PiggyBac transposable element-derived protein 4

Overview
NamePiggyBac transposable element-derived protein 4
Smed IDSMED30010813
Length (bp)1181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PiggyBac transposable element-derived protein 4 (SMED30010813) t-SNE clustered cells

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30010813) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PiggyBac transposable element-derived protein 4 (SMED30010813) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PiggyBac transposable element-derived protein 4 (SMED30010813) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010813

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010813SMESG000015322.1 SmedASXL_067704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010813SMESG000015322.1 SmedASXL_067704SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Match: CABZ01072083.2 (dual specificity phosphatase 26 [Source:NCBI gene;Acc:570815])

HSP 1 Score: 70.0922 bits (170), Expect = 1.389e-12
Identity = 34/105 (32.38%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLL 927
            V+Y   +      +S+ H D +  ++   KP +I +YN+T+GGV+N DK    Y+  R+    P  I   ML+  A N F++++  N  W      RRR+FL+ L
Sbjct:  391 VSYHPRKNKNVLVMSTLHRDDAENSDEQSKPQMILDYNSTRGGVDNFDKLTSTYTCQRKTLHWPMVIFFNMLDVSAYNAFVLWMDLNPSWEAQKTNRRRIFLQDL 495          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Match: npffr2 (neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-GENE-994428])

HSP 1 Score: 67.781 bits (164), Expect = 8.306e-12
Identity = 44/131 (33.59%), Postives = 66/131 (50.38%), Query Frame = 1
Query:  544 DNANRTRFSCFLGRTGISRSDNCVTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD 936
            D A R  FS  + R+G   S +   Y  ++    C L+S H D +IG+   +KP  I +YN+ K GV+ +D+    YS      R P  +   ML+  A+N +I+Y     GW      +RR+FL LL K+
Sbjct:  205 DTAQREVFSTSVLRSG---SVSLTIYAPKKNLTVCVLNSMHQDVTIGDNRKRKPNTITDYNHMKCGVDVLDQMARMYSVRAATRRWPVAVYYNMLDLAAVNAYILY-KACTGWTG----KRRLFLSLLAKE 327          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: G3Q385 (DDE_Tnp_1_7 domain-containing protein OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 4.521e-15
Identity = 39/115 (33.91%), Postives = 63/115 (54.78%), Query Frame = 1
Query:  589 GISRSDNCVTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVK 933
              +     V+Y  +R      +S+ H D+S+      KP +I +YN TKGGV+N+DK    YS  R+ AR P  +   +++  A N ++++I  N  WN +  +RRR+FL+ L K
Sbjct:   41 AFTEKTTLVSYCPKRNKNVLVMSTMHKDASLSTREDMKPQMILDYNATKGGVDNLDKVTATYSCQRKTARWPLVVFYNIVDVSAYNAYVLWIEINQQWNASKLYRRRLFLEELGK 155          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: G3N553 (DDE_Tnp_1_7 domain-containing protein OS=Gasterosteus aculeatus OX=69293 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 8.775e-15
Identity = 39/107 (36.45%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVK 933
            V+Y  +R      +S+ H D+S+      KP +I +YN TKGGV+N+DK    YS  R+ AR P  +   +++  A N ++++I  N  WN +  +RRR+FL+ L K
Sbjct:   49 VSYCPKRNKYVLVMSTMHKDASLSTREDMKPQMILDYNATKGGVDNLDKVTATYSCQRKTARWPLVVFYNIVDVSAYNAYVLWIEINQQWNASKLYRRRLFLEELGK 155          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A0S7EQU4 (PGBD4 (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=PGBD4 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.390e-14
Identity = 42/130 (32.31%), Postives = 68/130 (52.31%), Query Frame = 1
Query:  589 GISRSDNCVTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILDVR 978
              +     V+Y  +R      +S+ H D+S+      KP +I +YN+TKGGV+N+DK    YS  R+    PF I   +++  A N ++++I  N  WN +   RRR+FL+ L K      ++ R+  VR
Sbjct:   13 AFTEKTTLVSYCPKRNKNVLVMSTMHKDASLSTREDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTTYWPFVIFCNIVDVSAYNAYVLWIEINQQWNASKLHRRRLFLEELGKALVTPYIQNRVRPVR 142          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A1Y1LXG8 (DDE_Tnp_1_7 domain-containing protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.899e-14
Identity = 43/128 (33.59%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  589 GISRSDNCVTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILD 972
            G       V+Y  +       LSS+H DS+I     +KP +I +YN TKG V+ +DK I EY+  R++ R P  + M +++  A+N F++++  N  W      +RRMFL  L K     +++ RI D
Sbjct:   10 GFQPEITMVSYVPKVNQSVILLSSEHRDSAISEGSKRKPEIITHYNATKGAVDTLDKMIAEYTCNRQSKRWPATLFMNIIDIAAVNAFVMWVHLNPEWERQYLDKRRMFLLELGKRLVQPHLQRRISD 137          
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Match: A0A5C6MNA5 (DDE_Tnp_1_7 domain-containing protein OS=Takifugu flavidus OX=433684 GN=D4764_08G0002360 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.596e-14
Identity = 41/109 (37.61%), Postives = 61/109 (55.96%), Query Frame = 1
Query:  607 NCVTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVK 933
            + V+Y  ++      +S+ H D  I ++ H KP +I +YN TKGGV+N+DK +  YS  RR  R P  I   ML+  A N F+I++  N  W      +RR+FL+ L K
Sbjct:  106 SLVSYVPKKAKNVVLMSTLHGDGRICDQEHHKPEIIMDYNATKGGVDNIDKLVTAYSCKRRTLRWPLVIFFDMLDISAYNAFVIWMALNPEWKRVKLQKRRLFLEDLGK 214          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000037833.1 (piggyBac transposable element-derived protein 4-like [Source:NCBI gene;Acc:101160710])

HSP 1 Score: 82.4185 bits (202), Expect = 1.187e-16
Identity = 39/107 (36.45%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVK 933
            V+Y  +R      +S+ H+D+S+      KP +I +YN+TKGGV+N+DK    YS  R+ AR P  I   +++  A N ++++   N  WN    +RRR+FL+ L K
Sbjct:  387 VSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKLYRRRLFLEELGK 493          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000027888.1 (pep primary_assembly:ASM223467v1:17:9217998:9219211:-1 gene:ENSORLG00000025878.1 transcript:ENSORLT00000027888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 1.788e-16
Identity = 38/107 (35.51%), Postives = 62/107 (57.94%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVK 933
            V+Y  +R      +S+ H+D+S+      KP +I +YN+TKGGV+N+DK    YS  R+ AR P  I   +++  A N ++++   N  WN    +RR++FL+ L K
Sbjct:  190 VSYCPKRNKNVLVMSTMHTDASLSTRDDMKPQMILDYNSTKGGVDNLDKVTATYSCQRKTARWPMAIFFNIVDVSAYNAYVLWSEINQEWNAGKLYRRQLFLEELSK 296          
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Match: ENSORLT00000029842.1 (piggyBac transposable element-derived protein 4 [Source:NCBI gene;Acc:101157644])

HSP 1 Score: 67.0106 bits (162), Expect = 4.119e-13
Identity = 45/136 (33.09%), Postives = 72/136 (52.94%), Query Frame = 1
Query:  610 CVTYTKERKNGSCNLSSQHSDSSIGNE*H-QKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILDVRKKPSILKAIQAY 1014
             ++Y  ++      LS++HS   I +E   +KP +I +YN TKGGV+N+DK +  YS  R   R P  +   M++  A N ++I+   +  W      RRR+FL+ L KD       +R L +R+K  + +A  AY
Sbjct:  637 ALSYVPKKNKNVLLLSTKHSRVEICHERRDKKPEMILDYNKTKGGVDNLDKLLATYSCRRMTKRWPLAMFHNMIDMSAYNAYVIWREMHPDWMPWNRNRRRIFLEQLGKD------LVRPLVLRRK-RVPRARPAY 765          

HSP 2 Score: 26.5646 bits (57), Expect = 4.119e-13
Identity = 14/25 (56.00%), Postives = 17/25 (68.00%), Query Frame = 3
Query: 1035 VQTQEAAQTS-RATGK*GRCRLCPR 1106
            V  QEA  TS R+ GK  RC++CPR
Sbjct:  769 VSMQEAGGTSARSEGKRKRCQICPR 793          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000015322.1 (SMESG000015322.1)

HSP 1 Score: 135.961 bits (341), Expect = 1.588e-39
Identity = 67/70 (95.71%), Postives = 67/70 (95.71%), Query Frame = 1
Query:  817 MQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILDVRKKPSILKAIQAYGELL 1026
            MQMLNTEALN FIIYITKNHGWNTNLGFRRRMFLKLLVKD TNQNMKLRILDVRK PSILKAIQAYGELL
Sbjct:    1 MQMLNTEALNAFIIYITKNHGWNTNLGFRRRMFLKLLVKDLTNQNMKLRILDVRKTPSILKAIQAYGELL 70          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000015322.1 (SMESG000015322.1)

HSP 1 Score: 131.339 bits (329), Expect = 7.840e-38
Identity = 65/68 (95.59%), Postives = 65/68 (95.59%), Query Frame = 1
Query:  823 MLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILDVRKKPSILKAIQAYGELL 1026
            MLNTEALN FIIYITKNHGWNTNLGFRRRMFLKLLVKD TNQNMKLRILDVRK PSILKAIQAYGELL
Sbjct:    1 MLNTEALNAFIIYITKNHGWNTNLGFRRRMFLKLLVKDLTNQNMKLRILDVRKTPSILKAIQAYGELL 68          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000070813.1 (SMESG000070813.1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.878e-11
Identity = 40/134 (29.85%), Postives = 70/134 (52.24%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSSIGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRILDVRKKPSILKAIQAY 1014
            V+Y  ++      L ++  ++ I  E + KP +I  YN TKG V++ D    EYS  R   R  FR+ M++++  A N ++++   +  W  N   RR++FL+ L K    +N++ R  D+  K SI + I  +
Sbjct:  212 VSYIPKKGKAVNLLITKFHNNEICKEENNKPRIILYYNKTKGAVDSGDMMTFEYSIVRVTRRWAFRLFMELIDIAAFNAYVVWKAVHPDWRNNDSGRRKVFLRELAKALATKNVQDRKYDMFHK-SIKRCIDIF 344          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000081807.1 (SMESG000081807.1)

HSP 1 Score: 60.8474 bits (146), Expect = 6.268e-10
Identity = 39/155 (25.16%), Postives = 73/155 (47.10%), Query Frame = 1
Query:  574 FLGRTGISRSDNCVTYTKERKNGSCNLSSQHSDSSIGNE*H-QKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFLKLLVKD*TNQNMKLRIL------DVRKKPSILKAIQAYG 1017
            F  +   ++    V+Y   +      LS+ H+   + ++   +KP ++ +YN TKG V+  D+ +  YS+A +  + P R+   +++   LN F++    N  W  + G RR    +L +    +  MK  I+       +  KPS+ +AI A G
Sbjct:  250 FESKFAFTKDTALVSYAPPKNRTVVLLSTMHNRPVVFDDGRGRKPYMVLDYNMTKGAVDAFDQEVSFYSFAHKTRQWPMRLFYFIIDASCLNAFVLLNMNNPTWKDHEGSRRLDKRRLFLTKAAHSLMKPMIIARADNKSISHKPSVARAILAVG 404          
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Match: SMESG000032747.1 (SMESG000032747.1)

HSP 1 Score: 51.2174 bits (121), Expect = 8.800e-7
Identity = 31/104 (29.81%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  613 VTYTKERKNGSCNLSSQHSDSS--IGNE*HQKPCVIENYNNTKGGVNNVDKFIGEYSYARRAAR*PFRILMQMLNTEALNTFIIYITKNHGWNTNLGFRRRMFL 918
            V+Y  ++   +  LS+ H+  +  +G++   KP V+  YN TKGGV+ +D+ +  Y+   +  R        +L+  A N F ++      WN N   RRR+FL
Sbjct:   48 VSYVAKKSKVANILSTAHNKITGYVGSK--HKPDVLLFYNATKGGVDAMDERVATYTTKFKCRRWHVAFFCNILDISAFNAFALHYLVEPQWNANKSHRRRLFL 149          
The following BLAST results are available for this feature:
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01072083.21.389e-1232.38dual specificity phosphatase 26 [Source:NCBI gene;... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
npffr28.306e-1233.59neuropeptide FF receptor 2 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G3Q3854.521e-1533.91DDE_Tnp_1_7 domain-containing protein OS=Gasterost... [more]
G3N5538.775e-1536.45DDE_Tnp_1_7 domain-containing protein OS=Gasterost... [more]
A0A0S7EQU41.390e-1432.31PGBD4 (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
A0A1Y1LXG81.899e-1433.59DDE_Tnp_1_7 domain-containing protein (Fragment) O... [more]
A0A5C6MNA52.596e-1437.61DDE_Tnp_1_7 domain-containing protein OS=Takifugu ... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000037833.11.187e-1636.45piggyBac transposable element-derived protein 4-li... [more]
ENSORLT00000027888.11.788e-1635.51pep primary_assembly:ASM223467v1:17:9217998:921921... [more]
ENSORLT00000029842.14.119e-1333.09piggyBac transposable element-derived protein 4 [S... [more]
back to top
BLAST of PiggyBac transposable element-derived protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015322.11.588e-3995.71SMESG000015322.1[more]
SMESG000015322.17.840e-3895.59SMESG000015322.1[more]
SMESG000070813.11.878e-1129.85SMESG000070813.1[more]
SMESG000081807.16.268e-1025.16SMESG000081807.1[more]
SMESG000032747.18.800e-729.81SMESG000032747.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010813 ID=SMED30010813|Name=PiggyBac transposable element-derived protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1181bp
AATAGGATTTCAAAAGGTAACTAAATCAAATCGATATAAATTCCATGGAA
AATTGCGAGAAATATTTCCATTTTGGGAGATTTTTTGGAATACATAAAAA
ATTAATCAAATCCATAATTTATAAATCTAACATATTTGAGCAATTGTTTA
AATGCAGGAAATGTCGCAGCAAAAAATGTGTTATCAAACTTGTTTAGGAA
CATTTTTGAGGATTAAAATACGAATAATTTGTTATTAATTTGATGCATAA
TAATTTATAACGGATCATTCATTAGGACGTATCATAAAAAGAGGAGAATG
GTTGTTTACAAAAGAGACAATATGGAGGAGTTTCCAAGTTCTTTGAATAT
CCTCAACAGCATAATTTGTTACAATTTACACTTTCATTTAAAACAGCATT
TAAAATTTCATAATATTATTTACCCCTTAAAATGCCGAATGGGGTCTAAT
TTATGGGGTCTTTTTAGTTATTAACATACTGTGGTCTCCAGGAGACTCAT
GCCGTAATTAGTAGGCACTCATTTCTCGTGCAATAAATTGACAGATAACG
CCAACCGAACGCGTTTTTCATGTTTTTTAGGCCGCACAGGAATCAGCAGA
TCTGACAATTGTGTCACATATACCAAAGAAAGGAAAAATGGTTCATGTAA
TCTGTCTTCTCAGCACAGTGATTCCTCCATAGGAAATGAATAGCATCAAA
AACCTTGCGTGATAGAGAATTATAACAACACCAAAGGTGGTGTTAATAAT
GTTGATAAATTTATCGGCGAATATAGTTATGCTCGCCGAGCTGCAAGATG
ACCATTTAGAATCCTCATGCAAATGTTAAACACTGAAGCTCTAAATACTT
TCATAATTTACATAACAAAAAATCATGGTTGGAACACAAACCTTGGATTC
AGACGACGAATGTTCCTCAAGCTTTTGGTTAAAGACTAAACTAATCAAAA
TATGAAACTTCGCATACTAGACGTTCGAAAAAAACCAAGCATTTTGAAAG
CTATTCAAGCCTACGGAGAGCTGCTATAAACACAGTTCAGACTCAAGAAG
CAGCACAAACATCACGTGCTACTGGGAAATGAGGTAGATGCAGACTTTGT
CCAAGATTTAGCTACAGAAAAATAAATATTCGTTTTGATCATAGAGTAGA
AATAAAAGAAAAGAAAACTATACGTTGCTTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding