDPD-EGSNGQVFYFIKSQS-------EYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVD-DKDFGLNSEVEYF---VSDGNHLGKFKLDNDTGWI--SIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISG----------------NEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVA----RTGYCSLTVSVIDVNDNSPVFVPDEFFPTVME------NAPSGTTVIHLNATDADSGANAVIAYTVQSSDSD---LFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQIN-----KMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDP-PVFSLSTYRVQ-ISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSIN-------PQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLT--VS-------EGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLS-TAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSS 3598          

HSP 11 Score: 165.622 bits (418), Expect = 2.917e-39
Identity = 212/795 (26.67%), Postives = 343/795 (43.14%), Query Frame = 2
Query:  917 IQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAID-GDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTDYTLLDREAYE--RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD---TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVF 3271
            I  +D  D PP F  + Y + + + + V T +I VTA+D  D  L S V+Y + DGN   + F ++  +G I IA      S  ++++   F + V A +   P L  SS+  V I + + N ++  F Q     ++ E+   G  +     +   D+D   N   + + +  N+         I A+N +  V+ +     LDYE      ++I       V       Y  ++++++DVNDN+P+F    +   + EN+P+ T +  + ATD DSG    I Y++       FVID + G I T          LD E  +   L V A         +  TV I LK  N+  P F  + Y    FE S   + G     V A+D+D+  A+  + Y  +  S         F+IN  TG + +   +DREK     L++L   +     +  D   + I V D ND  PVF L+T+ V + + +   T + F++A D+D S    S  +Y  IG  + N       NP+TG I       R  + V+N TV A D G P  +    +++ + +IND  PV T S       EN   G  +  + +TDPD         Y+++        S+G P  + F+++       T G++     +DRE+ +     +   D  A    P  ++  T+ I +LD NDNP   +T      +F ++    N+  G T   VK  D D++ +          S +  SI      + +  R T    + TV  SDGV 
Sbjct: 2973 INTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGK-FKLDNDTGWISIA------SSLVSDLNQNFLIRVTAKDKGNPPL--SSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVV---RTVSARDRDTAMNGLISYNIISGNEEG-------IFAINSSTGVVTLAKA--LDYEMSSKHEMTISATDGGWVART---GYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQ-------GFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLY---YFEVSEAASRGTAVGEVFASDRDMG-ADGEVHYLIFGNSRK-----KGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDAND-PPVFSLSTYRVQISEGVPIGTHVTFVSAFDSD-SIPSWSRFSY-FIGSGNENGAFS--INPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVS--EGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLL--------STG-PATNYFSLS-------TAGVLSTTREIDREQIADFYLSVVTRDSGA----PQMSSTGTVHITVLDQNDNPSQSRT----VEIFVNY--YGNLFPGGTLGSVKPQDPDVLDSFHCSLTSGVTSLF--SIPAGSCDLSSQPRSTDGTFDLTVVSSDGVH 3692          
BLAST of Cadherin-23 vs. UniProt/SwissProt
Match: sp|Q24292|DS_DROME (Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3)

HSP 1 Score: 308.145 bits (788), Expect = 1.172e-82
Identity = 385/1441 (26.72%), Postives = 619/1441 (42.96%), Query Frame = 2
Query:  851 PMIQLQLQAQDSAYHVS--INFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSF-----LDYEQIKSINVSIKGLQIAPVFNIPEDSY-ADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIY--------------SLNDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAP-VFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFN--VTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYL---YFDPSLS---------FYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNS------TVSITVLDVNDNEPYFVD------YIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGL-SLDGYLTLITPLT-----IYGIFYYKLIIEIMDNPRGTIHFKKSK-EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSS--------LKNLGARFTFIVNAV-----DNGVPRLSNN-----CTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENT-ITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTP-SLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTA 4930
            PM  L + A D     S      F+ +ID    PPIF+ + Y+  + E++P  T V +V A  GD + RSPV+YS+  G+P + YF+I   SG I IA  +D E++  + V     L + AT   P ++    T V I++ D+NDN+  F+  + + SV E+++ G  +         DKD  ++ Q   S V  +               K +  I  ++G       LDYE  +   + +     A    +P  S    + + + DVNDN P+F    Y+  + E+      I  V A+D D+G   +I Y              S +D  + F I  ++G IY           LDRE  +R  +  +ATD G       T VI+ + D NDN P F+   Y+   F    N   G V    T  D+D+  N  +      S+ P N   +F+++  TG+++   P+DRE    ++  L+V A D           ++I V DVNDNAP +       V+V +     T ++ + A D D      + ITY ++ G DS    + ++ +P +G I  +      +  ++   V ASD G PP  T  ++ + V ++ND  P FT S   F   E+  +G  +G ++  +     D+    ++ +   +  +   +N L    +     +++  G + V  +LDRE  S    +I+ +D  A     PQ++  T++IE+ DVNDN P +        + E     + + T    F     D    G LQY    YF P L+         F +DS++G + L   LD E V      V   D    V        TV + +LD ND+ P+FV           L IS+ T++G + A  VA D D+G+N  + +     N    F + S  G + L+  L      +     + LII   D+  G    KKS   + + V   +NN P F Q  Y  + I E    G+ + +V A      EN N+SY+I      D+F +   R   +  +GQ    S         +++   + T   +AV      + +   SN       T+ +T+ D+NDN P F        GS    S+ EN+   +I  + A+D D G N ++ +++   N  ++F  I   SG LS  R  DRE    Y  ++ A+D G P S     NI + V D +DN P F         S Y G     S+   +  G  +  + +AVD D+G NA +VY    +T   F +D  SG +  + + DRE + +Y+  V A       DG      G      +   V + +LDINDN P+F     +G +     P   ++ +     D D+ +   + Y +              +N  +   F +N ++G LS +
Sbjct:  738 PMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP-DGYFSIETNSGNIRIAKPLDHEAK--SQVL----LNIQATLGEPPVYG--HTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAA---HAHDKDSGSSGQVTYSLVKES--------------GKGLFAIDARSGHLILSQHLDYESSQRHTLIV----TATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAP-------LDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE---FRIEENLRRGSVVGVVTASDLDLGENAAI----RYSLLPIN--SSFQVHPVTGEISTREPLDREL--RELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQN--ASITYSIVKGRDSDGHGLFSI-DPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIE--RPADVVRNSVEESFEDLRVT-YTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNN--PQSSAITVKIEVADVNDNAPEWPQDPIDLQVSE----ATPVGTIIHNFTATDADTGTNGDLQYRLIRYF-PQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDH--GQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT-ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR-GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF------RPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFS-IDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRF-------KLSKYTG-----SVQEDAPLGTSVVQI-SAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLAT------DG------GRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQ--ALDADLGANAEIVYSL------------NAENSAVSAKFRINPSTGALSAS 2066          

HSP 2 Score: 292.738 bits (748), Expect = 5.152e-78
Identity = 366/1343 (27.25%), Postives = 580/1343 (43.19%), Query Frame = 2
Query:  644 EFCTNLAIVDYDEINSICNLTITSVTSGSISDFNITKISINQNKIGSVSLGYYSVFQLTLTTPLDYERFPMIQLQLQAQDSA---YHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDG-NPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNF------TLIGVVTATDKDSGIFGKIIYSL--NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNR-ILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVN-FIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFI----IQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNST---VSITVLDVNDNEPYFVDYIQ-VLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL-SLD---GYLTLITPLTIYGIFYYKLIIEIMDN---PRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFG----------ENGNVSYKI-LLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGV---PRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNL--------DSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLG---TPSLTSAVNIEXXXXXXXXXXXXF--PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTG 4477
            EF   +++ D D      N+ +T   +G    F +T                 S++ + +  PLD E      L + A D      H S +  F+++ DV D PP F+   Y + + E     T V+ V A D D  L S + YSL +      ++F I+  +G I     ID E++ +        LTV+A +   P L  SS   V + I D+NDN   FDQ  Y  SV EN   G  I+   ++   D D   NA  N +     K  + FEV    + +  I +        LD+E+  S    +       +      + A + + + DVNDN P+F    Y   + E SP        T I  V ATD D G FG++ Y +   +    F ID STG I+       D   +  +    L + A  TDGG L +    ++ L   D    PPIFE   Y  ++ E+      G V         DVA+   + Y  Y  S  P  Y   F I  ++G++ I  P+D E     +L +     +P    ++    + I V+DVNDNAP F  +   ++VP++      +   +A D D  ++ Q  +TY L+       F ++A    ++G +I          + H   V A+D G P LST + IL++V ++ND PPVF +  +S +  E+  I   I QVNA+D DT  N  + Y I    + N  N+++SS        +V+   G+    G +Y+++ LDRE       Q+ V+  A +   P   A   + + +LD NDN P FQ S ++F + E      N+  G+    V A+D+D+     ++Y     + SF V  ++G+I   + LDRE     +  V   D    V S    V I V DVNDN P   D  + V+++ E    GT   +  A D D G+NA + +       S   GL S+D   G +     L       Y+L +   D    PR T+   +     + V+D+N+N P F+     F  + E   +G ++G +   ++             E+  V+Y +  L KD    I   F I +    G ++V   L + + + F   + A+D      P+ S+  TV + + D+NDN P +     P +    Q S      T+I   +ATD D+G NG++++ L        +S       F +  ++G LS     D E    Y   V A D     T  L ++V + + +LD +D+ P F  P++      S++        IS+++  G  + ++  AVD D G N  + Y  TG
Sbjct:  361 EFVARISVHDPDSKTEYANVNVT--LNGGDGHFALTTRD-------------NSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSI-FLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQ------LTVVARDGGVPPL--SSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCIL---KVSASDPDCGVNAMVNYTIGEGFKHLTEFEVR---SASGEICI-----AGELDFERRSSYEFPVLATDRGGL-----STTAMIKMQLTDVNDNRPVFYPREYKVSLRE-SPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFV---VRPDMLSVRTQPMHMLNISA--TDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKED---IPRGTVVGSVIAASGDVAHRSPVRYSIY--SGDPDGY---FSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP---VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQ--VTYSLVKESGKGLFAIDA----RSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSS--------DVSQHFGIFPNSGWIYLRAPLDRETRDRY--QLTVL--ATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEE------NLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLR-----VEVLDLNDNRPTFTSSSLVFR-VREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKD---LIEAAFDIDR--HSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQ-SSAITVKIEVADVNDNAPEW-----PQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF--------ISDATRIGEVVAHI-VAVDEDSGDNGQLTYEITG 1596          

HSP 3 Score: 277.33 bits (708), Expect = 3.015e-73
Identity = 374/1430 (26.15%), Postives = 625/1430 (43.71%), Query Frame = 2
Query:  833 LDYERFPMIQLQLQAQDSAYHVSINFTFIQVI--DVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSL-KDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSAN----FDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQY-NLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLND----PFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPP-NYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQ-----NISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQVR---VHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVSNLNFTVSCSDG---VFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-------------PNNSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTI--TLITIISATDKDSGLNGEIRFNL-DSMNGD-HEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDR--DIGYNAL--------IVYI---FTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTI-PTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILS 4924
            LD E  P   L ++A D        F  + +   DV D  PIF  S Y +T+ E   V T V+ V A D D      V+Y++ +  +   + F I+  +G I I   +D E++++       +L V+A +       ++  FV I++ D+NDN       F        + E++Q G  +   + I V D D  +  +Y N++   N         + +   + +I ++ V     LD E + +  +S+           P  +   + + I DVNDN P F    Y   + E +   T +  V A D+D G+   + YSL +      + F ID  TG I T  + + +      E   +L VV  A DGG   L +  TV++ + D+NDN PIF+  FY   + EN      G   +K +  D D   N ++    N ++G    +L  F++ +++G++ I   +D E+      +  V+A D     +  T +I++ + DVNDN PVF    + V++ +     + +++T I+ + ATD D  N  Q  ++YR++ G ++  F ++      TG I    P+  L VR   +H   + A+D G    +   ++ +++ +    PP+F ++ +++   E++  G  +G V A     + D+A+   ++ +     SG P +  F++          G + +   LD E  S +   IQ     A    PP      + IE+ DVNDN P F+ S+ + S+ E      +   GA  +   A D D   + Q  Y     S    F +D+ SG + L + LD E+       V+ +DG       N T+ + V DVNDN P F      +N+SE   +     +  A+D D G NA + +                ++ S  FG+    G++ L  PL       Y+L +   DN     H K    V + V+D N+N P F +  YEF  I E    G+++G V A+D D GEN  + Y +L        I   F++  V   G+I     L + L   +  +V A D G P  S    V + + D+NDN P   +P           S+ E     T +  + A D+D G N  I +++    + D H  F I P SG +      D E + +Y+  V A+D G P   +   + V VLDL+DN P F S+ L+  F + E         +++L G  +G++ + ++R  D+  N++        + Y     T D +   F +D  SG+L   +  DRE +  +   +RA+  +   + P S          S   V + + D+NDN P +   P  L   V  ATP   I+  +   TD D  +   L Y +   +P  ++   Q  +L     F ++  +G LS
Sbjct:  191 LDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKEL------HELVVVAKDHGEQPLETT-AFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFV---ARISVHDPD--SKTEYANVNVTLNGGDGH----FALTTRDNSIYLVIVH--LPLDREIVSNYTLSVVATDKG---TPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCET-----EPVPQLTVV--ARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENE---PVGRCILKVSASDPDCGVNAMV----NYTIGEGFKHLTEFEVRSASGEICIAGELDFER--RSSYEFPVLATD--RGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ--VSYRIVAGNEAGIFRIDR----STGEIFVVRPDM-LSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIA----ASGDVAH---RSPVRYSIYSGDP-DGYFSIET------NSGNIRIAKPLDHEAKSQVLLNIQ-----ATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE------SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK--TRVIVRVLDANDNDPKFQKSKYEFR-IEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-------INSSFQVHPVT--GEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADP------QEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLV--FRVRE---------DAAL-GHVVGSI-SPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTA-SNNPQS----------SAITVKIEVADVNDNAPEWPQDPIDLQ--VSEATPVGTIIH-NFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSL-----FRMDSLTGALS 1499          

HSP 4 Score: 265.388 bits (677), Expect = 1.387e-69
Identity = 344/1343 (25.61%), Postives = 564/1343 (42.00%), Query Frame = 2
Query: 1100 FAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNK--AILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN----DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFY----QAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVT---PVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDI--VGTLQY--LYFDPSLSFYVDSISGQIFLIKA--LDRETVSNLNFTVSCSDGVFL---VNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLSLDGYLTLIT---PLTIYGIFYYKLIIEIMDNPRGTIHFKK---SKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDH-----------EFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXF-PSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTI-LGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNIDTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDG 4996
             AI+  +GEI   + +DRE++        + L  I         +     V + + D NDN+  F Q        EN+   V   +   +   D DL     YN +  YN  + ++ + + + +  +   +L + ++   FLD E     ++ I+ L        P   +  V+I I DVNDN PIF  S Y   + EN+   T +  V A+D D+   G + Y++N    D  + F ID  TGAIY N         LD E  E   +V +A D G     TT  + ++  D+NDN P   V F        + E++    F   R+   D D     ++  Y   N+++   +   +F +      + +V    P+DRE + N    L VVA D     +  +  I + + DVNDN P F  + +  NV +     T++L + A D DE     S +TY L      +     + +P+TG I  +         V   TV A D G PPLS+   +L+ + ++ND  P+F QS ++ S  EN  +G  I +V+A+DPD         +   +N     G    + F V +        G + +   LD E+ S+    +   D+         +  A +++++ DVNDN P+F    ++ SL E  K  S  S+      V ATD D    G + Y  +  + +  F +D  +G+IF+++   L   T       +S +DG  L    ++ V ++++D     P F        + E    GT+    +A   D    + V +       S +    DGY ++ T    + I     ++   +++ N + T+         +V I V DVN+N P F       S + E   +G  +    A DKD G +G V+Y ++ +    +F +           G ++++  L      R T IV A D GVP LS N T+ V + D+NDN P F       +  S   S   +    I  ++A+D D+G N  I + +     D+           + F I P SG +      DRET+D Y+  VLA D GTP+  +   + V VLD +DN P F  S Y    F I E      ++   S+ G     V TA D D+G NA I Y        F + P +G +   +  DRE ++ Y   V A                 +P   +   V + + D+NDN P    P   +  + +   P +++V +     D+D     ++TY I            + ++ +   +F+++ TSG++ T   V          ++ +  SDG
Sbjct:   70 LAIDRATGEIRTKVKLDRETR------ASYSLVAIP-------LSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL---LPARDLDLEP---YN-TQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGG---TPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYIN-------KALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEF-VARISVHDPD-----SKTEYANVNVTLNGGD--GHFALTTRDNSIYLVIVHLPLDREIVSN--YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLN--SALTYSLAETPETHAQWFQI-DPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-------VNAMVNYTIGEGFKHLTEFEVRS------ASGEICIAGELDFERRSSYEFPVLATDRGG------LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPI-VAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRY-------SIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRIS-VPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDAR-------SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEK-----DEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKY---EFRIEE------NLRRGSVVG-----VVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-------------TPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVR--AVDRDHGQNASITYSI-----------VKGRDSDGHGLFSIDPTSGVIRTR--VVLDHEERSIYRLGVAASDG 1287          

HSP 5 Score: 227.254 bits (578), Expect = 5.908e-58
Identity = 331/1248 (26.52%), Postives = 513/1248 (41.11%), Query Frame = 2
Query:  812 QLTLTTPLDYERFPMIQLQLQAQDSAY-HVSINFT-FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFN-----------EYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETA-PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGL-QIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFM-IFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILK--DLNDNPPIFEVRFYQAWLFENSYNFTFGPV--RVKATDKDVDVANNRILYQFYNMSMGPPNYLDN----------FKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGV-DSVNFIVEAVY-----NPKTGAIIKKYPNARLQVRVHNFTVEASDRGY---PPLSTRVIILINVTEINDEPPVF---------TQSLFSFSTYENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLP-PQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSLS----FYVDSISGQIFLIKALDRETVS-----------NLNFTVSCS---------------DGVFLVNSTVSITVLDVNDNEPYFV-DYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPN-NSSSPFGL-SLDGYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSK-EVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRL-SNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGD-HEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIE 4276
             L L+  LDYE      L + A D     +S N T  + V DV D PP+F+   YS  ++E   ++  +I V A D D    + + Y + D    N           ++F I   SG I +   +DRE++D       + LTV+AT+   P+    +R  VR+  LD NDN   F +  Y+  + EN + G  + +   +   D DL  NA    S +  N   S F+V+P+           +     LD E  +  ++ ++   Q  PV      +   V I + DVNDN P   +     + + E  P  T +  V A D+D G    I YS+     +D    F ID ++G I T V       +LD E      +   A+DGG     T  ++ ++  DLNDN P F      + +F    +   G V   +   ++  DV  N +   F ++ +    Y  N          F I+  +G++ +   +DRE      L++  +    SN+       ++I V DVNDNAP +  +   + V +     T I    ATDAD       D+ YRLI     +N   E        +  TGA+  + P     V+ +   V+A D+       L T V + + + + ND  P F         T SLF     +   IG  +  + A D D+  N  L Y      I   N  G      F + +     QTG I  V+S+    +     G+  +I  A +   P P+ +   L + +   ++NPP F  ++++ ++ E      N+ +G+    V A  +         Y  P+      F+VD   G I      DRE+ +           N   T+S S               +G     +T+ ITV DVNDN P F       L++ E ++ G I    VA+D D G NA +I+     N  + F + S  G L+   PL       Y L I+  D  RG    ++    + I+V D N+N P F    Y  S + E   +GT + ++ A D D G N  + Y +  +      I            G I     L + L A + F+V A D G   + S    V + ++DINDN P F     P  G  P  ++ +   TL+ +  A D D G N EI ++L++ N      F I+P +G LS  +S   E+  L    V+A D G P  +S   IE
Sbjct:  934 HLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD------RYQLTVLATDNGTPAAHAKTRVIVRV--LDANDNDPKFQKSKYEFRIEENLRRGSVVGV---VTASDLDLGENAAIRYSLLPIN---SSFQVHPVTG--------EISTREPLDRELRELYDLVVEARDQGTPV----RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRV-------VLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT---SSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRV---TYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTN--GDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLF---ISDATRIGEVVAHIVAVDEDSGDNGQLTY-----EITGGNGEG-----RFRINS-----QTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILE------NVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT-VVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQASD--RGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGS-VQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAI--------DGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFER--YPYIGQVP--ALIQPGQTLLKV-QALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIE 2098          

HSP 6 Score: 167.548 bits (423), Expect = 8.516e-40
Identity = 319/1221 (26.13%), Postives = 498/1221 (40.79%), Query Frame = 2
Query:  830 PLDYERFPMIQLQLQAQDSAYHVS----INFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQ--YNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPI--FGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKKFV--IDSSTGAIYTNVNANTDY----------------------------------------------TLLDREAYE-RLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKIN-ASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIG---VDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVF--TQSLFSFSTY-------ENLDIGINIGQVNATDPDT--NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYV-QSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGAT-GFYVKATDVDIVGTLQYLYFDPSLSFYVDSISGQIFLIKALDRET--VSNLNFTVSCSDG-------VFLVNSTVSITVLDVNDNEPYFVDYIQV-LNISEVTQVGTIFAKFVANDSDAG--ENAVVIFYF-PNNSSSPFGLSLDGYLTLITPLTIY--GIFYYKLIIEIMDNPRGTIHFKKS----KEVGIYVIDVNNNFPIFSQVFYEFSPITEYTN-------IGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL---KNLGARFTFIVNAVDNGVPRLSNNCTVAVTI-IDINDNY-PSFTNP----VSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISG 4165
            PLD E+     LQ+QA D     S     N T I V D  D  P F+ S Y+ ++ E+ P+ T V+ ++A+D D  + + + YSL   N     FAI+  SG I     +DRE Q        ++  V+AT+       S+   V+I +LDINDN   F++  Y G V    Q G  ++   ++   D DL ANA+  Y+L+A  N+  S+ F + P      A   +  ++G  L  E +       KG       N P+ S   + + I +    TP+  F N +Y  M+ ENSP+ T +  V A   D G   K+ +S     +  +  +DS +G I  N     DY                                               L + +  E R+ +VA   D   L +   ++I L+D NDN P F  + + A + E +   TF   +V A D D   +N R+ Y   +      N+ + F I  A +G V     +DRE    DI +L ++A D     M  T  I++ + DVNDN P F  N   V V +       I  ++A D D        +TYRL     VD  N  + A+       ++K+  +  LQ + +   V ASD  +     R ++ + V + ND  PVF   Q    F+         E+L +  ++  VNATD D+  N     +II+           P    F+V      + + G+V V  S L     S+    +++I K A  P    +    LR++    NDN     +   QF L   +  ++ IS  A  G  V     D +     +      S +    S  I L+K LDRE   +  L   +S   G             +V IT+LD NDN P F    +    ISE+  +    A+  A D+D     N+ V++     N    F + L   +  +     Y  G   Y+LII   D+     H ++     +   + + D N+N P F        P+TEY +       +G+ +    A+D D G  G ++Y I     +D    ++FR+    D    LV S+         R+   + A D G        +VAV + I+  D + P FT      V P+  + PQ  +       +  ++ATD DSG +G + + L   +  H  F ++  SG
Sbjct: 1855 PLDREQHSRYTLQIQASDRGQPKSRQGHCNIT-IFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSL--ANETQWQFAIDGQSGLITTVGKLDRELQ------ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL---KVQALDADLGANAEIVYSLNA-ENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVV----ARDKG-------NPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTF-VAQVHAFDSDAG-SNARLRYHIVDG-----NHDNAFVIEPAFSGIVRTNIVLDREI--RDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIE-----------PAQEGFSV------HPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTL--LRVQ---ANDN----GSGRSQF-LQNQY--RAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS-----HHQRPLCSLQPFRLELHDENDNEPKF--------PLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSI-GPAPSDESSWKMFRV----DSESGLVTSAFVFDYEQRQRYDMELLASDMG----GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYV-------VGQVTATDSDSGPDGRVVYQL---SAPHSHFKVNRSSG 2971          

HSP 7 Score: 152.14 bits (383), Expect = 3.122e-35
Identity = 229/945 (24.23%), Postives = 396/945 (41.90%), Query Frame = 2
Query: 2099 FYNMSMGPPNYL-------DNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAI-----IKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYFDPSL-----SFYVDSISGQIFLI---KALDRETVSNLNFTVSCSD-GVFLVNSTVSI--TVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF---PNNSSSPFGLSLD-GYLTLITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSF-TNPVSPSNGSSPQFSIYENTITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRS--FDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVY-IFTGDT-VMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVT---DKDIVSQNALTYWI 4825
            F  +  GPP  +        +  I+ +TG++     +DRE   +    L+ +     N  +       + V+D NDNAP F   +  +  P+N         L A D D    P +   Y ++  +  +    + +  + G +     I  + + R     ++  +EA D G PPL   + + I + ++ND  P+F QS +  +  EN  +G ++ QV A+D D + +    +++  IN   S         +   +  ++   G +Y+   LD E    L   + V     E PL   TAF ++R  + DVNDN P     +F   L +D  PK + S     F  + +  D     +Y   + +L      F + +    I+L+     LDRE VSN   +V  +D G   ++++ SI   + DVNDN P F   +   N+ EV   GT   + +A+D D G N+ + +     P   +  F +    G +T  + +        +L +   D   G      +  V + + DVN+N PIF Q FY  S + E   +G  I +V A+D D G N  V+Y I          L  F ++  +  G+I +   L     + + F V A D G   LS    + + + D+NDN P F       S   SP+ S   ++  ++ ++ ATD D G  G++ + + + N +   F I   +G +  +R       T+ ++   + A D G  +L S  N + +V     +    P  +    ++ Y        +      G  +G+V  A   D+ + + + Y I++GD    F ++  SG++   K  D E K      ++A      G+ P   + G++  N       + + D+NDN P F        +V+ + P S  +    Y     DKD  S   +TY +
Sbjct:   49 FGGIDSGPPYIIVAEAGVETDLAIDRATGEIRTKVKLDRETRAS--YSLVAIPLSGRNIRVL------VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLE--PYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLD-RETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADEN---GLVEYAINRRQS---------DKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPL-ETTAFVSIR--VTDVNDNQPTINV-IF---LSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDG--GVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVS-VAENEPVGRCILKVSASDPDCGVNAMVNYTI----GEGFKHLTEFEVRSAS--GEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGN-EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG--NLRS--NADAVVFLSIIDAMQRPPIFEKARYNYY--------VKEDIPRGTVVGSV-IAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT----LGEPP---VYGHTQVN-------IEVEDVNDNAPEFE-----ASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL 917          

HSP 8 Score: 147.517 bits (371), Expect = 8.027e-34
Identity = 338/1431 (23.62%), Postives = 560/1431 (39.13%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAY----HVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNP-FNE-------YFAINETSGEIIIAMIIDRES-QDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIG---SEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMN-KAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNI-----------PEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSL-----NDPFKKFVIDSSTGAIYTN-----------------VNANTDYTLLDREAYERLFVVAIA-TDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVR-VKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSN-SSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRG-YPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPD--TNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPI--FQTSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGTLQYLYF-------DPSLSFYVDSISGQIFLIK---------------ALDR--------------------ETVSNLNFTVSC-------------------SDGVFLVN-STVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYF-PNNSSSPFGL--SLDGYLT--LITPLTIYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSLK-NLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSN-GSSPQFSIYENTITL---ITIISATDKDS-GLNGEIRFNLDSMNGDHEFFFISPISG----NLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSGYSPFNCSEARVVVIILDINDNPPVF 4702
            L +   LD E     +L+++A D+        S     I+V DV D  P +        ++E  PV T +   TA D D      +QY L    P  NE        F ++  +G + +   +D E+ Q+   +    D +   TE       +S T VR++ILD ND++ +F  P   G    +     A  IG   + I+  D+D   N Q                 Y I   N +    I  + G     E +KS+  + + ++    FN+           P+ S  ++ + +   ++N P F  + Y   I EN P+ + +  VTA          + Y +     ND F    +D   G I T                   +AN   TL      ++    +I  T  G   ++ T+ I + D+NDN P F  R    +      N   G +  V A+D D +  N  ++Y     ++G     + F I++S+G+++   P+DRE+     LQ  + A D     S    C I I V+D NDNAP F L+ ++ +V ++    T+++ ++A DAD     +  + Y L       F ++     ++G I       R     +NF V A+D G Y   S  V + INV +IND  P+F +  +       +  G  + +V A D D   N ++ Y     ++NA NS+   V++ F +      N + G +     L  E    L  ++   DK      PPQ++   + + I +     P+  FQ   ++  L      K N  +G     V A   D  G  Q + F       D  LS   DS+SG+I + K               AL R                     T S    T S                    +D  FL + + + I + D NDN P F     V  +SE    GT  A+  A DSDAG NA + ++    N  + F +  +  G +   ++    I  I+  K+I        G      +  + + ++DVN+N P F         ++E T +G +I  + A D D      ++Y++  +   D+  + +F + + +  G++++   L   L   +   V A D           + V + D NDN P F     P+     P  S    ++++   +  ++ATD DS G N ++ + ++      E F + P +G    N+S ++     + D Y  R++A D G P+L S+  + V   D       F  N      S                    +G+V   + +D    +L +     ++    L   S  +  +K  DRE  D Y   +R V +S     PH      S  + S   V++ ILD NDN P+F
Sbjct: 1382 LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTER----LQTSVT-VRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQL---------------TYEITGGNGEGRFRINSQTGII---ELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFH---VDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF--RPGSCYGLSVPENSEPGVIHTVVASDLD-EGPNADLIYSITGGNLG-----NKFSIDSSSGELS-ARPLDREQHSRYTLQ--IQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNAR--LVYSLANETQWQFAIDG----QSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVY-----SLNAENSA---VSAKFRI------NPSTGALSASQSLASESGKLLHLEVVARDKGN----PPQSSLGLIELLIGEAPQGTPVLRFQNETYRVML------KENSPSGTRLLQVVALRSD--GRRQKVQFSFGAGNEDGILSL--DSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIA----TDEGVPQMTGTATIRVQIVDVNDNQPTFPP--NNLVTVSEATELGAVITSISANDVD--TYPALTYRLGAESTVDIENMSIFALDRYS--GKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGVVSVNMSRLQPAVSSSGD-YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQIS----------------EAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQ--SKAIVLVKPLDRERNDLYK--LRLV-LSH----PHGPPLISSLNSSSGISVIITILDANDNFPIF 2699          

HSP 9 Score: 104.375 bits (259), Expect = 1.082e-20
Identity = 208/884 (23.53%), Postives = 359/884 (40.61%), Query Frame = 2
Query:  803 SVFQLTLTTPLDYERFPMIQLQLQAQDSAYHVSINFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMIIDRESQDITNVFGFFDLTVIAT-ETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNK--AILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIF--GNSSYTFMIFEN--------SPNFTLIGVVTATDKDS-GIFGKIIYSLNDPFKKFVIDSSTGAIYTN-------VNANTDYTLLDREAYERLFVVAIATDGG--GLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSN------SSMFDTCIIQIIVQDVNDNAPVFGLNT-FSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLI-GVDSVNFIVEAVYNPKTGAIIKKYPNARLQ----VRVHNFTVEASDRGYP-PLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDTNCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKS-NISTGATGFYVKATDVDIV--GTLQYLYFDPSLSFYVDSISGQIFLIK--ALDRETVSNL-------NFTVSCSDGVFLVNSTVSITVLDV 3310
            S F LT + P +      + L  +  D+ +  S     I++ D  D  P F    + +T++E     T V  V A D D    + ++Y + DGN  N +      SG +   +++DRE +DI      + L +IAT E  P +  ++   +R+QI+D+NDN   F  P    +V E ++ G  I   + I   D D      Y L A    +++   E   I A+++    LV++ +    LDYE  +   + +     A       ++   +++ + D NDN P+F        F I           S +F L+  V ATD DS G   K+IY +    + F +  S G +  N       V+++ DY           FV  IA D G   L + T + +   D       F    Y+A + E +     G V ++     +D           ++++   N    F++  S   + +V P+DRE+  ND+ +L +V   P         +      + I + D NDN P+F  +  +   + +      +I  L A DAD+ NTP S++ Y +  G D   F ++ V    TG +   + N RL      + +   + A D  +  PL +     + + + ND  P F  + +     EN  +G ++ + +A+D D          +     +N S  P  S  +   +  ++   G+V    + D E+      ++   D         + A   +R+EI   ++  P F    ++F L     P +  +  G     V ATD D    G + Y    P   F V+  SG + + +   LD +   NL       +  +S S G    NS  S+ V+++
Sbjct: 2223 SSFALTNSQPNEIR----VVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDI------YKLKIIATDEGVPQMTGTA--TIRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVI---TSISANDVDTYPALTYRLGA----ESTVDIENMSIFALDRYSGKLVLKRR----LDYELQQEYELDVIASDAA------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLL-TVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDY-----------FVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAA---PLGSVVLQLGQDALD----------QSLAIIAGNEESAFELLQSKA-IVLVKPLDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLV----TGVL---FVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLD----------KGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG------KKASVAVRVEIESRDEFTPQFTERTYRFVL-----PAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVISASSGRH--NSLSSMAVVEI 3018          
BLAST of Cadherin-23 vs. TrEMBL
Match: A0A267G650 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016256g1 PE=4 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 533/1637 (32.56%), Postives = 831/1637 (50.76%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMI-IDRESQDITNVFGFFDLTVIATETA----PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLN--DPFKKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRIL-YQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQV----RVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIG---QVNATDPDTNCDLAYFIIQNTINAVNSSGVPVN-SLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ----TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGT-LQYLYFDPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGLS-LDGYLTLITPLT--IYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVND----KGQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI------ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTV--MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFLSG---------------YSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNI-DTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIYEKE 5563
            LT+   LDYE     QL + A D     +   T   I V D +D PP F    Y   + E  P  T VIT+ A DGDR + + + Y L   N F++YF +N  +GE+  + + +DRE  DI  +FG  DL VIA E +    P+  + + T VRI + D ND    F+ P+Y GSV EN+ AGV + + S+I + D D   N  +NL+ + N +    FEV P+    +  + I VKN SFLDYE ++S+   I   +          S A V + ILDVNDN P+F  S Y F I ENSP  T +G V ATD DSG FG + Y+L+  D FK F I+S+TG I+ NV+A+ + TLLDRE +  +F+     DGGG +    + I+L D ND  P+F    Y   + ENS+ F   PV+V+A D D+  +NN I+ Y+     +G      NF I +++G + I TP++ E +P+ I+ L + AYD    S+  +  +Q+ V D NDN+P+     F+  V +N ++ T IL +NATDAD   +  S + +R+    +  F ++      TG I+ +   A L V      +N ++   D G P  +   I +I V ++N++ P F       +  ENL +   +    Q  A DPDT  +L Y I+ + ++A   +G  V+ S +N T+L+ ++ T G ++V+++LDREK   +   I V D AAETPLP QTA  TL I + D+ND  P+FQ     + ++ ++ E  +P ++IS  A      ATD D     L Y    PS  F +D+ + Q+ L  ALDRET     F V  +D + +  +TV + V D ND  P F  +   L+ISE T VG++  + +A D+D G    V +   +     F L+   G L L   L   + G   Y L+IE  DNP      + S+ + I V+DVN+N P F+Q  +  + + E  +   +I E+ ATD D G N  +S+ +      +   L LF +            I    SL      +   + A D G P ++ +  +   I D+ND+ P F  P    N +     + E+T    TI        A D+D G N  +RF+L S NGD+  F I  +SG L+   + +RE K  Y+F + A DLG P LT+ VNI V VLD+D++ PVF  +  +   S+ E  +  + I   ++SG ++G++A A D D+   +  +  F  D V  +FYL+  SG L+ +   DRE    Y+  V AV  SQ     + + +                Y+P N + A +VV + D+NDNPPV+      GG+     P++ + + +++VTD DI + + LT+ +    P    L  QL +  I D+VF L+  +G+L T    +FQ+ + G +  ++  SD KY     C +  +S  QQ+I V+   P+    + + F +YLSN+    I VD++   K+  G   +  T+++ HA++L  N+++  + +   ++  +     +   + +L  +L S   +     +  +  +I ++CS  ILL    V +W  R  Y+ KL+A    +     +SN  + PGTN++  E
Sbjct:  240 LTILRALDYEVSSFYQLSVNATDLTDGGTTTVTDVIINVQDRQDTPPFFDGIPYLKNVPENSPSGTLVITLIARDGDRGVPNSISYHLDASNAFSKYFILNNVTGELRTSSVKLDREGADILAIFGTIDLPVIAKEMSSVVQPANISQAGTTVRITVDDENDFFPTFEYPVYNGSVPENTMAGVPVNLFSQISISDLDAGDNGVFNLTLMRNGQVYRDFEVSPVTISRQGAVFIMVKNSSFLDYETVQSVTFQIVATETRTTQRF--SSTATVQLQILDVNDNRPVFNQSGYAFTIPENSPINTFVGRVKATDADSGAFGTVSYALDGTDAFK-FRINSTTGDIFVNVDADKNLTLLDRERFSTIFLTIEGRDGGGFVTAVQMEILLSDQNDQAPVFTRLSYFGVVKENSFTFD-SPVQVEAADNDLKGSNNSIVEYRIIGGDLG-----GNFNIVSTSGLLMIRTPLNYESLPSSIVNLTISAYDLGVPSLNSSINVQVTVLDQNDNSPICTYALFNATVMENATSGTQILQVNATDADPPGSENSRVFFRIQTGAADKFTIDG----NTGWIVVER-GADLDVTRYGSRYNLSIIVYDNGTPQRNGTCIAVIFVRDVNNQRPYFEVPTRRETVQENLSLNQPLPITPQFTAKDPDTTSNLQYSILFSQMSATEGNGQQVSVSNYNYTDLLYVSSTNGTLFVKNILDREKAQEIQIPIFVQDLAAETPLPVQTATGTLIITLSDLNDESPVFQLPAVNNTYRITVSEGLRPPTDISLKAL-----ATDPDTSNPPLVYSISPPSTIFSIDTNTAQVSLKTALDRETADQHQFFVLVNDSIHITTATVYVNVSDFNDVTPSFYQFASNLSISEATSVGSLLTRVLAYDNDTGLFGTVHYRILSGGGGKFALNDTSGELRLGQALDRDVPGGEEYSLLIEAFDNPGSADSLRTSRAMMISVLDVNDNPPRFAQDNFTITSLLESMDSNQLIREISATDADTGVNAQISFSLRAIPGQNSDALNLFFVTTKQSGSVFSAAIWTRKSLTRAVGWYNLTLLATDAGTPTMTGSTNLTFFIADVNDHSPVFVYP----NQTQTVIQVNESTNASSTIGKPLLVAKAIDQDYGNNTIVRFDLTSSNGDNAAFNIDAVSGLLTVATNLNREVKSEYRFSIKAYDLGVPPLTTMVNIVVQVLDVDESPPVFGPDSRVQQLSVPENSVPSSLIPGLTISGVRVGSIAKASDPDVTDKSTPICYFMLDPVYYLFYLNKTSGDLYVLSALDREAAPQYNLHVIAVGASQCNSTAYEWKNATNHRVKRYLDTTPIAYNPNNATMALIVVNVGDVNDNPPVWKNSIYYGGVRVTDPPSTTVFNFAEFVTDADIGNNSLLTFGMTGPTPDNQKLRTQLASREILDSVFTLDNRTGVLKTGDKTYFQETMTGAVSFNVTASDSKYLATTMCTIYLLSLEQQLIVVMSGVPANATRIRDAFVSYLSNITGWRIVVDNIVTHKNDDGTADNSKTDMYIHAINLKDNSIVPAATVRDKVDLLWPEMVAIYKTFGVLQVKLASQPASSDSILEIMRIALIVVACSLAILLFFACVSLWSCRRMYRRKLKAATAVAFGTNGHSNAPRTPGTNMHTYE 1853          
BLAST of Cadherin-23 vs. TrEMBL
Match: A0A267FGQ5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025494g1 PE=4 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 526/1644 (32.00%), Postives = 831/1644 (50.55%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMI-IDRESQDITNVFGFFDLTVIATETA----PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE--DSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTD--YTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRV----HNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQV---NATDPDTNCDLAYFIIQNTINAVNSSGVPVN-SLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ----TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGT-LQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLT--IYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRI--QKVNDK--GQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI------ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGY-NALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMS-------QYGDGPHSFLS----------GYSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNI-DTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIYEKE 5563
            ++L   LDYE     Q+ + A D++   S  F+   I V+D +D PP FQ   Y + + E  P DT V+TV A+DGDR + +PV+Y L   N F++YF++++++G++ +    +DRES ++  V+G  DL VIA E +    P   + +RT V I + D ND +  F+Q  +  SV EN+Q GV I     ++V+D D   NA +N++   + +T + FEV P     +A L++RVKN + LDYE +KS+N     L IA      E   S A V++ I+D NDN PIF  + Y F I ENS    ++G VTATD DSG FG I+YSL+      F I+S TG +  NV+  T    T LDRE    +++ A A DGGG ++   + + L D+NDN P+F    Y   + ENS  F   P++V+A D D   +NN ++   Y +  G  NY  +F +N STG +++V P+D E + +  + L V AYD     + +   + + V D NDNAP    + FS  V +     T +  +NATDAD S +  S + YR+    +  F +       TG I++    A L V      +N T+   D+GYP LS   +++++V ++N++ P F       +  ENL +G+++  +    A DPD++ +L+Y I+ + ++A+  SG PV  + +N T+L  +  T G + V   LDRE+   +T  I V D A ET  P QTA  TL + + DVND  P+FQ       F+ S++E       IST      + A D D   T LQY      DP   F +D  + Q+ L   LDRE +S     V  +D +     TV ITVLD+ND +P F  +   L++ E   VG++     A D+D G    V +   +     F L S  G L L  PL   + G   Y L+IE  DNP  T   K S+ + I ++DVN+N P FSQ  +  + +TE    G +I E+ ATD D G N  + + +          + LF +  ++  D     +  ++ LK     F  I+ A D G PR + +  + +++ D+ND+ P F  P    N S     I E+T    TI        ATDKD G+N  +RF+L S   D   F I P+SG L+   +  R  +  Y+F++ A D G   L+S  ++ V V  +D++ P FP       F++ E      +I   +L+G ++G++  AV+ D+G   A I Y     +   F++   +G  + + + DRE+K  Y+  V AV  S       ++   P                Y P N S A++VV I D+NDNPPV+      GG+   + P + ++  S+YV+D D  + +ALT+ I NI    S LA QL+ L I +TV ++   +G L T    +FQ+ + G +  ++ VSD ++ +   C +  +S  QQ++  + +      A+ +    YLSN+    I  +++  +K   G      ++++ HA++  +N +++   +   +++ ++    L   Y +L  RL           +  K  +IA++C   ++L    V +W  R  Y+ KL+A    +     NS+++K PGTN +  E
Sbjct:  223 VSLLKALDYETNKFYQIAVNATDTSAGGSSVFSDIIINVLDQQDTPPFFQKVPYIARIPENSPKDTLVVTVQALDGDRGVPNPVEYYLDPANAFSKYFSLDKSTGQLTVGSTPLDRESAELLAVYGTIDLPVIAKEVSTVSQPENISQTRTSVAIIVEDQNDRTPTFNQATFNASVVENTQVGVPISFADRVVVQDFDAGVNALFNITVWKDGRTYADFEVAPATGSVEATLIVRVKNSTLLDYETVKSVNF----LMIARETQTTELRSSTATVALQIIDANDNWPIFDKTKYVFSILENSVQGVVVGRVTATDLDSGAFGAILYSLDGTDNNIFSINSDTGEVTVNVDPATTPATTPLDRERISVIYLAARARDGGGFVSTVQLEVHLTDVNDNAPVFTRPSYSGLVKENSLTFE-SPLQVEAVDNDEKGSNNSLVQ--YAIVDG--NYGSSFAVNQSTGSLSLVKPLDYETLTHPTILLRVAAYDAGVPVLSNFVTVTVGVIDQNDNAPSCIKDVFSATVAETAPEGTFVAQINATDADPSVSENSKVFYRIQSGAADKFTIFG----DTG-IVQVERGADLDVNRFGDRYNLTIGVYDQGYPQLSGSCLLVVSVRDVNNQRPYFEVLSRRETVQENLPLGLSLPILPPYTAKDPDSSANLSYRILYDQMSALQPSGQPVQPAAYNYTSLFTVVPTTGAITVVGTLDREQAGEITIPIFVQDLANETVQPIQTATGTLILTLSDVNDEWPVFQPPAVNGTFRISIYEG---TVEIST-----KLLAIDADSSTTKLQYSTLPTNDPY--FGIDPNTAQLSLKTPLDREAISRYTLLVLVTDSLHKTTGTVEITVLDINDVQPTFYQFSDTLSVPENISVGSLLTTIKAYDNDTGAFGTVNYRILSGGGGKFSLNSETGELHLTAPLDRDVTGGDVYNLVIEAFDNPGSTNSLKSSRSMVINILDVNDNAPRFSQANFTITTLTESATAGQLIREISATDADVGVNREIDFSLQPVPGQSDRAMSLFTVTTKQTGDSYSASLTTSTDLKGAVGWFYLILLATDKGDPRQTGSTHLTISVSDVNDHAPEFIYP----NVSEIHVRINESTNASSTIGKELLQAVATDKDYGVNAVVRFSLTSSTTDQTAFRIDPVSGLLTVAINLRRTLQIQYRFQIQATDQGASPLSSQTSVVVEVWAVDESPPAFPQQSREQTFTLMENLPPAATIEGMNLTGTRLGSIGKAVNTDLGTPTAQICYFMISKSYDNFFVKKTNGDFYALIQADRESKPQYTIHVIAVSASYCSSSAYEWNAAPKELSRTRRSLDADPVAYDPSNPSMAQIVVQIGDVNDNPPVWRSAAFFGGVTVDSPPGTVVLSFSQYVSDADAGNNSALTFGISNIRADTSQLANQLQQLGITNTVLSI-AANGALRTGDKTYFQETMSGSLIFNVSVSDSRFTSWASCTIYLLSLNQQIVVTLSDNTRGAGAVRDELMAYLSNITGWRIVANNIVTYKREDGTADDTKSDIYIHAINKTTNAIISALTVRDKIDKLWSELPVLYKTYNVLWVRLAVQPAPTDSTLEILKIALIAVACGLTVMLFFSCVSLWSCRRMYRRKLKAATAVAFGPGGNSDSLKAPGTNAHAYE 1837          

HSP 2 Score: 115.546 bits (288), Expect = 1.134e-21
Identity = 324/1375 (23.56%), Postives = 531/1375 (38.62%), Query Frame = 2
Query:  902 INFTFIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMI----IDRESQDITNVFGFFDLTVIATETAPSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANA-QYNLSAVYNNKTSSIFEVYPIVAMN-KAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPEDSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPF----KKFVIDSSTGAIYTNVNANTDYTLLDREAYERLFVVA------IATDGGGL-------MNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSY---NFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIV--------TPVDREKIPNDILQLLVVAYDPSNSSMF-DTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIV-----EAVYNPKTGAIIKKYPNARLQVRVHNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIGQVNATDPDT----NCDLAYFIIQNTINAVNSSGVPVNSLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAA-ETPLPPQTAFATLRIEILDVNDNPPIFQTSLFQFSLFEDFKPKSNISTGATGFYVK---ATDVDIVGTLQYLYFDPSLSFYVDSI-----SGQIFLIKALDRET---VSNLNFTVSCSDGVF--LVNST-VSITVLDVNDNEPYFVDYIQVLNISEVTQVG-------TIFAKFVANDSDAGEN-AVVIFYFPNNSSSPFGLSLD----GYLTLIT------PLTIYGIFYYKLIIEI------MDNPRGTIHFKKSKEVGIYVI---DVNNNFPIFS--QVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRIQKVNDKGQILVNSSL-KNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYEN--TITLITIISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETK--DLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGYNALIVYIFTGDTVMFYLDPFSGH------LFGIKEFDRETKDTYSATVRAVPMSQYGDGPHSFL----SGYSPFNCSEARVVVIILDINDNPPVFTIPTI 4717
            +N T++ +   ED       SSY     EE+P    ++ + A D D      V   L   +    +F +   S      +     +D ES      +    + +  T    +L   S+ F  + I DINDN   F    Y+  + EN+ +    +   ++   D+D +A + Q N   V       +F        N +A     V     LDYE  K   +++     +   +     ++D+ I +LD  D  P F    Y   I ENSP  TL+  V A D D G+   + Y L DP     K F +D STG +          T LDRE+ E L V        IA +   +          T+V II++D ND  P F    + A + EN+      +F   RV   D D  V     L+       G   Y D F++  +TG V           T +D E + +  +  L++A +   + +   T  + + + D NDN P+F    +  ++ +N      +  + ATD D        I Y L G D+  F +     E   N          P  R ++ V      A D G     + V + +++T++ND  PVFT+  +S    EN     +  QV A D D     N  + Y I+                  N  +   +NQ+ G + +   LD   Y TLT    ++  AA +  +P  + F T+ + ++D NDN P     +F  ++ E         T   G +V    ATD D   +     F    S   D       +G + + +  D +        N T+   D  +  L  S  + ++V DVN+  PYF    +VL+  E  Q          I   + A D D+  N +  I Y   ++  P G  +      Y +L T       +T+ G    +   EI       D    T+   ++   G  ++   DVN+ +P+F    V   F  I+ Y     I  ++LA D D      + Y  L   D        F I    +  Q+ + + L +   +R+T +V   D+         TV +T++DIND  P+F          S   S+ EN    +L+T I A D D+G  G + + +  ++G    F ++  +G L      DR+    D+Y   + A D   P  T+++     ++    ++      +   NF+I       T+++ S+ +G  I  + +A D D+G N  I          F L P  G       LF +    ++T D+YSA++      +   G    +        P       + + + D+ND+ P F  P +
Sbjct:   38 LNSTYVTLPGGEDC----SGSSYIIYFKEEIPSGVPLMRIVAADAD---GDSVSMQLVGADQATYFFRLTSDSASRTAVLYSSGRLDAES------YNKISMELQITLNDGNLNIISKLFNPVIITDINDNKPEFLLQPYRWEIPENTLS----VAPFKVQAIDRDRDAGSIQLNFKEVSGINIDGLFS---FTGPNCRASCERNVSLLKALDYETNKFYQIAVNATDTSAGGS---SVFSDIIINVLDQQDTPPFFQKVPYIARIPENSPKDTLVVTVQALDGDRGVPNPVEYYL-DPANAFSKYFSLDKSTGQL------TVGSTPLDRESAELLAVYGTIDLPVIAKEVSTVSQPENISQTRTSVAIIVEDQNDRTPTFNQATFNASVVENTQVGVPISFAD-RVVVQDFDAGV---NALFNITVWKDG-RTYAD-FEVAPATGSVEATLIVRVKNSTLLDYETVKS--VNFLMIARETQTTELRSSTATVALQIIDANDNWPIFDKTKYVFSILENSVQGVVVGRVTATDLDSGAF--GAILYSLDGTDNNIFSINSDTGEVTVNVDPATTPATTPLDRERISVIYLAARARDGG--GFVSTVQLEVHLTDVNDNAPVFTRPSYSGLVKENSLTFESPLQVEAVDNDEKGSNNSLVQYAIVDG----------------NYGSSFAVNQSTGSLSLVKPLD---YETLTHPTILLRVAAYDAGVPVLSNFVTVTVGVIDQNDNAPSCIKDVFSATVAE---------TAPEGTFVAQINATDADPSVSENSKVFYRIQSGAADKFTIFGDTGIVQVERGADLDVNRFGDRYNLTIGVYDQGYPQLSGSCLLVVSVRDVNNQRPYF----EVLSRRETVQENLPLGLSLPILPPYTAKDPDSSANLSYRILYDQMSALQPSGQPVQPAAYNYTSLFTVVPTTGAITVVGTLDREQAGEITIPIFVQDLANETVQPIQTA-TGTLILTLSDVNDEWPVFQPPAVNGTFR-ISIYEGTVEISTKLLAIDAD-SSTTKLQYSTLPTND------PYFGIDP--NTAQLSLKTPLDREAISRYTLLVLVTDS---LHKTTGTVEITVLDINDVQPTFYQ-------FSDTLSVPENISVGSLLTTIKAYDNDTGAFGTVNYRI--LSGGGGKFSLNSETGELHLTAPLDRDVTGGDVYNLVIEAFD--NPGSTNSLKSSRSMVINILDVNDNAPRFSQANFTI-------TTLTESATAGQLIREI-SATDADVGVNREI---------DFSLQPVPGQSDRAMSLFTVTT--KQTGDSYSASLTTSTDLKGAVGWFYLILLATDKGDPRQTGSTHLTISVSDVNDHAPEFIYPNV 1294          
BLAST of Cadherin-23 vs. TrEMBL
Match: A0A1I8HDP5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 706.442 bits (1822), Expect = 0.000e+0
Identity = 527/1644 (32.06%), Postives = 831/1644 (50.55%), Query Frame = 2
Query:  815 LTLTTPLDYERFPMIQLQLQAQDSAYHVSINFT--FIQVIDVEDVPPIFQNSSYSSTMNEELPVDTHVITVTAIDGDRSLRSPVQYSLKDGNPFNEYFAINETSGEIIIAMI-IDRESQDITNVFGFFDLTVIATETA----PSLFNSSRTFVRIQILDINDNSANFDQPLYQGSVYENSQAGVAIIIGSEIMVEDKDLNANAQYNLSAVYNNKTSSIFEVYPIVAMNKAILVIRVKNGSFLDYEQIKSINVSIKGLQIAPVFNIPE--DSYADVSIAILDVNDNTPIFGNSSYTFMIFENSPNFTLIGVVTATDKDSGIFGKIIYSLNDPFKK-FVIDSSTGAIYTNVNANTD--YTLLDREAYERLFVVAIATDGGGLMNMTTVIIILKDLNDNPPIFEVRFYQAWLFENSYNFTFGPVRVKATDKDVDVANNRILYQFYNMSMGPPNYLDNFKINASTGDVTIVTPVDREKIPNDILQLLVVAYDPSNSSMFDTCIIQIIVQDVNDNAPVFGLNTFSVNVPQNISTNTTILFLNATDADESNTPQSDITYRLIGVDSVNFIVEAVYNPKTGAIIKKYPNARLQVRV----HNFTVEASDRGYPPLSTRVIILINVTEINDEPPVFTQSLFSFSTYENLDIGINIG---QVNATDPDTNCDLAYFIIQNTINAVNSSGVPVN-SLFNVTNLIGLNQTGGIVYVQSMLDREKYSTLTGQIQVIDKAAETPLPPQTAFATLRIEILDVNDNPPIFQ----TSLFQFSLFEDFKPKSNISTGATGFYVKATDVDIVGT-LQYLYF---DPSLSFYVDSISGQIFLIKALDRETVSNLNFTVSCSDGVFLVNSTVSITVLDVNDNEPYFVDYIQVLNISEVTQVGTIFAKFVANDSDAGENAVVIFYFPNNSSSPFGL-SLDGYLTLITPLT--IYGIFYYKLIIEIMDNPRGTIHFKKSKEVGIYVIDVNNNFPIFSQVFYEFSPITEYTNIGTIIGEVLATDKDFGENGNVSYKILLQKDTDVFILQLFRI--QKVNDK--GQILVNSSLKNLGARFTFIVNAVDNGVPRLSNNCTVAVTIIDINDNYPSFTNPVSPSNGSSPQFSIYENTITLITI------ISATDKDSGLNGEIRFNLDSMNGDHEFFFISPISGNLSNIRSFDRETKDLYKFRVLANDLGTPSLTSAVNIEXXXXXXXXXXXXFPSNYLLMNFSIYEGPLTFTSISNSSLSGFKIGNVATAVDRDIGY-NALIVYIFTGDTV-MFYLDPFSGHLFGIKEFDRETKDTYSATVRAVPMS-------QYGDGPHSFLSG----------YSPFNCSEARVVVIILDINDNPPVFTIPTILGGIVKFATPNSQIVDISKYVTDKDIVSQNALTYWIENIYPFQSDLAAQLKNLNI-DTVFALNITSGILSTAPGVFFQDNVDGFIQMSIGVSDGKYKNLDQCIVNFISSTQQVIAVIQNYPSFVVAMANNFSNYLSNMLNINITVDSVELFKDVRGNIPSGLTNLFFHAVSLPSNTVMNGSNLLSLLNQRFANTADLTAKYQLLDFRLTSNSTTPCVNNDYYKFIMIALSCSXXXXXXXXTVFVWMYRSKYQMKLRAFCTPSVDKMVNSNNVKLPGTNIYEKE 5563
            ++L   LDYE     Q+ + A D++   S  F+   I V+D +D PP FQ   Y + + E  P DT V+TV A+DGDR + +PV+Y L   N F++YF++++++G++ +    +DRES ++  V+G  DL VIA E +    P   + +RT V I + D ND +  F+Q  +  SV EN+Q GV I     ++V+D D   NA +N++   + +T + FEV P     +A L++RVKN + LDYE +KS+N     L IA      E   S A V++ I+D NDN PIF  + Y F I ENS    ++G VTATD DSG FG I YSL+      F I+S TG +  NV+  T    T LDRE    +++ A A DGGG ++   + + L D+NDN P+F    Y   + ENS  F   P++V+A D D   +NN ++   Y +  G  NY  +F +N STG +++V P+D E + +  + L V AYD     + +   + + V D NDNAP    + FS  V +     T +  +NATDAD S +  S + YR+    +  F +       TG I++    A L V      +N T+   D+GYP LS   +++++V ++N++ P F       +  ENL +G+++       A DPD++ +L+Y I+ + ++A+  SG PV  + +N T+L  +  T G + V   LDRE+   +T  I V D A ET  P QTA  TL + + DVND  P+FQ       F+ S++E       IST      + ATD D   T LQY      DP   F +D  + Q+ L   LDRE +S     V  +D +     TV ITVLD+ND +P F  +   L++ E   VG++     A D+D G    V +   +     F L S  G L L  PL   + G   Y L+IE  DNP  T   K S+ + I ++DVN+N P FSQ  +  + +TE    G +I E+ ATD D G N  + + +          + LF +  ++  D     +  ++ LK     F  I+ A D G PR + +  + +++ D+ND+ P F  P    N S     I E+T    TI        ATDKD G+N  +RF+L S   D   F I P+SG L+   +  R  +  Y+F++ A D G   L+S  ++ V V  +D++ P FP       F++ E      +I   +L+G ++G++  AV+ D+G   A I Y     +   F+++  +G  + + + DRE+K  Y+  V AV  S       ++   P                Y P N S A++VV I D+NDNPPV+      GG+   + P + ++  S+YV+D D  + +ALT+ I NI    S LA QL+ L I +TV ++   +G L T    +FQ+ + G +  ++ VSD ++ +   C +  +S  QQ++  + +      A+ +    YLSN+    I  +++  +K   G      ++++ HA++  +N +++   +   +++ ++    L   Y +L  RL           +  K  +IA++C   ++L    V +W  R  Y+ KL+A    +     NS+++K PGTN +  E
Sbjct:   53 VSLLKALDYETNKFYQIAVNATDTSAGGSSVFSDIIINVLDQQDTPPFFQKVPYIARIPENSPKDTLVVTVQALDGDRGVPNPVEYYLDPANAFSKYFSLDKSTGQLTVGSTPLDRESAELLAVYGTIDLPVIAKEVSTVSQPENISQTRTSVAIIVEDQNDRTPTFNQATFNASVVENTQVGVPISFADRVVVQDFDAGVNALFNITVWKDGRTYADFEVAPATGSVEATLIVRVKNSTLLDYETVKSVNF----LMIARETQTTELRSSTATVALQIIDANDNWPIFDKTKYVFSILENSVQGVVVGRVTATDLDSGAFGAISYSLDGTDNNIFSINSDTGEVTVNVDPATTPATTPLDRERISVIYLAARARDGGGFVSTVQLEVHLTDVNDNAPVFTRPSYSGLVKENSLTFE-SPLQVEAVDNDEKGSNNTLVQ--YAIVDG--NYGSSFAVNQSTGSLSLVKPLDYETLTHPTIVLRVAAYDAGVPVLSNFVTVTVGVIDQNDNAPSCIKDVFSATVAETAPEGTFVAQINATDADPSVSENSKVFYRIQSGAADKFTIFG----DTG-IVQVERGADLDVNRFGDRYNLTIGVYDQGYPQLSGSCLLVVSVRDVNNQRPYFEVLSRRETVQENLPLGLSLPISPPYTAKDPDSSANLSYRILYDQMSALQPSGQPVQPAAYNYTSLFTVVPTTGAITVVGNLDREQAGEITIPIFVQDLANETVQPIQTATGTLILTLSDVNDEWPVFQPPAVNGTFRISIYEG---TVEIST-----KLLATDADSSTTKLQYSTLPTNDPY--FGIDPNTAQLSLKTPLDREAMSRYTLLVLVTDSLHKTTGTVEITVLDINDVQPTFYQFSDTLSVPENISVGSLLTTIKAYDNDTGAFGTVNYRILSGGGGKFSLNSETGELHLTAPLDRDVTGGDVYNLVIEAFDNPGSTNSLKSSRSMVISILDVNDNAPRFSQANFTITTLTESATAGQLIREISATDADVGVNQEIDFSLQPVPGQSDRAMSLFTVTTKQTGDSYSA