Protein kinase

Overview
NameProtein kinase
Smed IDSMED30010792
Length (bp)1541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase (SMED30010792) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase (SMED30010792) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase (SMED30010792) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase (SMED30010792) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010792

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6032uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6032newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010792SMESG000074416.1 SMESG000074407.1 Contig1629GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30010792SMESG000074416.1 SMESG000074407.1 Contig1629GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior region of the whole animalSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig3811uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig3811newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6176newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6176uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000071859.1 SMESG000020398.1 Contig3811uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000071859.1 SMESG000020398.1 Contig3811newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010792SMESG000074416.1 SMESG000074407.1 dd_Smed_v4_3361_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6032uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010792SMESG000074416.1 SMESG000074407.1 Contig6032newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30010792SMESG000074407.1 SMESG000074416.1 dd_Smed_v6_3361_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 78.5666 bits (192), Expect = 9.082e-16
Identity = 68/241 (28.22%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +       +   +      + L  L+FLH  QVIHRD+   NI L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:   15 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETC---MDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKEL 237          
BLAST of Protein kinase vs. Ensembl Human
Match: PAK2 (p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;Acc:HGNC:8591])

HSP 1 Score: 75.485 bits (184), Expect = 6.188e-15
Identity = 54/187 (28.88%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L  +  +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY
Sbjct:   15 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPY 186          
BLAST of Protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 77.7962 bits (190), Expect = 1.052e-14
Identity = 68/241 (28.22%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   NI L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  195 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKEL 417          
BLAST of Protein kinase vs. Ensembl Human
Match: PAK1 (p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;Acc:HGNC:8590])

HSP 1 Score: 77.7962 bits (190), Expect = 1.564e-14
Identity = 68/241 (28.22%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   NI L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  293 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKEL 515          
BLAST of Protein kinase vs. Ensembl Human
Match: PAK2 (p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;Acc:HGNC:8591])

HSP 1 Score: 77.411 bits (189), Expect = 1.644e-14
Identity = 66/241 (27.39%), Postives = 111/241 (46.06%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L  +  +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  272 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGSAKEL 494          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 79.337 bits (194), Expect = 3.080e-15
Identity = 57/190 (30.00%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  495 EYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ--VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKT-AASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN----YQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E M++G LK YLK  K  +++    + W  QIL GL FLH +   VIHRDL   NI++                   K+ A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE  N    Y+ VI+ +K +         I  +      +++ C++++ EER+ +  L
Sbjct:  415 ELMTSGTLKMYLKRFK--RINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPEC-----FSRIPAQYPEIREIIDRCIRVRREERSTVKQL 588          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 79.337 bits (194), Expect = 3.196e-15
Identity = 57/190 (30.00%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  495 EYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ--VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKT-AASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN----YQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E M++G LK YLK  K  +++    + W  QIL GL FLH +   VIHRDL   NI++                   K+ A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE  N    Y+ VI+ +K +         I  +      +++ C++++ EER+ +  L
Sbjct:  362 ELMTSGTLKMYLKRFK--RINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPEC-----FSRIPAQYPEIREIIDRCIRVRREERSTVKQL 535          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 79.337 bits (194), Expect = 3.218e-15
Identity = 57/190 (30.00%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  495 EYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ--VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKT-AASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN----YQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E M++G LK YLK  K  +++    + W  QIL GL FLH +   VIHRDL   NI++                   K+ A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE  N    Y+ VI+ +K +         I  +      +++ C++++ EER+ +  L
Sbjct:  415 ELMTSGTLKMYLKRFK--RINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPEC-----FSRIPAQYPEIREIIDRCIRVRREERSTVKQL 588          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 79.337 bits (194), Expect = 3.358e-15
Identity = 57/190 (30.00%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  495 EYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ--VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKT-AASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN----YQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E M++G LK YLK  K  +++    + W  QIL GL FLH +   VIHRDL   NI++                   K+ A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE  N    Y+ VI+ +K +         I  +      +++ C++++ EER+ +  L
Sbjct:  415 ELMTSGTLKMYLKRFK--RINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPEC-----FSRIPAQYPEIREIIDRCIRVRREERSTVKQL 588          
BLAST of Protein kinase vs. Ensembl Celegans
Match: wnk-1 (Serine/threonine-protein kinase WNK [Source:UniProtKB/Swiss-Prot;Acc:X5M5N0])

HSP 1 Score: 79.337 bits (194), Expect = 3.361e-15
Identity = 57/190 (30.00%), Postives = 93/190 (48.95%), Query Frame = 3
Query:  495 EYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ--VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKT-AASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN----YQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E M++G LK YLK  K  +++    + W  QIL GL FLH +   VIHRDL   NI++                   K+ A SV+G           +MAPE+   + Y +  D+++FG  L+ ++TG+ PYSE  N    Y+ VI+ +K +         I  +      +++ C++++ EER+ +  L
Sbjct:  417 ELMTSGTLKMYLKRFK--RINIKVLKSWCRQILKGLSFLHTRNPPVIHRDLKCDNIFITGTTGSVKIGDLGLATLKNKSFAKSVIGTP--------EFMAPEMYE-EMYDESVDVYAFGMCLLEMVTGEYPYSECMNPATIYRKVISGVKPEC-----FSRIPAQYPEIREIIDRCIRVRREERSTVKQL 590          
BLAST of Protein kinase vs. Ensembl Fly
Match: slpr (gene:FBgn0030018 transcript:FBtr0071184)

HSP 1 Score: 78.1814 bits (191), Expect = 7.968e-15
Identity = 61/249 (24.50%), Postives = 107/249 (42.97%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQ---QVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            GE + +KI + ++   D  +  + +L E K F   K     +       + + LC+ MEY   G L   L      K+ P     W+ QI  G+ +LH++    +IHRDL  SN+ + E ++         K      A  +   + +     Y +M PE++S   Y +  D+WS+G +L  +ITG+ PY  +D       +    +T+       E     +  L+ SC +  P +R     +  Q++
Sbjct:  150 GEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALKHEN--IAALRGVCLNTKLCLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPET----WGALMKSCWQTDPHKRPGFKEILKQLE 387          
BLAST of Protein kinase vs. Ensembl Fly
Match: slpr (gene:FBgn0030018 transcript:FBtr0303844)

HSP 1 Score: 78.1814 bits (191), Expect = 7.968e-15
Identity = 61/249 (24.50%), Postives = 107/249 (42.97%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQ---QVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            GE + +KI + ++   D  +  + +L E K F   K     +       + + LC+ MEY   G L   L      K+ P     W+ QI  G+ +LH++    +IHRDL  SN+ + E ++         K      A  +   + +     Y +M PE++S   Y +  D+WS+G +L  +ITG+ PY  +D       +    +T+       E     +  L+ SC +  P +R     +  Q++
Sbjct:  150 GEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALKHEN--IAALRGVCLNTKLCLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPET----WGALMKSCWQTDPHKRPGFKEILKQLE 387          
BLAST of Protein kinase vs. Ensembl Fly
Match: slpr (gene:FBgn0030018 transcript:FBtr0303843)

HSP 1 Score: 78.1814 bits (191), Expect = 7.968e-15
Identity = 61/249 (24.50%), Postives = 107/249 (42.97%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQ---QVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            GE + +KI + ++   D  +  + +L E K F   K     +       + + LC+ MEY   G L   L      K+ P     W+ QI  G+ +LH++    +IHRDL  SN+ + E ++         K      A  +   + +     Y +M PE++S   Y +  D+WS+G +L  +ITG+ PY  +D       +    +T+       E     +  L+ SC +  P +R     +  Q++
Sbjct:  150 GEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALKHEN--IAALRGVCLNTKLCLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPET----WGALMKSCWQTDPHKRPGFKEILKQLE 387          
BLAST of Protein kinase vs. Ensembl Fly
Match: slpr (gene:FBgn0030018 transcript:FBtr0303842)

HSP 1 Score: 78.1814 bits (191), Expect = 8.196e-15
Identity = 61/249 (24.50%), Postives = 107/249 (42.97%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQ---QVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            GE + +KI + ++   D  +  + +L E K F   K     +       + + LC+ MEY   G L   L      K+ P     W+ QI  G+ +LH++    +IHRDL  SN+ + E ++         K      A  +   + +     Y +M PE++S   Y +  D+WS+G +L  +ITG+ PY  +D       +    +T+       E     +  L+ SC +  P +R     +  Q++
Sbjct:  150 GEEVAIKI-AHQTGEDDMQRMRDNVLQEAKLFWALKHEN--IAALRGVCLNTKLCLVMEYARGGSLNRILAG----KIPPDVLVNWAIQIARGMNYLHNEAPMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGLAREMYNTQRMSAAGTYAWMPPEVISVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAYGVAVNTLTLPIPKTCPET----WGALMKSCWQTDPHKRPGFKEILKQLE 387          
BLAST of Protein kinase vs. Ensembl Fly
Match: Mekk1 (gene:FBgn0024329 transcript:FBtr0331353)

HSP 1 Score: 73.9442 bits (180), Expect = 2.195e-13
Identity = 66/256 (25.78%), Postives = 122/256 (47.66%), Query Frame = 3
Query:  273 ISQNKIFKLYQT-QNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILS---CDKYGQECDIWSFGAVLIRIITGKRPYSEYD-NYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEER 1025
            I Q +  K+Y    N  GE + +K  +++       K    +  ELK  +  K ++  V+          L + ME  S G L++ ++   N  +     R+++ Q+L G+  LH   ++HRD+  +NI+L +  +        S  ++ +   +V G+   Y   +  YMAPE+ +    D +G+  DIWS G V++ + +GKRP++++D N+Q     I  KV +    +  E+  Q     ++ CL+  P+ R
Sbjct: 1195 IGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKN---VAEELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGN--LPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKI-QAHTTVPGELQGYVGTQA-YMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQ-----IMFKVGMGEKPQAPESLSQEGHDFIDHCLQHDPKRR 1437          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 77.7962 bits (190), Expect = 8.841e-15
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 482          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 77.7962 bits (190), Expect = 8.841e-15
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 482          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 77.7962 bits (190), Expect = 8.841e-15
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  265 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 482          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 77.7962 bits (190), Expect = 8.864e-15
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  266 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 483          
BLAST of Protein kinase vs. Ensembl Zebrafish
Match: map3k10 (mitogen-activated protein kinase kinase kinase 10 [Source:ZFIN;Acc:ZDB-GENE-050419-112])

HSP 1 Score: 78.5666 bits (192), Expect = 9.091e-15
Identity = 58/212 (27.36%), Postives = 90/212 (42.45%), Query Frame = 3
Query:  432 NRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ---VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            +R  + L        +LC+ MEY   G L   L  +K   V P     W+ QI  G+ +LH+Q    +IHRDL  SNI + E ++    S    K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F  L+  C    P  R    S+  +++
Sbjct:  144 HRNIIALRGVCLREPNLCLVMEYARGGALNRALAGKK---VPPRVLVNWAVQIATGMDYLHNQTFVPIIHRDLKSSNILILEPVERDDLSGKTLKITDFGLAREWHRTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEA----FAQLLGECWCPNPRGRPAFGSILKRLE 348          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 77.411 bits (189), Expect = 1.351e-14
Identity = 65/241 (26.97%), Postives = 111/241 (46.06%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K +   V   D++ +G  L V MEY++ G L   +     Q+    E      + L  L+FLH  QVIHRD+   NI L     +KL+         P+       K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +N    + +I    T +  +++ E +   F   ++ CL++  E+R     L
Sbjct:  188 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-HPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQE---GEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPE-----QNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDL 410          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 77.0258 bits (188), Expect = 1.963e-14
Identity = 65/241 (26.97%), Postives = 111/241 (46.06%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K +   V   D++ +G  L V MEY++ G L   +     Q+    E      + L  L+FLH  QVIHRD+   NI L     +KL+         P+       K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +N    + +I    T +  +++ E +   F   ++ CL++  E+R     L
Sbjct:  269 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-HPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQE---GEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPE-----QNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDL 491          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: ints7 (integrator complex subunit 7 [Source:Xenbase;Acc:XB-GENE-952192])

HSP 1 Score: 77.411 bits (189), Expect = 2.745e-14
Identity = 63/248 (25.40%), Postives = 101/248 (40.73%), Query Frame = 3
Query:  375 WKGDEFILNELKA-----FQTTKSNRR-----FVQLCDTFFMG--------SSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQV---IHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQI 1055
            W+GDE  +  ++         T  N R     F  LC    +           LC+ MEY   G L   L  +K   V  +    W+ QI  G+ +LH++ +   IHRDL  SNI + EK++     +   K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F+ ++ +C    P  R     +  Q+
Sbjct:  142 WRGDEVAVKAVRHDPDEDINVTAENVRQEAKLFCMLCHPNIIALKGVCLKPPHLCLVMEYARGGPLHRALAGKK---VPAHVLVNWAVQIARGMNYLHNEAIVPIIHRDLKSSNILILEKVEHDDLFNKTLKITDFGLAREWQKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEP----FVRILEACWDPDPHSRPSFSCILEQL 382          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: qsox2 (quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:XB-GENE-986398])

HSP 1 Score: 76.2554 bits (186), Expect = 3.104e-14
Identity = 61/219 (27.85%), Postives = 102/219 (46.58%), Query Frame = 3
Query:  387 EFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E I+NE+   +  K +   V   D++ +G  L V MEY++ G L   +     Q+    E      + L  L+FLH  QVIHRD+   NI L     +KL+         P+       K+S      Y +MAPE+++   YG + D+WS G + I ++ G+ PY   +N    + +I    T +  +++ E +   F   ++ CL++  E+R     L
Sbjct:  244 ELIINEILVMRENK-HPNIVNYLDSYLVGEELWVVMEYLAGGSLTDVVTETCMQE---GEIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGAVKLTDFGFCAQISPE-----QNKRSTMVGTPY-WMAPEVVTRKAYGPKVDVWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPQ--LQEPEKKSPAFRDFLSRCLEMDVEKRGSARDL 449          
BLAST of Protein kinase vs. Ensembl Xenopus
Match: ints7 (integrator complex subunit 7 [Source:Xenbase;Acc:XB-GENE-952192])

HSP 1 Score: 77.0258 bits (188), Expect = 3.440e-14
Identity = 63/248 (25.40%), Postives = 101/248 (40.73%), Query Frame = 3
Query:  375 WKGDEFILNELKA-----FQTTKSNRR-----FVQLCDTFFMG--------SSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQV---IHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQI 1055
            W+GDE  +  ++         T  N R     F  LC    +           LC+ MEY   G L   L  +K   V  +    W+ QI  G+ +LH++ +   IHRDL  SNI + EK++     +   K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F+ ++ +C    P  R     +  Q+
Sbjct:  113 WRGDEVAVKAVRHDPDEDINVTAENVRQEAKLFCMLCHPNIIALKGVCLKPPHLCLVMEYARGGPLHRALAGKK---VPAHVLVNWAVQIARGMNYLHNEAIVPIIHRDLKSSNILILEKVEHDDLFNKTLKITDFGLAREWQKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEP----FVRILEACWDPDPHSRPSFSCILEQL 353          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 77.411 bits (189), Expect = 1.255e-14
Identity = 66/241 (27.39%), Postives = 111/241 (46.06%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L  +  +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  272 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRGSAKEL 494          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 77.411 bits (189), Expect = 1.397e-14
Identity = 68/241 (28.22%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   NI L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKEL 514          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Pak1 (p21 (RAC1) activated kinase 1 [Source:MGI Symbol;Acc:MGI:1339975])

HSP 1 Score: 77.411 bits (189), Expect = 1.397e-14
Identity = 68/241 (28.22%), Postives = 110/241 (45.64%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D++ +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   NI L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I +I G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R     L
Sbjct:  292 GQEVAIKQMNLQQQPKK-----ELIINEILVMRENK-NPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDE---GQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSAIFRDFLNRCLEMDVEKRGSAKEL 514          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k10 (mitogen-activated protein kinase kinase kinase 10 [Source:MGI Symbol;Acc:MGI:1346879])

HSP 1 Score: 77.411 bits (189), Expect = 2.295e-14
Identity = 61/250 (24.40%), Postives = 105/250 (42.00%), Query Frame = 3
Query:  318 KGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ---VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            +GE + +K   L+   +D     E +  E + F   + +   + L        +LC+ MEY   G L   L  ++   V P+    W+ Q+  G+ +LH+     +IHRDL   NI + E ++    +  + K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F  L+  C    P  R    S+  Q++
Sbjct:  118 RGEEVAVKAARLDPE-RDPAVTAEQVRQEARLFGALQ-HPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRR---VPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEP----FARLLEECWDPDPHGRPDFGSILKQLE 358          
BLAST of Protein kinase vs. Ensembl Mouse
Match: Map3k10 (mitogen-activated protein kinase kinase kinase 10 [Source:MGI Symbol;Acc:MGI:1346879])

HSP 1 Score: 77.0258 bits (188), Expect = 2.313e-14
Identity = 61/250 (24.40%), Postives = 105/250 (42.00%), Query Frame = 3
Query:  318 KGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ---VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            +GE + +K   L+   +D     E +  E + F   + +   + L        +LC+ MEY   G L   L  ++   V P+    W+ Q+  G+ +LH+     +IHRDL   NI + E ++    +  + K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F  L+  C    P  R    S+  Q++
Sbjct:  118 RGEEVAVKAARLDPE-RDPAVTAEQVRQEARLFGALQ-HPNIIALRGACLSPPNLCLVMEYARGGALSRVLAGRR---VPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLADTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPIPSTCPEP----FARLLEECWDPDPHGRPDFGSILKQLE 358          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q5QN75|M2K1_ORYSJ (Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=MKK1 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.037e-15
Identity = 67/223 (30.04%), Postives = 107/223 (47.98%), Query Frame = 3
Query:  393 ILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLH-DQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY--SEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQ 1052
            I+ ELK  Q T+ N   V    +F+    + + +EYM  G L   +K  K   + PY       Q+L GL +LH ++ VIHRD+ PSN+ ++ K ++K++   +S        AS MG++  +    Y YMAPE +S   Y  + DIWS G V++    G+ PY  SE + +     +++  V         +     F   ++SC++  P ER     L N 
Sbjct:  114 IVQELKINQATQ-NAHIVLCHQSFYHNGVIYLVLEYMDRGSLADIIKQVKT-ILEPY-LAVLCKQVLEGLLYLHHERHVIHRDIKPSNLLVNRKGEVKITDFGVS-----AVLASSMGQRDTFVG-TYNYMAPERISGSSYDYKSDIWSLGLVILECAIGRFPYIPSEGEGWLSFYELLEAIVDQPPPSAPADQFSPEFCAFISSCIQKDPAERMSASELLNH 327          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q39008|M3K1_ARATH (Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana OX=3702 GN=MEKK1 PE=1 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 9.492e-15
Identity = 63/204 (30.88%), Postives = 101/204 (49.51%), Query Frame = 3
Query:  471 GSSLCVSMEYMSNG-MLKTYLKNQ-KNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYR-----YMAPEILS---CDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQ 1052
            GS+L + +E ++ G +LK Y + Q ++  VS Y     + QIL GLK+LHD+  IHRD+  +NI +D    +             K A   + K S + ++K       +MAPE+++    D YG   DIWS G  ++ + TG+ PYS+ +  Q +  + +G +    D   ++  L      +  CLK+ PEER     L N 
Sbjct:  404 GSNLYIFLELVTQGSLLKLYQRYQLRDSVVSLY-----TRQILDGLKYLHDKGFIHRDIKCANILVDANGAV-------------KLADFGLAKVSKFNDIKSCKGTPFWMAPEVINRKDSDGYGSPADIWSLGCTVLEMCTGQIPYSDLEPVQALFRIGRGTLPEVPDTLSLDARL-----FILKCLKVNPEERPTAAELLNH 584          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q54Y90|Y0133_DICDI (Probable serine/threonine-protein kinase DDB_G0278665 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278665 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.027e-14
Identity = 50/143 (34.97%), Postives = 74/143 (51.75%), Query Frame = 3
Query:  465 FMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYD 893
            F  S  C+ +EY+  G L  YL N  N   SP    K +  I  G+ FLH  +++H DL P N  +         S  L+ F L  +++      +V  +  + YM+PE+ +  K+ +  D+WS+GA LI I+T KRPY EYD
Sbjct:  252 FCVSPKCLVLEYIEGGSLDKYLHN-PNYTFSPQLRLKMANDIAKGMCFLHRNEILHLDLKPQNFLVVSISPEAPVSIKLADFGLATSSSRSFYGPTVEGS--FLYMSPEVFTQKKFSRAADVWSYGACLIEILTNKRPYQEYD 391          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9S7U9|M2K2_ARATH (Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 78.1814 bits (191), Expect = 2.322e-14
Identity = 62/225 (27.56%), Postives = 108/225 (48.00%), Query Frame = 3
Query:  393 ILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSY-QILLGLKFLH-DQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENL---KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYS---EYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            I  ELK  Q+++     V    +F+   ++ + +EYM  G L  +LK+ K     P  +    + Q+L GL +LH D+ +IHRDL PSN+ ++ + ++K++             ++VM   +   N     Y YM+PE +  +KYG + DIWS G V++   TGK PY+   + + +  V  +++  V          N        +++CL+  P  R+    L
Sbjct:  113 IAQELKINQSSQC-PNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVK---AIPDSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFG---------VSTVMTNTAGLANTFVGTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKEL 324          
BLAST of Protein kinase vs. UniProt/SwissProt
Match: sp|Q9FJV0|M2K6_ARATH (Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana OX=3702 GN=MKK6 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.040e-14
Identity = 63/216 (29.17%), Postives = 105/216 (48.61%), Query Frame = 3
Query:  393 ILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ-VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQ---RFMPLVNSCLKIKPEERA 1028
            I+ ELK  Q +      V    +F+   +  + +EYM  G L   ++  K   + PY       Q+LLGL +LH+++ VIHRD+ PSN+ ++ K ++K+S   +S      + AS MG++  +    Y YM+PE +S   Y    DIWS G  ++    G+ PY E ++ Q+  +  +    I  +        Q    F   V++C++  P  RA
Sbjct:  113 IVQELKINQASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVIRQVKT-ILEPY-LAVVCKQVLLGLVYLHNERHVIHRDIKPSNLLVNHKGEVKISDFGVS-----ASLASSMGQRDTFVG-TYNYMSPERISGSTYDYSSDIWSLGMSVLECAIGRFPYLESEDQQNPPSFYELLAAIVENPPPTAPSDQFSPEFCSFVSACIQKDPPARA 320          
BLAST of Protein kinase vs. TrEMBL
Match: A9SWW2 (Predicted protein OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPADRAFT_136578 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 2.940e-16
Identity = 79/278 (28.42%), Postives = 142/278 (51.08%), Query Frame = 3
Query:  321 GENILLKIYS---LESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMI-KG-KVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDS----LQNQIKQ*VI-YNSYKDSINYYLVLEFRF 1124
            G+++ +KI     L  +++  ++ + FI+ +++       ++  VQ      M  +LC+  EYMS G +  YL+NQK     P   R  +  +  G+ +LH  ++IHRDL  +N+ LDE   +K++   +++    ++ + VM      E   YR+MAPEI+    YG++ D++SFG VL  ++TGK PY++    Q  + ++ KG + TI  ++        + + L+  C K  P ER +       LQ  +K+ +I Y  +     + +V EF F
Sbjct:  296 GQDVAIKILKPERLNENLQREFQQEVFIMRKVR-------HKNVVQFIGACTMPPNLCIITEYMSGGSVYDYLRNQKALLKMPMLLRV-AIDVSKGMDYLHQNKIIHRDLKAANLLLDENEVVKVADFGVARV---QSQSGVM----TAETGTYRWMAPEIIEHKPYGKKADMFSFGVVLWELLTGKVPYADMTPLQAAVGVVQKGLRPTIPKNIP------PKLVDLLQRCWKTDPSERPEFSETTLILQEILKEVLICYTCF-----FRIVGEFGF 547          
BLAST of Protein kinase vs. TrEMBL
Match: A0A2K1K9V0 (Uncharacterized protein OS=Physcomitrella patens subsp. patens OX=3218 GN=PHYPA_009741 PE=4 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.570e-16
Identity = 70/240 (29.17%), Postives = 126/240 (52.50%), Query Frame = 3
Query:  321 GENILLKIYS---LESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMI-KG-KVTIEYDVKDIENELQRFMPLVNSCLKIKPEER 1025
            G+++ +KI     L  +++  ++ + FI+ +++       ++  VQ      M  +LC+  EYMS G +  YL+NQK     P   R  +  +  G+ +LH  ++IHRDL  +N+ LDE   +K++   +++    ++ + VM      E   YR+MAPEI+    YG++ D++SFG VL  ++TGK PY++    Q  + ++ KG + TI  ++        + + L+  C K  P ER
Sbjct:  307 GQDVAIKILKPERLNENLQREFQQEVFIMRKVR-------HKNVVQFIGACTMPPNLCIITEYMSGGSVYDYLRNQKALLKMPMLLR-VAIDVSKGMDYLHQNKIIHRDLKAANLLLDENEVVKVADFGVARV---QSQSGVM----TAETGTYRWMAPEIIEHKPYGKKADMFSFGVVLWELLTGKVPYADMTPLQAAVGVVQKGLRPTIPKNIP------PKLVDLLQRCWKTDPSER 525          
BLAST of Protein kinase vs. TrEMBL
Match: A0A1Z5JZV8 (Mitogen-activated protein kinase kinase 1 OS=Fistulifera solaris OX=1519565 GN=FisN_4Lh063 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.136e-16
Identity = 69/221 (31.22%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  390 FILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQK---VSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRF------MPLVNSCLKIKPEER 1025
             ++ ELKA    +S+   ++L   +   + + + +EYM+ G L   ++  K  K   V+P      +YQILLGL+ LH++ ++HRDL P+N+ L    ++KL  + ++        ++V+G          +YMAPE L+   YG+  DIWSFG V+   +TGK P+S+ D+  D++      VT+E    D+ NEL  F        ++   L   PE+R
Sbjct:  108 MLVRELKALTKVQSDH-VIRLYGAYLEETHITMVLEYMNLGSLDATIQQTKAMKEAMVAPI-----AYQILLGLRDLHEKGIMHRDLKPANVLLSSDGEVKLCDAGMASLGEQTLNSTVLGTA--------KYMAPERLT-KSYGRLSDIWSFGLVVYECVTGKHPFSKIDSLVDLL------VTVEE--SDL-NELLSFKCHSGLKEIIACSLHADPEQR 304          
BLAST of Protein kinase vs. TrEMBL
Match: A0A1Z5KE04 (Mitogen-activated protein kinase kinase 1 OS=Fistulifera solaris OX=1519565 GN=FisN_4Hh063 PE=3 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 6.926e-16
Identity = 67/221 (30.32%), Postives = 115/221 (52.04%), Query Frame = 3
Query:  390 FILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQK---VSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRF------MPLVNSCLKIKPEER 1025
             ++ ELKA    +S+   ++L   +   + + + +EYM+ G L   ++  K  K   V+P      +YQILLGL+ LH++ ++HRDL P+N+ L+   ++KL  + ++        ++V+G          +YMAPE L+   YG+  DIWSFG V+   +TG+ P+S+ D+  D++  ++     E DV    NEL  F        ++   L   PE+R
Sbjct:  108 MLVRELKALTKVQSDH-IIRLYGAYLEETHVTMVLEYMNLGSLDAIIQQTKAMKEAMVAPI-----AYQILLGLRDLHEKGIMHRDLKPANVLLNSDGEVKLCDAGMASLGEHTLNSTVLGTA--------KYMAPERLT-KSYGRLSDIWSFGLVVYECVTGRHPFSKIDSLVDLLVTVE-----ESDV----NELLSFECHSGLKEIIECSLHADPEQR 304          
BLAST of Protein kinase vs. TrEMBL
Match: A0A0M0J9S3 (Mitogen-activated protein kinase kinase 6 OS=Chrysochromulina tobinii OX=1460289 GN=Ctob_002843 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 8.112e-16
Identity = 74/226 (32.74%), Postives = 115/226 (50.88%), Query Frame = 3
Query:  390 FILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKN---QKVSPYEFRKWSYQILLGLKFLH-DQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVI-NMIKGKVTIEY-DVKD--IENELQRFMPLVNSCLKIKPEERAKMDSL 1043
             ILNE+K     +SN   +   D FF   S+ +++EYM  G L+  L   K+   Q V         +QIL GL +LH +Q+ +HRDL P+N+ LD    +KLS   ++     K   S M  ++  +     YM+PE L  D YG   D+WS G + +    G  P+    +Y +++  +++G V  EY DV++    +ELQ    LV++CL+  P ER  +  L
Sbjct:    1 MILNEIKIVSNAQSNH-LISFYDAFFHDGSIYLALEYMDCGSLEGLLHAAKSTPAQLVPEGVSASVLFQILRGLTYLHHEQKAVHRDLKPANVLLDSAGCVKLSDFGIA-----KQLGSGMYAQAGTQVGTVAYMSPERLRGDPYGFASDVWSVGLIALETALGTYPFPLCRSYFELVKTIVEGPVPSEYPDVQERVPLDELQ----LVHACLQKAPNERPDVRDL 216          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: map3k10 (mitogen-activated protein kinase kinase kinase 10 [Source:ZFIN;Acc:ZDB-GENE-050419-112])

HSP 1 Score: 80.1073 bits (196), Expect = 2.275e-15
Identity = 57/191 (29.84%), Postives = 82/191 (42.93%), Query Frame = 3
Query:  480 LCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ---VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            LC+ MEY   G L   L  +K   V P     W+ QI  G+ +LH+Q    VIHRDL  SNI + E ++    S    K      A        +     Y +MAPE++    + +  D+WSFG +L  ++TG+ PY E D       +   K+T+       E     F  L+  C    P  R    S+
Sbjct:  141 LCLVMEYARGGALNRALAGKK---VPPRVLVNWAVQIATGMDYLHNQTIVPVIHRDLKSSNILILEPVERDDLSGKTLKITDFGLAREWHRTTKMSAAGTYAWMAPEVIKLSLFSKSSDVWSFGVLLWELLTGEVPYREIDALAVAYGVAMNKLTLPVPSTCPEA----FAQLLGECWSPNPHSRPSFSSI 324          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 78.1814 bits (191), Expect = 7.249e-15
Identity = 66/236 (27.97%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  360 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 577          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a [Source:ZFIN;Acc:ZDB-GENE-021011-2])

HSP 1 Score: 77.411 bits (189), Expect = 8.296e-15
Identity = 62/214 (28.97%), Postives = 100/214 (46.73%), Query Frame = 3
Query:  387 EFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  261 ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPIFRDFLNRCLEMDVEKRG 461          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: si:ch73-340m8.2 (tyrosine-protein kinase SRK3-like [Source:NCBI gene;Acc:103039108])

HSP 1 Score: 77.0258 bits (188), Expect = 1.203e-14
Identity = 60/223 (26.91%), Postives = 103/223 (46.19%), Query Frame = 3
Query:  393 ILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFR-KWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIIT-GKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQI 1055
            I  E+K  +  K + R ++L     +    C+  E M NG LK YL + + +K   +     ++ Q+  G+ +L  + ++HRDL   NI L +    K++   L+ F LP    S    K     +  ++MAPEI     Y  +CD+WSFG +L  I+T G  PY + D    +  + +G     Y ++  +        ++  C +  P+ER     LQ ++
Sbjct:  245 IQTEIKIMKEYK-HERLLKLYGVCTVSEPFCLITELMKNGSLKKYLISHRERKDIAFSLMIDFAVQVTEGMAYLESKNIVHRDLRADNILLTDMQFCKIADFGLADFTLPGDRESTFAVK-----VPIKWMAPEIFDNQVYTSKCDVWSFGILLTEIVTYGNDPYPDKDKLACIQAIRRG-----YRMEQPQACPSSLYEIMKLCWRTDPDERPGFTVLQEKL 456          
BLAST of Protein kinase vs. Ensembl Cavefish
Match: pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-3759])

HSP 1 Score: 77.0258 bits (188), Expect = 1.335e-14
Identity = 55/187 (29.41%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY
Sbjct:  237 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPY 408          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002088.1 (pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 gene:ENSPMAG00000001892.1 transcript:ENSPMAT00000002088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 2.741e-14
Identity = 45/139 (32.37%), Postives = 74/139 (53.24%), Query Frame = 3
Query:  483 CVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPK-TAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN 896
            C+ MEY + G L   L+    +K++P    +W+  I  G+ +LH  ++IHRDL   N+ +     +K+S    SK  + K T  S  G  +        +MAPE++  +   ++ DIWSFG VL  ++TG+ PY + D+
Sbjct:   11 CIIMEYCAQGQLYEVLR--AGRKITPELLYRWTTGIASGMNYLHLHKIIHRDLKSPNVLITHDDLVKISDFGTSKELMDKSTKMSFAGTVA--------WMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDS 139          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 6.743e-14
Identity = 52/182 (28.57%), Postives = 85/182 (46.70%), Query Frame = 3
Query:  483 CVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPK-TAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEER 1025
            C+ MEY + G L   L+    +++SP     W+  I  G+ +LH  ++IHRDL   N+ +    ++K+S    SK    K T  S  G  +        +MAPE++  +   ++ DIWSFG VL  ++TG+ PY + D+   +  +    + +       E     F  L+  C   KP  R
Sbjct:   76 CIIMEYCAQGQLYEVLR--AGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSFAGTVA--------WMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAIIWGVGSNSLHLPIPASCPEG----FKILLTQCWNSKPRNR 243          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 67.781 bits (164), Expect = 2.673e-12
Identity = 45/141 (31.91%), Postives = 77/141 (54.61%), Query Frame = 3
Query:  477 SLCVSMEYMSNGMLKTYLK--NQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYD 893
            +L + MEYM  G +K  L+      + V+    RK++ QIL G+ FLH   ++HRD+  +NI  D   ++KL     SK    +T  S            Y +M+PE+++ + YG++ DIWS G  ++ ++T K P++E++
Sbjct:  435 TLSIFMEYMPGGSIKDQLRAYGALTENVT----RKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRL--QTICSQGTAMRSVTGTPY-WMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFE 568          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: map3k9 (mitogen-activated protein kinase kinase kinase 9 [Source:ZFIN;Acc:ZDB-GENE-081113-5])

HSP 1 Score: 68.1662 bits (165), Expect = 2.757e-12
Identity = 51/219 (23.29%), Postives = 86/219 (39.27%), Query Frame = 3
Query:  441 FVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQ---VIHRDLNPSNIYXXXXXXXXXXXXXXXXXXX-----------PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQI 1055
             + L        +LC+ MEY   G L   L  ++   + P+    W+ QI  G+K+LHD+    +IHRDL   N+      +   +    +K                T  S  G         Y +MAPE++    + +  D+WS+G +L  ++TG+ PY   D       +   K+T+       E     F  L+  C    P  R     + +++
Sbjct:  149 IIALKAVCLQAPNLCLIMEYARGGALNRALAGRR---IHPHILLDWAVQIARGMKYLHDEAIVNIIHRDLKSCNVVKVLLQERVENDDLEAKTLKITDFGLAREWYKTTMMSAAG--------TYAWMAPEVIKSSTFSKGSDVWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLPIPSTCPEP----FSKLMTECWDPDPHSRPPFSRILDEL 352          
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 66.6254 bits (161), Expect = 4.943e-12
Identity = 75/335 (22.39%), Postives = 147/335 (43.88%), Query Frame = 3
Query:  114 KHFTRVRILR-----LASTIPSELAKKLITVFYLQ--GFHQKIGLYCNFRNPN-------FKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHV-----KDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIIT-GKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIK 1058
            KH+ ++R L      + S I     ++L+  ++L+  G  QK+G  C    P        +++P + I   K     Q  +     + + +Y+ ++ V     K G    +  L E    +T + ++  V+L         + +  EYM  G L  +LK  +  ++   +      Q+  G+ F+ D+  IHRDL  +NI ++  L  K++   L++        +  G K        ++ APE ++   +  + D+WSFG +L  ++T G+ PY    N + + ++ +G     Y +   +N       ++  C + KPEER   + LQ+ ++
Sbjct:  181 KHY-KIRTLDKGGYFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQPQKPWEKDAWEIPRESIKLEKKLGAGQFGD-----VWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDK-LVRL-HAVVTDEPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAK-----FPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERG-----YRMPKPDNCPCELYSIMQECWRQKPEERPTFEYLQSLLE 497          
BLAST of Protein kinase vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 75.485 bits (184), Expect = 4.717e-15
Identity = 61/193 (31.61%), Postives = 96/193 (49.74%), Query Frame = 3
Query:  474 SSLCVSMEYMSNGMLKTYLKN--QKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDV--INMIKGKVTIEYDVKDIENEL-----QRFMPLVNSCLKIKPEER 1025
            SS+ ++MEYM    L+   KN  ++  ++S     K +  +L GL +LH+++VIHRD+ P NI L+EK ++KL    +S   +   A +  G           YMAPE +    Y   CD+WS G  L+ +  G+ P+      Q+V  I ++   +T    +KD E EL     + F   ++ CLK    ER
Sbjct:  286 SSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFTGTSF--------YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKD-EPELDISWSKTFRSFIDYCLKKDARER 469          
BLAST of Protein kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 70.0922 bits (170), Expect = 3.545e-13
Identity = 62/249 (24.90%), Postives = 112/249 (44.98%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSS-LCVSMEYMSNGMLKTYL----KNQKNQKVSPYEFRKWSY---QILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            GE + +K   L    K      + I+NEL     ++     V   + + +    L V MEYM  G L   L    ++   +  SP    + +Y   +   GLKFLH++++IHRD+   NI L+ +  +K++          K +       + Y      +MAPEI++   Y ++ D+WS G +LI +I G+ PY   D  + +  +           + +  + ++F+   ++CL++  E RA +  L
Sbjct:  400 GERVAIKQIRLSEQPKK-----QLIMNELLVMNDSRQ-ENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPY------WMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFL---DACLQVNVESRASVRKL 633          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 69.707 bits (169), Expect = 5.271e-13
Identity = 59/219 (26.94%), Postives = 107/219 (48.86%), Query Frame = 3
Query:  387 EFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSL 1043
            E I+NE+   + +K +   V   D++ +   L V MEYM  G L   + +     ++  +      + L GL+FLH + V+HRD+   NI L  + D+KL+               +  K++      Y +MAPE++S  +YG + DIWS G ++I +I G+ PY      + +  +         + +++ + L++F+   + CL ++PE+RA    L
Sbjct:  660 ELIINEILVMKGSK-HPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQIN-----ELNLKRTTMVGTPY-WMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPENLSSSLKKFL---DWCLCVEPEDRASATEL 865          
BLAST of Protein kinase vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 65.0846 bits (157), Expect = 1.189e-11
Identity = 47/154 (30.52%), Postives = 81/154 (52.60%), Query Frame = 3
Query:  471 GSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYE---FRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXP-----KTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDV 908
            G +L + +EY+  G + + L N       P+E      ++ QIL+G+ +LH + +IHRD+  +NI +D K  +K++   +SK   P        AS+ G  SV+      +M+PE++       + DIWS G V+I + TGK P+ ++   Q +
Sbjct:  526 GGNLNIFLEYVPGGSVSSMLNN-----YGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQG--SVF------WMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAI 666          
BLAST of Protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 65.0846 bits (157), Expect = 1.654e-11
Identity = 42/134 (31.34%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  480 LCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            L + +EY +NG L+  L ++ +  +S  E + +  Q LLGLK+LH + VIHRD+  +NI L     +KL+             ++++   ++       +MAPEIL         DIWS GA ++ ++T   PY
Sbjct:   95 LYILLEYCANGSLRR-LISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFG---------VSTIVNSSALTLAGTLNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPY 218          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO36150 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJF2])

HSP 1 Score: 84.7297 bits (208), Expect = 2.875e-17
Identity = 58/195 (29.74%), Postives = 97/195 (49.74%), Query Frame = 3
Query:  492 MEYMSNGMLKTYLKNQKNQKVSPYE---FRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENL--KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFM-PLVNSCLKIKPEER-AKMDSLQNQI 1055
            +E+M+ G +   L      K  P+E     ++  QIL G+ +LH+ QV+HRD+  +NI +D        +   +     + A  + G       L     +MAPE+L  + YG+ CD+WS G VLI + TGK P++ +++   +  +   K+       DI   L   +  +V  CL+ KPE+R A +D LQ+ +
Sbjct:  657 LEWMAGGSISMLLS-----KYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAA---RLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEHSNHLALIF--KIACAIGPPDIPEHLNPGVRDVVLRCLESKPEDRPAAVDLLQHPL 841          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 75.0998 bits (183), Expect = 4.088e-15
Identity = 43/140 (30.71%), Postives = 72/140 (51.43%), Query Frame = 3
Query:  492 MEYMSNGMLKTYLKNQKNQKVSPYE---FRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENL--KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN 896
            +E+M+ G +   L      K  P+E     ++  QIL G+ +LH+ QV+HRD+  +NI +D        +   +     + A  + G       L     +MAPE+L  + YG+ CD+WS G VLI + TGK P++ +++
Sbjct:  119 LEWMAGGSISMLLS-----KYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAA---ARLATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPWNAHEH 250          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 73.1738 bits (178), Expect = 1.993e-14
Identity = 64/234 (27.35%), Postives = 119/234 (50.85%), Query Frame = 3
Query:  351 LESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQK--NQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQ-RFMPLVNSCLKIKPEERAKMDSL 1043
            L S  K+  K  E  +  +KAF+    N R VQ          + + MEY+  G +  ++K     N+ ++    RK+S QIL G+ +LH  +++HRD+  +NI  D   ++KL+    SK    +T  S  G +SV+    Y +MAPE+++ + YG++ D+WS G  ++ ++T K P+++++    +      K+  +    ++ ++L    +  V S L++  + R   D L
Sbjct:   40 LNSSTKNEVKALEGEIEFMKAFR----NERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLT----RKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRL--QTIRSKTGFRSVH-GTPY-WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALF-----KIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADEL 256          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO49138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH03])

HSP 1 Score: 70.4774 bits (171), Expect = 1.242e-13
Identity = 62/227 (27.31%), Postives = 95/227 (41.85%), Query Frame = 3
Query:  387 EFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRK---WSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFM-----PLVNSCLKIKPEERAKMDSL 1043
               LNE+K   T K +R  V+  D F       + MEY   G L T +K    Q V P+   +   W  Q+LL LK +H Q ++HRDL   NI+L +   +K+    +++        +     + Y      Y++PEI     Y  + DIW+ G VL  + T   P++  +    V+ ++ G              + RF       LV   LKI P +R     L
Sbjct:   46 HLALNEVKILSTLK-HRNIVRYRDAFEETGRFYIVMEYAEGGDLHTKIK----QAVEPFSSERILNWLAQLLLALKHIHGQNILHRDLKTQNIFLTKDDVVKIGDFGIARILDSTCDHARTTVGTPY------YLSPEICQRQPYNNKSDIWALGCVLYELTTRTHPFTADNLTNLVVKILHGNYP----------PIPRFYGPLLEDLVAVMLKINPADRPSAKQL 251          
BLAST of Protein kinase vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 69.707 bits (169), Expect = 5.695e-13
Identity = 46/153 (30.07%), Postives = 74/153 (48.37%), Query Frame = 3
Query:  438 RFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDN 896
            RF  +C+        CV MEY   G L   L++   ++++P     W+ QI  G+ +LH  ++IHRDL   NI +     LK+S     K    K+A         +       MAPE++  +   ++ D+WSFG +L  ++TG+ PY   D+
Sbjct:   85 RFKGVCN---QAPVYCVVMEYCPYGQLFEVLRD--GREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDILKISDFGTCKEFNEKSAKMTFAGTVAW-------MAPEVIRNEPCSEKVDVWSFGVLLWELLTGELPYKGVDS 225          
BLAST of Protein kinase vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 80.4925 bits (197), Expect = 7.586e-16
Identity = 67/236 (28.39%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F MG  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  171 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLMGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPVFRDFLNRCLEMDVEKRG 388          
BLAST of Protein kinase vs. Ensembl Medaka
Match: pak2b (p21 (RAC1) activated kinase 2 [Source:NCBI gene;Acc:101167280])

HSP 1 Score: 79.7221 bits (195), Expect = 1.628e-15
Identity = 67/236 (28.39%), Postives = 109/236 (46.19%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERA 1028
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F MG  L V MEY++ G L   +      +    +      + L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY   +N    + +I    T E  +++ E     F   +N CL++  E+R 
Sbjct:  280 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFLDSFLMGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLN-ENPLRALYLIATNGTPE--LQNPEKLSPVFRDFLNRCLEMDVEKRG 497          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 78.5666 bits (192), Expect = 3.277e-15
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      ++L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY
Sbjct:  225 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPY 396          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000028689.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 78.5666 bits (192), Expect = 3.870e-15
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      ++L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY
Sbjct:  262 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPY 433          
BLAST of Protein kinase vs. Ensembl Medaka
Match: ENSORLT00000043480.1 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 78.5666 bits (192), Expect = 3.870e-15
Identity = 55/187 (29.41%), Postives = 89/187 (47.59%), Query Frame = 3
Query:  321 GENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPY 881
            G+ + +K  +L+   K      E I+NE+   +  K N   V   D+F +G  L V MEY++ G L   +      +    +      ++L  L+FLH  QVIHRD+   N+ L     +KL+         P+ +     K+S      Y +MAPE+++   YG + DIWS G + I ++ G+ PY
Sbjct:  262 GQEVAIKQINLQKQPKK-----ELIINEILVMKELK-NPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTETCMDEA---QIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQS-----KRSTMVGTPY-WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPY 433          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 449.514 bits (1155), Expect = 1.922e-151
Identity = 244/273 (89.38%), Postives = 249/273 (91.21%), Query Frame = 3
Query:  243 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIKQ 1061
            NP F+VPDKPISQNKIFKLY TQNQK ENILLKIYSLESHVKDGWKGDEFILNELK FQTTK N+ FVQLCDTF  GSSLCVS E+MSNGMLKTYLKN K   VS  EFRKWS+QILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY  YQDVINMI    TIEYDV+DIENELQ FMPLVNSCLK  PEERAKMDSLQNQIKQ
Sbjct:  427 NPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK---VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLQNQIKQ 696          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.101e-151
Identity = 244/273 (89.38%), Postives = 249/273 (91.21%), Query Frame = 3
Query:  243 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIKQ 1061
            NP F+VPDKPISQNKIFKLY TQNQK ENILLKIYSLESHVKDGWKGDEFILNELK FQTTK N+ FVQLCDTF  GSSLCVS E+MSNGMLKTYLKN K   VS  EFRKWS+QILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY  YQDVINMI    TIEYDV+DIENELQ FMPLVNSCLK  PEERAKMDSLQNQIKQ
Sbjct:  426 NPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK---VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLQNQIKQ 695          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 449.514 bits (1155), Expect = 2.363e-151
Identity = 244/273 (89.38%), Postives = 249/273 (91.21%), Query Frame = 3
Query:  243 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIKQ 1061
            NP F+VPDKPISQNKIFKLY TQNQK ENILLKIYSLESHVKDGWKGDEFILNELK FQTTK N+ FVQLCDTF  GSSLCVS E+MSNGMLKTYLKN K   VS  EFRKWS+QILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY  YQDVINMI    TIEYDV+DIENELQ FMPLVNSCLK  PEERAKMDSLQNQIKQ
Sbjct:  438 NPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK---VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLQNQIKQ 707          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074416.1 (SMESG000074416.1)

HSP 1 Score: 448.743 bits (1153), Expect = 2.410e-151
Identity = 244/273 (89.38%), Postives = 249/273 (91.21%), Query Frame = 3
Query:  243 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIKQ 1061
            NP F+VPDKPISQNKIFKLY TQNQK ENILLKIYSLESHVKDGWKGDEFILNELK FQTTK N+ FVQLCDTF  GSSLCVS E+MSNGMLKTYLKN K   VS  EFRKWS+QILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEY  YQDVINMI    TIEYDV+DIENELQ FMPLVNSCLK  PEERAKMDSLQNQIKQ
Sbjct:  415 NPGFEVPDKPISQNKIFKLYHTQNQKHENILLKIYSLESHVKDGWKGDEFILNELKIFQTTKYNQSFVQLCDTFLTGSSLCVSTEFMSNGMLKTYLKNHK---VSVNEFRKWSHQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYHYYQDVINMIMENGTIEYDVEDIENELQGFMPLVNSCLKRIPEERAKMDSLQNQIKQ 684          
BLAST of Protein kinase vs. Planmine SMEST
Match: SMESG000074407.1 (SMESG000074407.1)

HSP 1 Score: 431.795 bits (1109), Expect = 8.864e-147
Identity = 226/232 (97.41%), Postives = 227/232 (97.84%), Query Frame = 3
Query:  243 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYXXXXXXXXXXXXXXXXXXXPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIKGKVTI 938
            NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFE PKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMI  K  +
Sbjct:  295 NPNFKVPDKPISQNKIFKLYQTQNQKGENILLKIYSLESHVKDGWKGDEFILNELKAFQTTKSNRRFVQLCDTFFMGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHDQQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFEHPKTAASVMGKKSVYENLKYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINMIMEKARL 526          
The following BLAST results are available for this feature:
BLAST of Protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PAK19.082e-1628.22p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK26.188e-1528.88p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;... [more]
PAK11.052e-1428.22p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK11.564e-1428.22p21 (RAC1) activated kinase 1 [Source:HGNC Symbol;... [more]
PAK21.644e-1427.39p21 (RAC1) activated kinase 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnk-13.080e-1530.00Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.196e-1530.00Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.218e-1530.00Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.358e-1530.00Serine/threonine-protein kinase WNK [Source:UniPr... [more]
wnk-13.361e-1530.00Serine/threonine-protein kinase WNK [Source:UniPr... [more]
back to top
BLAST of Protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slpr7.968e-1524.50gene:FBgn0030018 transcript:FBtr0071184[more]
slpr7.968e-1524.50gene:FBgn0030018 transcript:FBtr0303844[more]
slpr7.968e-1524.50gene:FBgn0030018 transcript:FBtr0303843[more]
slpr8.196e-1524.50gene:FBgn0030018 transcript:FBtr0303842[more]
Mekk12.195e-1325.78gene:FBgn0024329 transcript:FBtr0331353[more]
back to top
BLAST of Protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2a8.841e-1527.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a8.841e-1527.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a8.841e-1527.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a8.864e-1527.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
map3k109.091e-1527.36mitogen-activated protein kinase kinase kinase 10 ... [more]
back to top
BLAST of Protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qsox21.351e-1426.97quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
qsox21.963e-1426.97quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
ints72.745e-1425.40integrator complex subunit 7 [Source:Xenbase;Acc:X... [more]
qsox23.104e-1427.85quiescin sulfhydryl oxidase 2 [Source:Xenbase;Acc:... [more]
ints73.440e-1425.40integrator complex subunit 7 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak21.255e-1427.39p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Pak11.397e-1428.22p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Pak11.397e-1428.22p21 (RAC1) activated kinase 1 [Source:MGI Symbol;A... [more]
Map3k102.295e-1424.40mitogen-activated protein kinase kinase kinase 10 ... [more]
Map3k102.313e-1424.40mitogen-activated protein kinase kinase kinase 10 ... [more]
back to top
BLAST of Protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5QN75|M2K1_ORYSJ1.037e-1530.04Mitogen-activated protein kinase kinase 1 OS=Oryza... [more]
sp|Q39008|M3K1_ARATH9.492e-1530.88Mitogen-activated protein kinase kinase kinase 1 O... [more]
sp|Q54Y90|Y0133_DICDI2.027e-1434.97Probable serine/threonine-protein kinase DDB_G0278... [more]
sp|Q9S7U9|M2K2_ARATH2.322e-1427.56Mitogen-activated protein kinase kinase 2 OS=Arabi... [more]
sp|Q9FJV0|M2K6_ARATH4.040e-1429.17Mitogen-activated protein kinase kinase 6 OS=Arabi... [more]
back to top
BLAST of Protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A9SWW22.940e-1628.42Predicted protein OS=Physcomitrella patens subsp. ... [more]
A0A2K1K9V03.570e-1629.17Uncharacterized protein OS=Physcomitrella patens s... [more]
A0A1Z5JZV86.136e-1631.22Mitogen-activated protein kinase kinase 1 OS=Fistu... [more]
A0A1Z5KE046.926e-1630.32Mitogen-activated protein kinase kinase 1 OS=Fistu... [more]
A0A0M0J9S38.112e-1632.74Mitogen-activated protein kinase kinase 6 OS=Chrys... [more]
back to top
BLAST of Protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k102.275e-1529.84mitogen-activated protein kinase kinase kinase 10 ... [more]
pak2a7.249e-1527.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
pak2a8.296e-1528.97p21 protein (Cdc42/Rac)-activated kinase 2a [Sourc... [more]
si:ch73-340m8.21.203e-1426.91tyrosine-protein kinase SRK3-like [Source:NCBI gen... [more]
pak2b1.335e-1429.41p21 protein (Cdc42/Rac)-activated kinase 2b [Sourc... [more]
back to top
BLAST of Protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002088.12.741e-1432.37pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 ge... [more]
ENSPMAT00000008193.16.743e-1428.57pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
map3k22.673e-1231.91mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k92.757e-1223.29mitogen-activated protein kinase kinase kinase 9 [... [more]
hck4.943e-1222.39HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK24.717e-1531.61MAPKK involved in the protein kinase C signaling p... [more]
SKM13.545e-1324.90Member of the PAK family of serine/threonine prote... [more]
STE205.271e-1326.94Cdc42p-activated signal transducing kinase; involv... [more]
STE111.189e-1130.52Signal transducing MEK kinase; involved in pheromo... [more]
CDC151.654e-1131.34Protein kinase of the Mitotic Exit Network; locali... [more]
back to top
BLAST of Protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361502.875e-1729.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279764.088e-1530.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414101.993e-1427.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491381.242e-1327.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375755.695e-1330.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pak2b7.586e-1628.39p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
pak2b1.628e-1528.39p21 (RAC1) activated kinase 2 [Source:NCBI gene;Ac... [more]
ENSORLT00000015480.23.277e-1529.41serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000028689.13.870e-1529.41serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
ENSORLT00000043480.13.870e-1529.41serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
back to top
BLAST of Protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074416.11.922e-15189.38SMESG000074416.1[more]
SMESG000074416.12.101e-15189.38SMESG000074416.1[more]
SMESG000074416.12.363e-15189.38SMESG000074416.1[more]
SMESG000074416.12.410e-15189.38SMESG000074416.1[more]
SMESG000074407.18.864e-14797.41SMESG000074407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010792 ID=SMED30010792|Name=Protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1541bp
GCAAGTTAAATGTAAAGTAAAATAAAGAATTATAAATTTAAAAAGTTAAA
TCTATGCTCGGTAAACTATGGCACGCAGATAGAACTGAATTTTGCTAGAA
GAGTAACGTTCCAAAGCATTTTACACGAGTGCGTATTCTGCGTCTGGCAT
CTACTATTCCAAGTGAGTTAGCCAAGAAACTCATAACTGTGTTTTATTTG
CAAGGGTTTCATCAGAAAATAGGGCTATATTGTAATTTCAGAAATCCTAA
TTTTAAAGTTCCTGATAAACCGATCAGTCAGAATAAAATATTTAAACTGT
ATCAGACTCAAAACCAAAAAGGCGAAAATATATTATTGAAAATCTATTCA
CTTGAATCACATGTCAAAGACGGATGGAAAGGTGACGAGTTTATACTAAA
TGAGTTGAAGGCATTCCAGACTACAAAATCAAATCGGCGTTTTGTTCAGC
TATGCGATACATTTTTCATGGGTTCAAGTTTATGTGTTTCAATGGAGTAC
ATGTCTAATGGAATGCTGAAGACATATCTAAAGAACCAAAAGAACCAAAA
GGTGTCACCATATGAATTTAGAAAATGGTCATATCAAATTTTGTTAGGAT
TGAAGTTTCTCCATGATCAACAAGTCATTCACAGAGATTTGAACCCGTCA
AACATTTATTTGGATGAAAAACTAGATTTGAAATTATCCAGTTCAAATCT
TTCGAAATTCGAGCTTCCCAAAACTGCAGCCTCAGTGATGGGGAAAAAAT
CCGTATATGAAAATCTAAAATATAGATATATGGCACCTGAAATATTATCG
TGCGACAAATATGGTCAAGAATGTGACATTTGGTCGTTTGGCGCGGTGTT
GATCAGGATTATTACCGGAAAAAGGCCTTATTCGGAATATGATAATTACC
AAGACGTGATAAATATGATAAAGGGAAAAGTCACGATTGAATATGATGTA
AAAGATATTGAGAATGAATTGCAACGCTTCATGCCTTTGGTTAATTCATG
TTTGAAAATAAAACCAGAGGAAAGAGCAAAAATGGATAGCTTACAAAACC
AAATTAAGCAATAAGTTATATATAATTCATATAAAGATTCAATCAATTAT
TATTTGGTGCTTGAATTTCGTTTCGACAATCGTGATTAGTTTTATTAATT
ATGTTAAATAACTTGTTCATTAAAATGAGTTTTGGATTTGTTTTATCTCG
AGGTGACTTTGACTTGTCTTTTAAAAATTTCGAATGCTAGGAAACTGACT
CTTCATTTTACTCCTGTAGAATTTTCTTTATTAACATTTATATTCACGAC
TTTGATCACTAGTTATTAGCAAATCCTTCCTTTACATATCACACAATTTT
ATTTTGACAAATTATTTGCTTCTTTTTCTATCTCAAAATATTCAACTTTT
AAATTTGTAGATGTCATGAAGGTTTTCCGGTAAATATATTTGAACTTCAG
TATGAATACAAACAACAAATCAAAGGCTGTTTACCCTCATATTCTTAGAT
TTACTTATGCATCATTTTTTGATAATTTGTTCTGTTAAACG
back to top

protein sequence of SMED30010792-orf-1

>SMED30010792-orf-1 ID=SMED30010792-orf-1|Name=SMED30010792-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=199bp
MGSSLCVSMEYMSNGMLKTYLKNQKNQKVSPYEFRKWSYQILLGLKFLHD
QQVIHRDLNPSNIYLDEKLDLKLSSSNLSKFELPKTAASVMGKKSVYENL
KYRYMAPEILSCDKYGQECDIWSFGAVLIRIITGKRPYSEYDNYQDVINM
IKGKVTIEYDVKDIENELQRFMPLVNSCLKIKPEERAKMDSLQNQIKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm