SCP domain-containing protein

Overview
NameSCP domain-containing protein
Smed IDSMED30010795
Length (bp)363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCP domain-containing protein (SMED30010795) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCP domain-containing protein (SMED30010795) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010795

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010795SMESG000036385.1 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010795SMESG000036385.1 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010795SMESG000036385.1 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010795SMESG000036385.1 dd_Smed_v4_5743_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 70.0922 bits (170), Expect = 1.228e-14
Identity = 43/101 (42.57%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   65 PSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            P E KE +L  HN LR  V       QP A+NM  M WDD+L + A +WAS CI  H   +       + +GQN+ A    Y+     VQ WYDE KDYTY
Sbjct:   52 PREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTS-----LLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY 140          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 70.0922 bits (170), Expect = 1.277e-14
Identity = 43/101 (42.57%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   65 PSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            P E KE +L  HN LR  V       QP A+NM  M WDD+L + A +WAS CI  H   +       + +GQN+ A    Y+     VQ WYDE KDYTY
Sbjct:   52 PREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTS-----LLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY 140          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISPLD2 (cysteine rich secretory protein LCCL domain containing 2 [Source:HGNC Symbol;Acc:HGNC:25248])

HSP 1 Score: 69.707 bits (169), Expect = 1.632e-14
Identity = 43/101 (42.57%), Postives = 53/101 (52.48%), Query Frame = 2
Query:   65 PSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            P E KE +L  HN LR  V       QP A+NM  M WDD+L + A +WAS CI  H   +       + +GQN+ A    Y+     VQ WYDE KDYTY
Sbjct:   52 PREDKEEILMLHNKLRGQV-------QPQASNMEYMTWDDELEKSAAAWASQCIWEHGPTS-----LLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTY 140          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 60.8474 bits (146), Expect = 1.172e-11
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 2
Query:   71 EYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD---YKDVVQGWYDEFKDYTY 355
            + +  ++  HN+LR+ V+       P A+NM++M W  ++   A+ WA+ C   H    DR+       G+N++  SD   +   +Q WYDE  D+ Y
Sbjct:   35 QVQREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTS--TRCGENLYMSSDPTSWSSAIQSWYDEILDFVY 123          
BLAST of SCP domain-containing protein vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 60.8474 bits (146), Expect = 1.172e-11
Identity = 29/98 (29.59%), Postives = 50/98 (51.02%), Query Frame = 2
Query:   71 EYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD---YKDVVQGWYDEFKDYTY 355
            + +  ++  HN+LR+ V+       P A+NM++M W  ++   A+ WA+ C   H    DR+       G+N++  SD   +   +Q WYDE  D+ Y
Sbjct:   35 QVQREIVNKHNELRKAVS-------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTS--TRCGENLYMSSDPTSWSSAIQSWYDEILDFVY 123          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-10 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q20609])

HSP 1 Score: 53.5286 bits (127), Expect = 1.607e-9
Identity = 30/98 (30.61%), Postives = 49/98 (50.00%), Query Frame = 2
Query:   14 LFCFFVYGITLTLTSCTPSEY-KEFLLKAHNDLRRNVALGH----TPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMF 292
            L C  ++    TL  C  SE  K ++L  HN LR  +ALG        +P+A+NM++++WD  L   A+ +++ C  GH             +G+NM+
Sbjct:    7 LICLLIFSFCETL--CEFSETGKNYILSRHNYLRSQIALGKYVAGNSTKPSASNMMKLIWDTTLETTAQDYSTGCPTGHSASRAN-------IGENMY 95          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-12 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q9N5N3])

HSP 1 Score: 51.6026 bits (122), Expect = 8.484e-9
Identity = 37/131 (28.24%), Postives = 56/131 (42.75%), Query Frame = 2
Query:   17 FCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGH----TPNQPAAANMIEMVWDDDLAEKAESWASSCIAGH-------------DTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYE 358
            F  ++  I    T+   S  +  ++KAHNDLR  +ALG+       +P AANM ++ WD  +A  A+ +A++C   H              +     LDKF     N             W  EF+DY +E
Sbjct:    3 FALYLIAIFGCATAQFSSTAQTAIVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTCPDDHSGTEYGENLYWSWSSSAPTSLDKFGVAASN------------SWEKEFQDYGWE 121          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-8 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18540])

HSP 1 Score: 47.3654 bits (111), Expect = 2.896e-7
Identity = 23/70 (32.86%), Postives = 42/70 (60.00%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGH----TPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMF 274
            K+ +L AHND+R  +A G+       + +A NM++M WD  L + A+++A+ C   H T ND+ + + ++
Sbjct:   23 KQSILNAHNDIRSRIAKGNYVAKGNRKESATNMLKMKWDSSLEQSAQNYANGCHMQHST-NDKTIGENLY 91          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-15 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:O16575])

HSP 1 Score: 46.595 bits (109), Expect = 5.080e-7
Identity = 28/100 (28.00%), Postives = 53/100 (53.00%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALG-----HTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQG-WYDEFKDYTYE 358
            ++ ++ AHN LR ++A G      T  +P + N+++M WD  +A+ A+++A++C  GH      E   + + G  + +  DY     G W  EF+ Y ++
Sbjct:   24 QKAIVDAHNTLRSSIAKGTYVANKTRKEPGS-NILKMKWDPTIAKSAQAYANTCPTGHGKSKYGENLYWRWSGAVIKSIDDYGVRASGAWASEFQKYGWK 122          
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Match: scl-5 (SCP-Like extracellular protein [Source:UniProtKB/TrEMBL;Acc:Q18543])

HSP 1 Score: 46.2098 bits (108), Expect = 7.946e-7
Identity = 33/126 (26.19%), Postives = 56/126 (44.44%), Query Frame = 2
Query:   44 LTLTSCTPSEYKEF-------LLKAHNDLRRNVALG----HTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMF---AGSDYKDVVQ-------GWYDEFKDYTYE 358
            L LT+     Y +F       +L  HN LR  +A G        +PAA++M++M WD  +A  A+++A+ C  GH             +G+N++     +   ++ Q        W  EF+DY + 
Sbjct:    6 LLLTALCAGAYAQFSANGQAAILNVHNTLRSRIAKGTYVAKGTAKPAASDMLKMKWDATVAASAQAYANKCPTGH--------SGAAGLGENLYWYWTSATITNIDQFGATGSAAWEKEFQDYGWS 123          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG8483 (gene:FBgn0038126 transcript:FBtr0082782)

HSP 1 Score: 78.1814 bits (191), Expect = 7.774e-18
Identity = 39/112 (34.82%), Postives = 63/112 (56.25%), Query Frame = 2
Query:   50 LTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFA----------GSDYKDVVQGWYDEFKDYTY 355
            + S   +E +  +L+ HN LR+ VA G  P QP A NM E+VWDD+LA +A+ WA +C   HD +  R +++F  +GQN+              D+   +Q W++E + Y++
Sbjct:   28 IASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQFRHDPH--RTINRFT-MGQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQKYSF 136          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG42780 (gene:FBgn0261848 transcript:FBtr0303416)

HSP 1 Score: 53.1434 bits (126), Expect = 3.966e-9
Identity = 38/111 (34.23%), Postives = 52/111 (46.85%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFA-GSDYKDV----------------VQGWYDEFKDYTYE 358
            K  L+KAHN +R+  A G    +  A  M +M W+ DL + A   A +C+ GHD  ++ E  KF   GQN+FA G  +  +                VQ W  E KD T E
Sbjct:   61 KNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTE--KFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAE 169          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG42780 (gene:FBgn0261848 transcript:FBtr0339817)

HSP 1 Score: 53.1434 bits (126), Expect = 4.027e-9
Identity = 38/111 (34.23%), Postives = 52/111 (46.85%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFA-GSDYKDV----------------VQGWYDEFKDYTYE 358
            K  L+KAHN +R+  A G    +  A  M +M W+ DL + A   A +C+ GHD  ++ E  KF   GQN+FA G  +  +                VQ W  E KD T E
Sbjct:   62 KNALIKAHNLVRQKWASGKAKIKWTACKMAKMEWNKDLEKLAILNAKTCLMGHDECHNTE--KFRLSGQNLFAMGFSHARITKTKMNMTLSMLFEMAVQKWAGEEKDITAE 170          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: Ag5r2 (gene:FBgn0020508 transcript:FBtr0073938)

HSP 1 Score: 48.521 bits (114), Expect = 1.404e-7
Identity = 35/103 (33.98%), Postives = 51/103 (49.51%), Query Frame = 2
Query:   71 EYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNM----FAGSDYKDV-------VQGWYDEFKD 346
            +YK   + +HND R  +A G+  N  AA  M  M WDD+LA  A      C   HD+ ++   D F + GQN+    ++G D  D+       VQ W+DE  +
Sbjct:   57 DYKWVFVHSHNDKRNYIAGGYDSNHNAACRMATMEWDDELAYLASLNVRQCNMVHDSCHNT--DAFKYSGQNLAWQAYSG-DLPDMGYILDNSVQMWFDEVHN 156          
BLAST of SCP domain-containing protein vs. Ensembl Fly
Match: CG32679 (gene:FBgn0052679 transcript:FBtr0071469)

HSP 1 Score: 46.9802 bits (110), Expect = 5.631e-7
Identity = 30/98 (30.61%), Postives = 44/98 (44.90%), Query Frame = 2
Query:   83 FLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQN---MFAGSD-----YKDVVQGWYDEFKDYT 352
             +L+ HN+ R  +A G     P+A  M  M WD  LA+ A   A  C   HD    R  + + + GQN   +F  S       +  +  W+DE +D T
Sbjct:   63 LILQLHNERRNLIAGGGVSGFPSAVQMATMSWDTTLAQLAAYNALQCRMAHDEC--RNTNTYRYAGQNLSILFTRSVDVAVFLRQRIAAWFDENRDAT 158          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 65.855 bits (159), Expect = 2.691e-13
Identity = 40/99 (40.40%), Postives = 48/99 (48.48%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNM------FAGSDYKDVVQGWYDEFKDYTY 355
            +E +LK HN LR  V        P A+NM  M+WDD+L   A SWA  C   H        D  M +GQN+      +    Y   VQ WYDE KDYTY
Sbjct:   65 REEILKLHNKLRGEV-------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQ-----DLLMSIGQNLAVHWGRYRSPAYH--VQAWYDEVKDYTY 149          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01068499.1 (cysteine-rich venom protein natrin-1-like [Source:NCBI gene;Acc:100536500])

HSP 1 Score: 61.6178 bits (148), Expect = 2.655e-12
Identity = 32/99 (32.32%), Postives = 50/99 (50.51%), Query Frame = 2
Query:   68 SEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG---SDYKDVVQGWYDEFKDYTY 355
            S  ++ ++  HN  RR V       QP+A+NM++M W D +AE A  W + C   H   + R L+ +   G+N+F     S +  VV  W+ E  +Y Y
Sbjct:    6 SSVQQEIVDVHNAFRRAV-------QPSASNMLKMSWSDAVAESARGWINKCNMTHGPPSSRMLNGYEM-GENLFKATGISSWTSVVDAWHSEVNNYKY 96          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: pi15a (peptidase inhibitor 15a [Source:NCBI gene;Acc:561978])

HSP 1 Score: 61.6178 bits (148), Expect = 4.018e-12
Identity = 37/95 (38.95%), Postives = 51/95 (53.68%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD-YKDVVQ---GWYDEFKDYTYE 358
            +L  HN +R  V        P A+NM  MVWDD LA+ AE WAS+CI  H   N        F+GQN+   +  Y+ ++Q    W+DE KDY++ 
Sbjct:   72 ILDYHNKVRGKVF-------PPASNMEYMVWDDTLAKTAEQWASTCIWEHGPRN-----LLRFLGQNLSVRTGRYRSILQLVKPWHDEVKDYSFP 154          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 59.3066 bits (142), Expect = 2.434e-11
Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS-DYKDVVQ---GWYDEFKDYTYE 358
            +L  HN +R NV        P AANM  M+WDD LA  AE+WA++CI  H            ++GQN+   + +Y+ ++Q    WYDE +DY + 
Sbjct:   54 ILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHG-----PPYLLRYLGQNLSVRTGNYRSILQLVKPWYDEVRDYMFP 136          
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Match: pi15b (peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-070912-590])

HSP 1 Score: 59.3066 bits (142), Expect = 2.556e-11
Identity = 35/95 (36.84%), Postives = 51/95 (53.68%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS-DYKDVVQ---GWYDEFKDYTYE 358
            +L  HN +R NV        P AANM  M+WDD LA  AE+WA++CI  H            ++GQN+   + +Y+ ++Q    WYDE +DY + 
Sbjct:   69 ILDYHNKVRANVF-------PPAANMEYMLWDDGLARSAEAWAATCIWEHG-----PPYLLRYLGQNLSVRTGNYRSILQLVKPWYDEVRDYMFP 151          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 65.0846 bits (157), Expect = 7.179e-13
Identity = 39/97 (40.21%), Postives = 50/97 (51.55%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            KE +++ HN LR  V        P+A+NM  M WDD+L + AE+WA  CI  H           M +GQN+      Y+     VQ WYDE KDYTY
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHGP-----TALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTY 141          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 64.6994 bits (156), Expect = 7.841e-13
Identity = 39/97 (40.21%), Postives = 50/97 (51.55%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            KE +++ HN LR  V        P+A+NM  M WDD+L + AE+WA  CI  H           M +GQN+      Y+     VQ WYDE KDYTY
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG-----PTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTY 141          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:613091])

HSP 1 Score: 64.6994 bits (156), Expect = 8.758e-13
Identity = 39/97 (40.21%), Postives = 50/97 (51.55%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            KE +++ HN LR  V        P+A+NM  M WDD+L + AE+WA  CI  H           M +GQN+      Y+     VQ WYDE KDYTY
Sbjct:   57 KEEIIQLHNKLRGQV-------HPSASNMEYMTWDDELEKSAEAWAEECIWEHG-----PTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTY 141          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: R3HDML (R3H domain containing-like [Source:NCBI gene;Acc:100492715])

HSP 1 Score: 59.6918 bits (143), Expect = 2.724e-11
Identity = 37/96 (38.54%), Postives = 51/96 (53.12%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFM-FVGQNMFAGS----DYKDVVQGWYDEFKDYTYE 358
            LL  HN +R  V        P AANM  MVWD+ LA+ AESWA+ C   H        ++ M ++GQN+   S       D+V+GWYDE + Y++ 
Sbjct:   66 LLDYHNQVRSKVF-------PPAANMEYMVWDERLAKSAESWANQCKWDHGP------NQLMRYIGQNLSVHSGRYRSIVDLVKGWYDERQHYSFP 148          
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Match: pi15 (peptidase inhibitor 15 [Source:NCBI gene;Acc:100489915])

HSP 1 Score: 59.6918 bits (143), Expect = 2.737e-11
Identity = 38/95 (40.00%), Postives = 54/95 (56.84%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD-YKDVVQ---GWYDEFKDYTYE 358
            +++ HN +R  V        P AANM  MVWD++LA+ AE+WA++CI  H       L KF+  GQN+   +  YK ++Q    WYDE KDY + 
Sbjct:   70 IVEYHNQVRGKVF-------PPAANMEYMVWDENLAKLAEAWAATCIWDH---GPSYLLKFL--GQNLSVRTGRYKSILQLVKPWYDEVKDYAFP 152          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1l3 (GLI pathogenesis-related 1 like 3 [Source:MGI Symbol;Acc:MGI:3620621])

HSP 1 Score: 67.0106 bits (162), Expect = 3.482e-14
Identity = 34/102 (33.33%), Postives = 57/102 (55.88%), Query Frame = 2
Query:   68 SEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRE---LDKFMFVGQNMFAG---SDYKDVVQGWYDEFKDYTY 355
             ++ +  L  HN+LRR V       QP AA+M +++WD  LA+ A++W   C  GH+    ++   L  + F+G+N++ G   +  +DVV  WY+E  DY +
Sbjct:   39 PKFIDAFLNIHNELRRKV-------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCTSKQYGCLLDYDFIGENIYLGEIETQPEDVVNNWYNENTDYNF 133          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 60.8474 bits (146), Expect = 6.326e-12
Identity = 33/109 (30.28%), Postives = 59/109 (54.13%), Query Frame = 2
Query:   50 LTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRE---LDKFMFVGQNMFAG---SDYKDVVQGWYDEFKDYTYE 358
            + + T  ++ +  L  HN+LRR V       QP AA+M ++ WD  LA+ A++W   C   H+    +    L+ + F+G+N++ G   +  +DVV  WY+E K + ++
Sbjct:   33 VPTITDPKFIDAFLNIHNELRRKV-------QPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDFIGENIYLGRIETQPEDVVINWYNESKYFNFD 134          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 59.6918 bits (143), Expect = 8.762e-12
Identity = 27/93 (29.03%), Postives = 53/93 (56.99%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD---YKDVVQGWYDEFKDYTY 355
            ++  HN+LRR+V        P  +++++M W       A+ WA+ CI  H + +DR+++  +  G+N++  +D   +  V+Q WY+E +D+ Y
Sbjct:   41 IVNKHNELRRSV-------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKIN--IRCGENLYMSTDPTLWSTVIQSWYNENEDFVY 124          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 59.6918 bits (143), Expect = 9.278e-12
Identity = 27/93 (29.03%), Postives = 53/93 (56.99%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD---YKDVVQGWYDEFKDYTY 355
            ++  HN+LRR+V        P  +++++M W       A+ WA+ CI  H + +DR+++  +  G+N++  +D   +  V+Q WY+E +D+ Y
Sbjct:   41 IVNKHNELRRSV-------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKIN--IRCGENLYMSTDPTLWSTVIQSWYNENEDFVY 124          
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Match: Crisp2 (cysteine-rich secretory protein 2 [Source:MGI Symbol;Acc:MGI:98815])

HSP 1 Score: 60.4622 bits (145), Expect = 1.138e-11
Identity = 27/93 (29.03%), Postives = 53/93 (56.99%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD---YKDVVQGWYDEFKDYTY 355
            ++  HN+LRR+V        P  +++++M W       A+ WA+ CI  H + +DR+++  +  G+N++  +D   +  V+Q WY+E +D+ Y
Sbjct:   41 IVNKHNELRRSV-------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKIN--IRCGENLYMSTDPTLWSTVIQSWYNENEDFVY 124          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPU2|VA543_SCODE (Scoloptoxin SSD43 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.173e-18
Identity = 45/125 (36.00%), Postives = 66/125 (52.80%), Query Frame = 2
Query:   23 FFVYGITLTLTS--------CTPSE------YKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS---DYKDVVQGWYDEFKD 346
            F +YG+ + LTS        C  SE       K  +LK HN+LR+ VA G    QP A+NM ++ W+D+LA  A+  A  CI  H +   R+  K+   G++M+AG+     K  V  WY+E +D
Sbjct:    3 FVIYGVIVVLTSQLYVDGWGCQMSERGLDKKMKNKILKHHNELRQKVANGQERGQPTASNMKQLRWNDELAANAQRAAERCIFQHTSDEGRKTTKYGVAGESMYAGTFSNPLKTAVDMWYEEVRD 127          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPU1|VA576_SCODE (Scoloptoxin SSD976 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.991e-16
Identity = 42/123 (34.15%), Postives = 65/123 (52.85%), Query Frame = 2
Query:   14 LFCFFVYGITLTLTSC------TPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKD----VVQGWYDEFKDYT 352
            LF   ++ I  +   C        +  K+ +L  HN  R+ VA G    QP+AANM E+ W+D++A  A+  A +C+  H   + R+  K+ ++G+N++ GS Y D     V  WYDE KD T
Sbjct:    9 LFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGS-YPDPIPRSVNAWYDEVKDVT 130          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|P0DPV2|VA558_SCODE (Scoloptoxin SSD558 OS=Scolopendra dehaani OX=2609776 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.383e-16
Identity = 42/123 (34.15%), Postives = 65/123 (52.85%), Query Frame = 2
Query:   14 LFCFFVYGITLTLTSC------TPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDV----VQGWYDEFKDYT 352
            LF   ++ I  +   C        +  K+ +L  HN  R+ VA G    QP+AANM E+ W+D++A  A+  A +C+  H   + R+  K+ ++G+N++ GS Y D     V  WYDE KD T
Sbjct:    9 LFVLLMFQIIGSGMGCDMKVRGLDANMKKMILDLHNKKRQIVANGQQSGQPSAANMKELHWNDEIAANAQRSAETCVFEHTAKSLRKTTKYSYLGENIYKGS-YPDPIPRSVNAWYDEVKDVT 130          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|O19010|CRIS3_HORSE (Cysteine-rich secretory protein 3 OS=Equus caballus OX=9796 GN=CRISP3 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 8.923e-16
Identity = 38/103 (36.89%), Postives = 57/103 (55.34%), Query Frame = 2
Query:   56 SCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS---DYKDVVQGWYDEFKDYTY 355
            S T SE ++ ++  HNDLRR V+       P A+NM++M WD   A  A++WA+ C+  H    DR +   M  G+N+F  S    + D +Q W+DE  D+ Y
Sbjct:   31 SITKSEVQKEIVNKHNDLRRTVS-------PLASNMLKMQWDSKTATNAQNWANKCLLQHSKAEDRAVGT-MKCGENLFMSSIPNSWSDAIQNWHDEVHDFKY 125          
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Match: sp|W4VS53|CRVP_TRILK (CRISP/Allergen/PR-1 OS=Trittame loki OX=1295018 PE=1 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 3.484e-15
Identity = 43/123 (34.96%), Postives = 62/123 (50.41%), Query Frame = 2
Query:   11 YLFCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTP--NQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNM--------FAGSDYKDVVQGWYDEFKDY 349
            + +C         LT    S  KE +L+ HN LR  VA G     + P A++M+++VWDD+LA  A+  A  C+  HD  + R +  F  VGQN+        F+   +   V GWYDE KD+
Sbjct:   32 HTYCLHPNSTCKILTRGVSSGDKEIILREHNKLRSRVATGKETKYSLPKASDMMQLVWDDELASVAQKHADQCVFEHDCNDCRNVQNFG-VGQNLHLRTSSAKFSDITWAGAVNGWYDEVKDF 153          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1C9ZZV5 (SCP domain-containing protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.067e-63
Identity = 91/119 (76.47%), Postives = 104/119 (87.39%), Query Frame = 2
Query:    5 MKYLFCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 361
            M++L C  +  I++ L  CTP EYK+FLLKAHNDLRR++ALG TPNQPAAANMIEMVWDD LA KAE WA  CIAGHDTY+DR+LDKFMFVGQNMFAGS+YK+VVQGWYDE+KDYTYEG
Sbjct:    7 MQFLLCGIISFISIALIFCTPPEYKDFLLKAHNDLRRDIALGKTPNQPAAANMIEMVWDDALAGKAEEWAGKCIAGHDTYDDRQLDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEG 125          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A4S2M3Q0 (SCP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004183 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 3.568e-22
Identity = 42/90 (46.67%), Postives = 56/90 (62.22%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTY 355
             +K H+  R  +  G  P QP A NM  +VWDD+LAEKA+ WA+ C AGHD+ +DR+  KF  VGQN   G D +     W+DE+K+Y Y
Sbjct:   30 FVKLHDQGRVRLQKGEVPGQPCARNMPPVVWDDELAEKAQKWAAKCQAGHDSSSDRKTHKFPLVGQNWAGGYDLQGAFNAWFDEYKNYDY 119          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A4S2LXG1 (SCP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004183 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.724e-22
Identity = 42/90 (46.67%), Postives = 56/90 (62.22%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTY 355
             +K H+  R  +  G  P QP A NM  +VWDD+LAEKA+ WA+ C AGHD+ +DR+  KF  VGQN   G D +     W+DE+K+Y Y
Sbjct:    9 FVKLHDQGRVRLQKGEVPGQPCARNMPPVVWDDELAEKAQKWAAKCQAGHDSSSDRKTHKFPLVGQNWAGGYDLQGAFNAWFDEYKNYDY 98          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A1I8HU24 (SCP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002706g1 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.882e-20
Identity = 44/95 (46.32%), Postives = 53/95 (55.79%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG--SDYKDVVQGWYDEFKDYTY 355
            K   LK HN LR   A GHT  QP+A+NM E+VWDD L   A  W   C  GHD   DR L  F +VGQN   G   D+   V+ W++E+K Y Y
Sbjct:   29 KMAFLKEHNRLRAQTAKGHTRGQPSASNMAELVWDDRLMRSANRWVRKCRVGHDRARDRRLPGFSWVGQNWAGGHSRDFTRYVRMWFNEYKYYNY 123          
BLAST of SCP domain-containing protein vs. TrEMBL
Match: A0A5B9CUI5 (Venom allergen OS=Scolopendra subspinipes OX=55038 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 2.267e-20
Identity = 56/134 (41.79%), Postives = 71/134 (52.99%), Query Frame = 2
Query:    5 MKYLFCFF-VYGIT-LTLTSC-------TPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS----------DYKDVVQGWYDEFKDY 349
            +K   CFF +Y +    + SC       T +E  E LL  HN LR  VA G    QP+AANM E+VWDD LA KA+ W S C  GHDTY  R+  K+  VGQN ++ S          +    VQ WY+E KD+
Sbjct:    3 IKVFLCFFFLYQLNKCNVESCDAINSGLTETEKAE-LLDVHNKLRAKVANGQQDGQPSAANMKELVWDDALAAKAQEWTSECKPGHDTYEARKTSKYAVVGQNCYSYSSSGKGSDKKIEMSKPVQAWYNEVKDF 135          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042591.1 (GLI pathogenesis related 1 [Source:NCBI gene;Acc:111193446])

HSP 1 Score: 65.0846 bits (157), Expect = 1.847e-13
Identity = 36/92 (39.13%), Postives = 51/92 (55.43%), Query Frame = 2
Query:   98 HNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTY---NDRELDKFMFVGQNMFAGSDY--KDVVQGWYDEFKDYTYE 358
            HN  R NV       QPAA+NM  M WD+ LA  A +WA  C+  H+T+     R    F  VG+N++AG+ +  +  ++ W DE KDY+Y 
Sbjct:   38 HNQHRANV-------QPAASNMRYMTWDEGLAVTARAWARKCLFIHNTHLKEEGRVHPVFSSVGENLWAGTHFSVQGAIKSWADEVKDYSYS 122          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 65.0846 bits (157), Expect = 2.016e-13
Identity = 37/95 (38.95%), Postives = 53/95 (55.79%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD-YKDVVQ---GWYDEFKDYTYE 358
            +L+ HN +R  V        P A+NM  MVWDD LA++AE WAS+C+  H   N        F+GQN+   +  Y+ ++Q    WYDE KDY++ 
Sbjct:   78 ILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRN-----LLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFP 160          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: pi15a (peptidase inhibitor 15-A-like [Source:NCBI gene;Acc:103031459])

HSP 1 Score: 65.0846 bits (157), Expect = 2.162e-13
Identity = 37/95 (38.95%), Postives = 53/95 (55.79%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD-YKDVVQ---GWYDEFKDYTYE 358
            +L+ HN +R  V        P A+NM  MVWDD LA++AE WAS+C+  H   N        F+GQN+   +  Y+ ++Q    WYDE KDY++ 
Sbjct:   71 ILQYHNKVRGKVF-------PPASNMEYMVWDDSLAKRAEEWASTCLWEHGPRN-----LLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFP 153          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: crispld2 (cysteine-rich secretory protein LCCL domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-130131-1])

HSP 1 Score: 62.7734 bits (151), Expect = 2.195e-12
Identity = 39/99 (39.39%), Postives = 46/99 (46.46%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNM------FAGSDYKDVVQGWYDEFKDYTY 355
            +E +L  HN LR  V        P A+NM  MVWDD+L   A  WA  C   H        D  M +GQN+      +    Y   VQ WYDE KDYTY
Sbjct:   61 REEILALHNKLREGV-------YPTASNMEYMVWDDELERSATHWAEQCQWEHGPQ-----DLLMSIGQNLAVHWGRYRSPAYH--VQAWYDEVKDYTY 145          
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030308.1 (glioma pathogenesis-related protein 1-like [Source:NCBI gene;Acc:103030109])

HSP 1 Score: 60.4622 bits (145), Expect = 6.357e-12
Identity = 38/115 (33.04%), Postives = 54/115 (46.96%), Query Frame = 2
Query:   38 ITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDT---YNDRELDKFMFVGQNMFAGSDY-----KDVVQGWYDEFKDYTYE 358
            + L L   T  ++    ++AHN  R   +       P AANM  M WDD LA+ A SWA  C A H+    +  +    F  VG+N++ GS Y     +  +Q W  E  DYT+ 
Sbjct:   22 LALVLPDITEPDFIRRCVQAHNAHRSRAS-------PHAANMRLMTWDDALAKGARSWARHCKASHNPILQHMGQAHPDFRRVGENIWLGSPYSAFTVESAIQTWNQEGADYTHR 129          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 56.6102 bits (135), Expect = 4.542e-11
Identity = 30/91 (32.97%), Postives = 49/91 (53.85%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS---DYKDVVQGWYDEF 340
            + F++  HNDLRRNV        P+A NM++M+W  +    A SWA++C  GH     R+  ++   G+N+F  S    +   ++ WY+E 
Sbjct:   44 QTFIVDLHNDLRRNVT-------PSAGNMLQMMWKKEAYLNALSWANNCTFGHSPDARRKTTQWT-CGENIFMSSAPFTWNYAIRDWYNEV 126          
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000374.1 (pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 gene:ENSPMAG00000000334.1 transcript:ENSPMAT00000000374.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 7.771e-10
Identity = 35/94 (37.23%), Postives = 47/94 (50.00%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNM--FAGSDYKDV--VQGWYDEFKDYTY 355
            L + HN LR +V        P AA+M  M WD +LA  AE+WA  C  GH        D+   +GQN+  + GS+      VQ W+DE + Y Y
Sbjct:    9 LTEYHNRLRASV-------HPQAADMEHMSWDWELAGMAEAWAKQCKWGHGPS-----DQLDAIGQNLAVYVGSERPLAYHVQAWFDEEEWYQY 90          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld2 (cysteine rich secretory protein LCCL domain containing 2 [Source:NCBI gene;Acc:101174090])

HSP 1 Score: 65.0846 bits (157), Expect = 3.231e-13
Identity = 40/97 (41.24%), Postives = 48/97 (49.48%), Query Frame = 2
Query:   77 KEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            +E +L  HN LR +V        P+AANM  MVWDD+L   A  WA  C   H        D  M +GQN+      Y+     VQ WYDE KDYTY
Sbjct:   76 REEILLLHNKLRSSV-------YPSAANMEHMVWDDELERSATQWAEECRWEHGPQ-----DLLMSIGQNLAVHWGRYRSPAFHVQAWYDEVKDYTY 160          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: pi15a (peptidase inhibitor 15 [Source:NCBI gene;Acc:101173911])

HSP 1 Score: 56.225 bits (134), Expect = 3.169e-10
Identity = 34/95 (35.79%), Postives = 50/95 (52.63%), Query Frame = 2
Query:   86 LLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSD-YKDVVQ---GWYDEFKDYTYE 358
            +L  HN +R  V        P A+NM  MVWD+ LA+ AE WA +C+  H   +        F+GQN+   +  Y+ ++Q    WYDE KDY++ 
Sbjct:   69 ILDYHNKVRGKVF-------PPASNMEYMVWDETLAKTAEDWAHACLWEHGPSH-----LLRFLGQNLSVRTGRYRSILQLVKPWYDEVKDYSFP 151          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000023160.2 (peptidase inhibitor 16 [Source:NCBI gene;Acc:101164782])

HSP 1 Score: 55.0694 bits (131), Expect = 1.279e-9
Identity = 35/99 (35.35%), Postives = 55/99 (55.56%), Query Frame = 2
Query:   71 EYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS---DYKDVVQGWYDEFKDYTYE 358
            + +E L++ HN  R  V+       P+AA M+ + WD +L   AE +A+ CI  H+T    EL+     G+N+FAG+   D  + V+ W+ E  DY+YE
Sbjct:   60 QQEEMLVELHNHYRGQVS-------PSAAAMLPLKWDGNLKLVAEGYAAKCIWEHNT----ELED---TGENLFAGTGKLDLSEAVEKWFLERLDYSYE 144          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 53.9138 bits (128), Expect = 2.602e-9
Identity = 34/96 (35.42%), Postives = 47/96 (48.96%), Query Frame = 2
Query:   80 EFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            + +L  HN LR  V        P A+NM  M+WD +L   AE WA +C+  H   +         +GQN+ A    Y+     VQ WYDE KDY++
Sbjct:   90 QLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHGPAS-----LLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSF 173          
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Match: crispld1a (cysteine rich secretory protein LCCL domain containing 1 [Source:NCBI gene;Acc:101172850])

HSP 1 Score: 53.9138 bits (128), Expect = 2.874e-9
Identity = 34/96 (35.42%), Postives = 47/96 (48.96%), Query Frame = 2
Query:   80 EFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAG-SDYKDV---VQGWYDEFKDYTY 355
            + +L  HN LR  V        P A+NM  M+WD +L   AE WA +C+  H   +         +GQN+ A    Y+     VQ WYDE KDY++
Sbjct:   62 QLILDLHNKLRGQV-------YPPASNMEYMMWDTELERSAEEWAETCLWEHGPAS-----LLPQIGQNLGAHWGRYQPPTFHVQAWYDEVKDYSF 145          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 251.521 bits (641), Expect = 2.174e-86
Identity = 118/119 (99.16%), Postives = 118/119 (99.16%), Query Frame = 2
Query:    5 MKYLFCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 361
            MKYLFC FVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG
Sbjct:    1 MKYLFCLFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 119          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036363.1 (SMESG000036363.1)

HSP 1 Score: 198.749 bits (504), Expect = 1.311e-65
Identity = 92/119 (77.31%), Postives = 100/119 (84.03%), Query Frame = 2
Query:    5 MKYLFCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 361
            MK LFC  +  +  TL   TP EYKEFLLKAHNDLRR +ALG TPNQPAAANMIEMVWDD LA K+E WA  CIAGHDTY+DR LDKFMFVGQNMFAGS+YK+VVQGWYDE+KDYTYEG
Sbjct:    1 MKLLFCGVISCLLATLAVGTPPEYKEFLLKAHNDLRRQIALGKTPNQPAAANMIEMVWDDALAGKSEEWAGKCIAGHDTYDDRALDKFMFVGQNMFAGSNYKEVVQGWYDEYKDYTYEG 119          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.305e-44
Identity = 67/67 (100.00%), Postives = 67/67 (100.00%), Query Frame = 2
Query:  161 MIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 361
            MIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG
Sbjct:    1 MIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 67          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000036385.1 (SMESG000036385.1)

HSP 1 Score: 137.502 bits (345), Expect = 3.247e-42
Identity = 64/64 (100.00%), Postives = 64/64 (100.00%), Query Frame = 2
Query:  170 MVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 361
            MVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG
Sbjct:    1 MVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYEG 64          
BLAST of SCP domain-containing protein vs. Planmine SMEST
Match: SMESG000024103.1 (SMESG000024103.1)

HSP 1 Score: 107.842 bits (268), Expect = 2.888e-30
Identity = 47/97 (48.45%), Postives = 66/97 (68.04%), Query Frame = 2
Query:   68 SEYKEFLLKAHNDLRRNVALGHTPNQPAAANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGSDYKDVVQGWYDEFKDYTYE 358
            S+ ++  L AHN  RR VA G  PNQP AA+M+EMVW+D+LA  AE WA+ C+ GHD+  +R+   F   GQN++AG + KD  + W++E  DYTY+
Sbjct:   21 SDLRDDFLMAHNKFRRQVAQGKVPNQPVAADMMEMVWNDELAATAEKWANRCVFGHDSDENRQTKSFPITGQNIYAGWEPKDATELWFNEHTDYTYK 117          
The following BLAST results are available for this feature:
BLAST of SCP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRISPLD21.228e-1442.57cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD21.277e-1442.57cysteine rich secretory protein LCCL domain contai... [more]
CRISPLD21.632e-1442.57cysteine rich secretory protein LCCL domain contai... [more]
CRISP21.172e-1129.59cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP21.172e-1129.59cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scl-101.607e-930.61SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-128.484e-928.24SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-82.896e-732.86SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-155.080e-728.00SCP-Like extracellular protein [Source:UniProtKB/... [more]
scl-57.946e-726.19SCP-Like extracellular protein [Source:UniProtKB/... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG84837.774e-1834.82gene:FBgn0038126 transcript:FBtr0082782[more]
CG427803.966e-934.23gene:FBgn0261848 transcript:FBtr0303416[more]
CG427804.027e-934.23gene:FBgn0261848 transcript:FBtr0339817[more]
Ag5r21.404e-733.98gene:FBgn0020508 transcript:FBtr0073938[more]
CG326795.631e-730.61gene:FBgn0052679 transcript:FBtr0071469[more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld22.691e-1340.40cysteine-rich secretory protein LCCL domain contai... [more]
CABZ01068499.12.655e-1232.32cysteine-rich venom protein natrin-1-like [Source:... [more]
pi15a4.018e-1238.95peptidase inhibitor 15a [Source:NCBI gene;Acc:5619... [more]
pi15b2.434e-1136.84peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
pi15b2.556e-1136.84peptidase inhibitor 15b [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld27.179e-1340.21cysteine-rich secretory protein LCCL domain contai... [more]
crispld27.841e-1340.21cysteine-rich secretory protein LCCL domain contai... [more]
crispld28.758e-1340.21cysteine-rich secretory protein LCCL domain contai... [more]
R3HDML2.724e-1138.54R3H domain containing-like [Source:NCBI gene;Acc:1... [more]
pi152.737e-1140.00peptidase inhibitor 15 [Source:NCBI gene;Acc:10048... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr1l33.482e-1433.33GLI pathogenesis-related 1 like 3 [Source:MGI Symb... [more]
Glipr1l16.326e-1230.28GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Crisp28.762e-1229.03cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
Crisp29.278e-1229.03cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
Crisp21.138e-1129.03cysteine-rich secretory protein 2 [Source:MGI Symb... [more]
back to top
BLAST of SCP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DPU2|VA543_SCODE2.173e-1836.00Scoloptoxin SSD43 OS=Scolopendra dehaani OX=260977... [more]
sp|P0DPU1|VA576_SCODE1.991e-1634.15Scoloptoxin SSD976 OS=Scolopendra dehaani OX=26097... [more]
sp|P0DPV2|VA558_SCODE2.383e-1634.15Scoloptoxin SSD558 OS=Scolopendra dehaani OX=26097... [more]
sp|O19010|CRIS3_HORSE8.923e-1636.89Cysteine-rich secretory protein 3 OS=Equus caballu... [more]
sp|W4VS53|CRVP_TRILK3.484e-1534.96CRISP/Allergen/PR-1 OS=Trittame loki OX=1295018 PE... [more]
back to top
BLAST of SCP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1C9ZZV52.067e-6376.47SCP domain-containing protein (Fragment) OS=Dugesi... [more]
A0A4S2M3Q03.568e-2246.67SCP domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LXG13.724e-2246.67SCP domain-containing protein OS=Opisthorchis feli... [more]
A0A1I8HU241.882e-2046.32SCP domain-containing protein OS=Macrostomum ligna... [more]
A0A5B9CUI52.267e-2041.79Venom allergen OS=Scolopendra subspinipes OX=55038... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042591.11.847e-1339.13GLI pathogenesis related 1 [Source:NCBI gene;Acc:1... [more]
pi15a2.016e-1338.95peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
pi15a2.162e-1338.95peptidase inhibitor 15-A-like [Source:NCBI gene;Ac... [more]
crispld22.195e-1239.39cysteine-rich secretory protein LCCL domain contai... [more]
ENSAMXT00000030308.16.357e-1233.04glioma pathogenesis-related protein 1-like [Source... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CRISP34.542e-1132.97cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
ENSPMAT00000000374.17.771e-1037.23pep scaffold:Pmarinus_7.0:GL476650:75849:87118:-1 ... [more]
back to top
BLAST of SCP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crispld23.231e-1341.24cysteine rich secretory protein LCCL domain contai... [more]
pi15a3.169e-1035.79peptidase inhibitor 15 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000023160.21.279e-935.35peptidase inhibitor 16 [Source:NCBI gene;Acc:10116... [more]
crispld1a2.602e-935.42cysteine rich secretory protein LCCL domain contai... [more]
crispld1a2.874e-935.42cysteine rich secretory protein LCCL domain contai... [more]
back to top
BLAST of SCP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036385.12.174e-8699.16SMESG000036385.1[more]
SMESG000036363.11.311e-6577.31SMESG000036363.1[more]
SMESG000036385.11.305e-44100.00SMESG000036385.1[more]
SMESG000036385.13.247e-42100.00SMESG000036385.1[more]
SMESG000024103.12.888e-3048.45SMESG000024103.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010795 ID=SMED30010795|Name=SCP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=363bp
GAAAATGAAATATTTATTTTGTTTTTTTGTATACGGAATTACATTAACCT
TGACATCATGTACTCCTTCAGAATACAAAGAATTTTTACTCAAAGCTCAT
AATGATTTAAGACGAAACGTTGCTCTCGGGCATACCCCTAATCAACCGGC
CGCAGCAAACATGATTGAGATGGTTTGGGACGATGATTTGGCTGAAAAAG
CTGAAAGCTGGGCTAGTTCGTGCATTGCTGGACACGATACATATAATGAT
AGAGAATTAGATAAATTTATGTTCGTTGGTCAAAATATGTTTGCTGGTTC
AGATTACAAAGATGTCGTTCAAGGATGGTATGATGAATTTAAAGATTACA
CATATGAAGGTAA
back to top

protein sequence of SMED30010795-orf-1

>SMED30010795-orf-1 ID=SMED30010795-orf-1|Name=SMED30010795-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=120bp
KMKYLFCFFVYGITLTLTSCTPSEYKEFLLKAHNDLRRNVALGHTPNQPA
AANMIEMVWDDDLAEKAESWASSCIAGHDTYNDRELDKFMFVGQNMFAGS
DYKDVVQGWYDEFKDYTYEG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR001283CRISP-related
IPR014044CAP_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014044CAP domainSMARTSM00198SCP_3coord: 24..120
e-value: 1.4E-8
score: 32.0
IPR014044CAP domainPFAMPF00188CAPcoord: 30..119
e-value: 4.5E-11
score: 43.7
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 21..120
e-value: 2.3E-28
score: 101.2
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 5..119
NoneNo IPR availablePANTHERPTHR10334:SF344AT27079P-RELATEDcoord: 23..119
NoneNo IPR availableCDDcd05380CAP_eukcoord: 26..119
e-value: 4.55174E-28
score: 97.9103
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.676
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 23..119