Cyclic nucleotide gated channel 1

Overview
NameCyclic nucleotide gated channel 1
Smed IDSMED30010783
Length (bp)2825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cyclic nucleotide gated channel 1 (SMED30010783) t-SNE clustered cells

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel 1 (SMED30010783) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cyclic nucleotide gated channel 1 (SMED30010783) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cyclic nucleotide gated channel 1 (SMED30010783) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010783

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010783SMESG000020049.1 SmedASXL_008624SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010783SMESG000020049.1 dd_Smed_v4_25713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010783SMESG000020049.1 dd_Smed_v4_25713_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010783SMESG000020049.1 dd_Smed_v6_55969_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010783SMESG000020049.1 dd_Smed_v6_25713_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30010783SMESG000020049.1 OX_Smed_1.0.06056ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30010783SMESG000020049.1 Contig10382newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010783SMESG000020049.1 Contig10382uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN4 (hyperpolarization activated cyclic nucleotide gated potassium channel 4 [Source:HGNC Symbol;Acc:HGNC:16882])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 300/567 (52.91%), Postives = 408/567 (71.96%), Query Frame = 1
Query:  841 DVNIQSDEFGCYEDITFDDAN-RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIVNE 2502
            D  I+ +      D    +A  R   + +++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DFISSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY++ALFKAMSHML IGYGR  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL   +      +++++IV  
Sbjct:  185 DTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNT-EIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVETR-IDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQENEIIQQIVQH 748          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 294/525 (56.00%), Postives = 395/525 (75.24%), Query Frame = 1
Query:  868 GCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            G +ED   +   RQ    +++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWDL+ML +++ NL+I+PV I+FF +  +  WIIFN  SDT+FLLD+ +NFRTG +  D + EIIL PK I  NYLKSWF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+P+L+D+P D WV   ++    W  QY++ALFKAMSHML IGYG   P S+ + WIT++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+F+E +ILNEL++ LRE+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+  +ITK  +    L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:   79 GGFEDA--EGPRRQY--GFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIV-EKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK 596          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN2 (hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 [Source:HGNC Symbol;Acc:HGNC:4846])

HSP 1 Score: 557.755 bits (1436), Expect = 0.000e+0
Identity = 289/543 (53.22%), Postives = 401/543 (73.85%), Query Frame = 1
Query:  904 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            R + +S+++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I + YL++WF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P + WV    +    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+  LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G     LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL   +       +++EIV
Sbjct:  156 RGSQASFMQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNT-EIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIV 695          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:HGNC Symbol;Acc:HGNC:4845])

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 291/519 (56.07%), Postives = 392/519 (75.53%), Query Frame = 1
Query:  889 FDDA-NRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            F+DA   +    +++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWDL+ML +++ NL+I+PV I+FF +  +  WIIFN  SDT+FLLD+ +NFRTG +  D + EIIL PK I  NYLKSWF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+P+L+D+P D WV   ++    W  QY++ALFKAMSHML IGYG   P S+ + WIT++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+F+E +ILNEL++ LRE+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+  +ITK  +    L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +I +
Sbjct:   81 FEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIV-EKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIAK 596          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Match: HCN3 (hyperpolarization activated cyclic nucleotide gated potassium channel 3 [Source:HGNC Symbol;Acc:HGNC:19183])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 277/507 (54.64%), Postives = 380/507 (74.95%), Query Frame = 1
Query:  928 KEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFN-QIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQN 2433
            +    +  QP+ NK ++++FG+  A+  E+ R +  G W+IHP S+FRFYWDL+ML L++ NLI+LPV I+FF ++ S  WI+FN +SDT FLLD+ +NFRTG++  + A EI+L P+ I   YL++WF +D ISSIP+DYIFL++  +   + ++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY+ ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI  YYEHRYQGKMF+E  IL ELSE LRE+IIN+ CR LVA +P F +AD +FV+ V+ KL++EVFQPGDL+++EG++G +MYFIQ G++ ++ + G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D F +VLE +P+MRR  E+VA +RL++IG+ 
Sbjct:   46 RRHLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLLRIGKK 550          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 145.591 bits (366), Expect = 8.453e-36
Identity = 125/486 (25.72%), Postives = 220/486 (45.27%), Query Frame = 1
Query: 1048 IHPC-----SNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDL---------SLKWIIFNCISDTIFLLDIFVNFRTGVIT-NDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLR-DYPSDSWV--IKCKLKEAYWF-------------DQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            IH C     S F+  WD ++L L+I   +  P   +F   +L         +    I + I D +F++DI +NFRT  +  ND A +++  P +IA +Y K WF +D ++++P D + +  N  E    I                           +   ++   L+ VA K       G   L+LLM    L+ HW AC+ + I      +   +W+  +  +L + Y                +Y  +L+  +S + SIG+G    T+  E   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +     N +D   +L    +CL+  I  +  R L++    F  +    +  + ++ +     PGD ++  G++ T +YFI  G V+I+  +  V   L     FGE  LL +   +   +VRA TYC+++ + RD  L VL+ YP
Sbjct:   68 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNSDETTTLI--------------------------GLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWS--YTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 145.976 bits (367), Expect = 9.041e-36
Identity = 125/486 (25.72%), Postives = 220/486 (45.27%), Query Frame = 1
Query: 1048 IHPC-----SNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDL---------SLKWIIFNCISDTIFLLDIFVNFRTGVIT-NDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLR-DYPSDSWV--IKCKLKEAYWF-------------DQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            IH C     S F+  WD ++L L+I   +  P   +F   +L         +    I + I D +F++DI +NFRT  +  ND A +++  P +IA +Y K WF +D ++++P D + +  N  E    I                           +   ++   L+ VA K       G   L+LLM    L+ HW AC+ + I      +   +W+  +  +L + Y                +Y  +L+  +S + SIG+G    T+  E   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +     N +D   +L    +CL+  I  +  R L++    F  +    +  + ++ +     PGD ++  G++ T +YFI  G V+I+  +  V   L     FGE  LL +   +   +VRA TYC+++ + RD  L VL+ YP
Sbjct:   68 IHHCTIVHYSPFKAVWDWIILLLVIYTAVFTPYVAAFLLRELQDTAKKSRFTEPLEIVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNSDETTTLI--------------------------GLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWS--YTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 146.362 bits (368), Expect = 1.179e-35
Identity = 112/430 (26.05%), Postives = 199/430 (46.28%), Query Frame = 1
Query: 1174 IFNCISDTIFLLDIFVNFRTGVIT-NDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLR-DYPSDSWV--IKCKLKEAYWF-------------DQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            I + I D +F++DI +NFRT  +  ND A +++  P +IA +Y K WF +D ++++P D + +  N  E    I                           +   ++   L+ VA K       G   L+LLM    L+ HW AC+ + I      +   +W+  +  +L + Y                +Y  +L+  +S + SIG+G    T+  E   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +     N +D   +L    +CL+  I  +  R L++    F  +    +  + ++ +     PGD ++  G++ T +YFI  G V+I+  +  V   L     FGE  LL +   +   +VRA TYC+++ + RD  L VL+ YP
Sbjct:  162 IVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNSDETTTLI--------------------------GLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWS--YTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 563          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 145.976 bits (367), Expect = 1.219e-35
Identity = 112/430 (26.05%), Postives = 199/430 (46.28%), Query Frame = 1
Query: 1174 IFNCISDTIFLLDIFVNFRTGVIT-NDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLR-DYPSDSWV--IKCKLKEAYWF-------------DQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            I + I D +F++DI +NFRT  +  ND A +++  P +IA +Y K WF +D ++++P D + +  N  E    I                           +   ++   L+ VA K       G   L+LLM    L+ HW AC+ + I      +   +W+  +  +L + Y                +Y  +L+  +S + SIG+G    T+  E   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +     N +D   +L    +CL+  I  +  R L++    F  +    +  + ++ +     PGD ++  G++ T +YFI  G V+I+  +  V   L     FGE  LL +   +   +VRA TYC+++ + RD  L VL+ YP
Sbjct:  124 IVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNSDETTTLI--------------------------GLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAW--SYTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 525          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Match: unc-103 (Potassium voltage-gated channel unc-103 [Source:UniProtKB/Swiss-Prot;Acc:G5EFJ9])

HSP 1 Score: 145.976 bits (367), Expect = 1.419e-35
Identity = 112/430 (26.05%), Postives = 199/430 (46.28%), Query Frame = 1
Query: 1174 IFNCISDTIFLLDIFVNFRTGVIT-NDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLR-DYPSDSWV--IKCKLKEAYWF-------------DQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            I + I D +F++DI +NFRT  +  ND A +++  P +IA +Y K WF +D ++++P D + +  N  E    I                           +   ++   L+ VA K       G   L+LLM    L+ HW AC+ + I      +   +W+  +  +L + Y                +Y  +L+  +S + SIG+G    T+  E   TI+ M+ G+  YA   G+ +A+IQ   +    Y  +  ++ E++ + ++P  LRQR+  Y++H +     N +D   +L    +CL+  I  +  R L++    F  +    +  + ++ +     PGD ++  G++ T +YFI  G V+I+  +  V   L     FGE  LL +   +   +VRA TYC+++ + RD  L VL+ YP
Sbjct:  138 IVDLIVDIMFIVDIIINFRTTYVNENDEACQVVSDPGKIATHYFKGWFIIDMVAAVPFDLLLVSTNSDETTTLI--------------------------GLLKTARLLRLVRVARKLDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGSAELSHKEYTWLHQLSKQLAQPYTSTNGTIPTGGPTLKSRYVTSLYFTLSTITSIGFGNVSATTDSEKIFTIIMMILGSLMYASVFGNVSAIIQRLYSGTARYHTEMSRLREFIRFHQIPNPLRQRLEEYFQHAWS--YTNGIDMNLVLKGFPDCLQADICLHLNRNLLSGCAAFAGSTPGCLRALSMRFRTTHSPPGDTLVHRGDILTGLYFIARGSVEILNDDNTVMGILGKDDIFGENPLLYDEVGKSSCNVRALTYCDLHKILRDDLLDVLDMYP 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0100369)

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 366/524 (69.85%), Postives = 447/524 (85.31%), Query Frame = 1
Query:  901 NRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNK--KEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEEL--LNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQD 2460
            + + ++++LK Q  S+FQP+DN+LAMKLFG++ AL KE+ RQ+  G WVIHPCS+FRFYWDL ML LL+ANLIILPVAISFFNDDLS +WI FNC+SDTIFL+DI VNFRTG++  D A+++IL PK IA++YL++WF LD ISSIPLDYIFLI N+   + F QI+HAGRALRILRLAKLLSL+RLLRLSRLVRYVSQWEE+  LN+AS F+ IFNL+ +MLL+GHW+ CLQFL+PML+ +PS+SWV   +L+E+YW +QY+WALFKAMSHML IGYGR+PP S+ + W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK F+E  IL ELSE LRE +INYNCR+LVA+VPFF  AD NFVS+VV KL+YEVFQPGD+IIKEG +GT+MYFIQEG+VDI+   GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN++SL  D F  VL+ YPLMR+TME+VAAERL KIG+NP ++  + +
Sbjct:  697 SEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1219          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290109)

HSP 1 Score: 712.605 bits (1838), Expect = 0.000e+0
Identity = 367/528 (69.51%), Postives = 448/528 (84.85%), Query Frame = 1
Query:  901 NRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILN---KKEYFN---QIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEEL--LNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQD 2460
            + + ++++LK Q  S+FQP+DN+LAMKLFG++ AL KE+ RQ+  G WVIHPCS+FRFYWDL ML LL+ANLIILPVAISFFNDDLS +WI FNC+SDTIFL+DI VNFRTG++  D A+++IL PK IA++YL++WF LD ISSIPLDYIFLI N   K + F+   QI+HAGRALRILRLAKLLSL+RLLRLSRLVRYVSQWEE+  LN+AS F+ IFNL+ +MLL+GHW+ CLQFL+PML+ +PS+SWV   +L+E+YW +QY+WALFKAMSHML IGYGR+PP S+ + W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK F+E  IL ELSE LRE +INYNCR+LVA+VPFF  AD NFVS+VV KL+YEVFQPGD+IIKEG +GT+MYFIQEG+VDI+   GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN++SL  D F  VL+ YPLMR+TME+VAAERL KIG+NP ++  + +
Sbjct:  697 SEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQIMKLQDFSDSFQILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNPNIMHQKDE 1224          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0290292)

HSP 1 Score: 703.36 bits (1814), Expect = 0.000e+0
Identity = 366/517 (70.79%), Postives = 443/517 (85.69%), Query Frame = 1
Query:  898 ANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNK--KEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEEL--LNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNP 2436
             + + ++++LK Q  S+FQP+DN+LAMKLFG++ AL KE+ RQ+  G WVIHPCS+FRFYWDL ML LL+ANLIILPVAISFFNDDLS +WI FNC+SDTIFL+DI VNFRTG++  D A+++IL PK IA++YL++WF LD ISSIPLDYIFLI N+   + F QI+HAGRALRILRLAKLLSL+RLLRLSRLVRYVSQWEE+  LN+AS F+ IFNL+ +MLL+GHW+ CLQFL+PML+ +PS+SWV   +L+E+YW +QY+WALFKAMSHML IGYGR+PP S+ + W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK F+E  IL ELSE LRE +INYNCR+LVA+VPFF  AD NFVS+VV KL+YEVFQPGD+IIKEG +GT+MYFIQEG+VDI+   GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN++SL  D F  VL+ YPLMR+TME+VAAERL KIG+NP
Sbjct:    7 VSEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNP 522          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0308835)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 366/517 (70.79%), Postives = 443/517 (85.69%), Query Frame = 1
Query:  898 ANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNK--KEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEEL--LNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNP 2436
             + + ++++LK Q  S+FQP+DN+LAMKLFG++ AL KE+ RQ+  G WVIHPCS+FRFYWDL ML LL+ANLIILPVAISFFNDDLS +WI FNC+SDTIFL+DI VNFRTG++  D A+++IL PK IA++YL++WF LD ISSIPLDYIFLI N+   + F QI+HAGRALRILRLAKLLSL+RLLRLSRLVRYVSQWEE+  LN+AS F+ IFNL+ +MLL+GHW+ CLQFL+PML+ +PS+SWV   +L+E+YW +QY+WALFKAMSHML IGYGR+PP S+ + W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK F+E  IL ELSE LRE +INYNCR+LVA+VPFF  AD NFVS+VV KL+YEVFQPGD+IIKEG +GT+MYFIQEG+VDI+   GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN++SL  D F  VL+ YPLMR+TME+VAAERL KIG+NP
Sbjct:   24 VSEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNP 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Match: Ih (gene:FBgn0263397 transcript:FBtr0308836)

HSP 1 Score: 702.975 bits (1813), Expect = 0.000e+0
Identity = 366/517 (70.79%), Postives = 443/517 (85.69%), Query Frame = 1
Query:  898 ANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNK--KEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEEL--LNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNP 2436
             + + ++++LK Q  S+FQP+DN+LAMKLFG++ AL KE+ RQ+  G WVIHPCS+FRFYWDL ML LL+ANLIILPVAISFFNDDLS +WI FNC+SDTIFL+DI VNFRTG++  D A+++IL PK IA++YL++WF LD ISSIPLDYIFLI N+   + F QI+HAGRALRILRLAKLLSL+RLLRLSRLVRYVSQWEE+  LN+AS F+ IFNL+ +MLL+GHW+ CLQFL+PML+ +PS+SWV   +L+E+YW +QY+WALFKAMSHML IGYGR+PP S+ + W+T++SM++GATCYALF+GHA  LIQS D+S+R YREK KQVEEYMAYRKLPR +RQRI  Y+EHRYQGK F+E  IL ELSE LRE +INYNCR+LVA+VPFF  AD NFVS+VV KL+YEVFQPGD+IIKEG +GT+MYFIQEG+VDI+   GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN++SL  D F  VL+ YPLMR+TME+VAAERL KIG+NP
Sbjct:   24 VSEKVSANFLKSQLQSWFQPTDNRLAMKLFGSRKALVKERIRQKTSGHWVIHPCSSFRFYWDLCMLLLLVANLIILPVAISFFNDDLSTRWIAFNCLSDTIFLIDIVVNFRTGIMQQDNAEQVILDPKLIAKHYLRTWFFLDLISSIPLDYIFLIFNQDFSDSF-QILHAGRALRILRLAKLLSLVRLLRLSRLVRYVSQWEEVYFLNMASVFMRIFNLICMMLLIGHWSGCLQFLVPMLQGFPSNSWVSINELQESYWLEQYSWALFKAMSHMLCIGYGRFPPQSLTDMWLTMLSMISGATCYALFLGHATNLIQSLDSSRRQYREKVKQVEEYMAYRKLPRDMRQRITEYFEHRYQGKFFDEELILGELSEKLREDVINYNCRSLVASVPFFANADSNFVSDVVTKLKYEVFQPGDIIIKEGTIGTKMYFIQEGVVDIVMANGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLFSLSVDHFNCVLDQYPLMRKTMETVAAERLNKIGKNP 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 300/522 (57.47%), Postives = 394/522 (75.48%), Query Frame = 1
Query:  877 EDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            E I  DD  R   + ++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D A EIIL P+QI   YL+SWF +DFISSIP+DYIFLI+  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P+D WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:  160 EQILPDD-ERYYQAGFMHRQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNA-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLIVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGK 677          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn2b (hyperpolarization activated cyclic nucleotide-gated potassium channel 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8228])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 300/561 (53.48%), Postives = 412/561 (73.44%), Query Frame = 1
Query:  856 SDEFGCYED--ITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            S  F   ED  IT +D   +   +Y++ QF +  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF ++ +  WIIFN +SDT FL+D+ +NFRTG++  D   EIIL P++I + YLK+WF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV   K+    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+E LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G +   LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + L+   + DL   +      ++++EIV
Sbjct:   57 SVSFSKSEDGQITAEDGEARDNQTYMQRQFSAMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKEETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYEDNT-EIILDPEKIKKKYLKTWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHKVQHDLNSGVFNNRENEMIQEIV 614          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4l (hyperpolarization activated cyclic nucleotide-gated potassium channel 4l [Source:ZFIN;Acc:ZDB-GENE-110411-3])

HSP 1 Score: 572.778 bits (1475), Expect = 0.000e+0
Identity = 292/507 (57.59%), Postives = 386/507 (76.13%), Query Frame = 1
Query:  925 LKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQN 2433
            LK    +F  P  NK ++++FG++ A+  E+ R +  G W+IHP S+FRFYWDL+ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D + EIIL P+QI   YL+SWFA+DF+SSIP+DYIFLI+  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+II++NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G++ ++TK G   T +SDGSYFGEICLLT  RR ASVRA+TYC +YSL  D F  VLE YP+MRR  E+VA +RL +IG++
Sbjct:   18 LKRHLFTFLLPGVNKFSLRMFGSEKAVEHEQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQQIKVRYLRSWFAVDFLSSIPVDYIFLIVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGES 521          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn2b (hyperpolarization activated cyclic nucleotide-gated potassium channel 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8228])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 290/521 (55.66%), Postives = 395/521 (75.82%), Query Frame = 1
Query:  883 ITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQN 2433
            IT +D   +   +Y++ QF +  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF ++ +  WIIFN +SDT FL+D+ +NFRTG++  D   EIIL P++I + YLK+WF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV   K+    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+E LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G +   LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG++
Sbjct:  123 ITAEDGEARDNQTYMQRQFSAMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKEETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYEDNT-EIILDPEKIKKKYLKTWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKS 640          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 296/527 (56.17%), Postives = 390/527 (74.00%), Query Frame = 1
Query:  877 EDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL---------NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            E I  DD  R   + ++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D A EIIL P+QI   YL+SWF +DFISSIP+DYIFLI+  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+      +         ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P+D WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:  140 EQILPDD-ERYYQAGFMHRQFGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNA-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLIVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHHTHTTILHLIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVAKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGK 662          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054882.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 298/533 (55.91%), Postives = 397/533 (74.48%), Query Frame = 1
Query:  895 DANRQTTS-------SYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQ 2457
            D   QT S       S++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF ++ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R AK+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    ++ A W  QY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD +I+EG +G +M+FIQ G+V I++K G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D F  VLE YP+MRR  ESVA +RL +IG +N LL+   Q
Sbjct:  162 DGREQTLSGGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLEDNT-EIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETR-IDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKKNSLLLHKVQ 691          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054880.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 298/533 (55.91%), Postives = 397/533 (74.48%), Query Frame = 1
Query:  895 DANRQTTS-------SYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQ 2457
            D   QT S       S++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF ++ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R AK+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    ++ A W  QY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD +I+EG +G +M+FIQ G+V I++K G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D F  VLE YP+MRR  ESVA +RL +IG +N LL+   Q
Sbjct:   57 DGREQTLSGGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLEDNT-EIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETR-IDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKKNSLLLHKVQ 586          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054883.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 294/519 (56.65%), Postives = 393/519 (75.72%), Query Frame = 1
Query:  916 SSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQ 2457
             S++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF ++ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R AK+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    ++ A W  QY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD +I+EG +G +M+FIQ G+V I++K G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D F  VLE YP+MRR  ESVA +RL +IG +N LL+   Q
Sbjct:   46 GSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLEDNT-EIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETR-IDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKKNSLLLHKVQ 561          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: ENSXETT00000054879.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 [Source:NCBI gene;Acc:100495521])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 298/533 (55.91%), Postives = 397/533 (74.48%), Query Frame = 1
Query:  895 DANRQTTS-------SYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQ 2457
            D   QT S       S++  QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF ++ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R AK+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    ++ A W  QY++ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  LRQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD +I+EG +G +M+FIQ G+V I++K G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D F  VLE YP+MRR  ESVA +RL +IG +N LL+   Q
Sbjct:   10 DGREQTLSGGEDEQGSFMHRQFGALLQPGVNKFSLRMFGSQKAVEREQDRVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKEENTPAWIVFNVVSDTFFLVDLVLNFRTGIVLEDNT-EIILEPQRIKIRYLKSWFLVDFVSSIPVDYIFLIVETR-IDSEVYKTARALRIVRFAKVLSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSLNHMQNASWGKQYSYALFKAMSHMLCIGYGQQAPVGMGDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADLRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYLIREGTVGKKMFFIQHGVVSILSK-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNEVLEEYPMMRRAFESVALDRLDRIGKKNSLLLHKVQ 539          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Match: cdh19 (cadherin 19, type 2 [Source:Xenbase;Acc:XB-GENE-6045915])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 291/519 (56.07%), Postives = 390/519 (75.14%), Query Frame = 1
Query:  922 YLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFN-QIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQD 2460
            +++ QF +  QP+ NK ++++FG+  A+  E++R +  G W+IHP S+FRFYWDL+ML L++ANLIILPV I+FF D+ +  WI+FN +SDT FL D+ +NFRTG++  D   EIIL P  I   YLKSWF +DF+SSIP+DYIFLI++ +   + ++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY+ A+FKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI  YYEHRYQGKMF+E +IL ELSE L+E+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V I+T+ G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG +N +L+  R +
Sbjct:  347 FIQRQFGALLQPAVNKFSLRMFGSHKAVEIEQQRVKSAGSWIIHPYSDFRFYWDLIMLLLMVANLIILPVGITFFKDENTPPWIVFNVLSDTFFLADLVLNFRTGIVVEDNT-EIILDPHTIKMKYLKSWFLVDFVSSIPVDYIFLIVDLETNVDTEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPEDCWVSINHMANESWGKQYSHAIFKAMSHMLCIGYGQQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHEYYEHRYQGKMFDEENILGELSEPLKEEIVNFNCRNLVANMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVVSILTR-GSKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAMDRLDRIGKKNSILLRKRAE 863          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn4 (hyperpolarization-activated, cyclic nucleotide-gated K+ 4 [Source:MGI Symbol;Acc:MGI:1298209])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 301/565 (53.27%), Postives = 408/565 (72.21%), Query Frame = 1
Query:  841 DVNIQSDEFGCYEDITFDDAN-RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            D  I+ +      D    +A  R   S +++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DFISSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY++ALFKAMSHML IGYGR  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL   +      +++++IV
Sbjct:  185 DTAIKVEGGAAASDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNT-EIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETR-IDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQENEIIQQIV 746          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn1 (hyperpolarization activated cyclic nucleotide gated potassium channel 1 [Source:MGI Symbol;Acc:MGI:1096392])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 293/525 (55.81%), Postives = 395/525 (75.24%), Query Frame = 1
Query:  868 GCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            G +ED   +   RQ    +++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWDL+ML +++ NL+I+PV I+FF +  +  WIIFN  SDT+FLLD+ +NFRTG +  D + EIIL PK I  NYLKSWF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+P+L+D+P D WV   ++    W  QY++ALFKAMSHML IGYG   P S+ + WIT++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+F+E +IL+EL++ LRE+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+  +ITK  +    L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:   68 GSFEDA--EGPRRQY--GFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIV-EKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILSELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK 585          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 292/543 (53.78%), Postives = 403/543 (74.22%), Query Frame = 1
Query:  904 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            R + +S+L+ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I + YL++WF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV    +    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+  LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G     LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL+  +       +++EIV
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNT-EIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQENAIIQEIV 668          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn2 (hyperpolarization-activated, cyclic nucleotide-gated K+ 2 [Source:MGI Symbol;Acc:MGI:1298210])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 292/543 (53.78%), Postives = 403/543 (74.22%), Query Frame = 1
Query:  904 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            R + +S+L+ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I + YL++WF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV    +    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+  LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G     LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL+  +       +++EIV
Sbjct:  129 RGSQASFLQRQFGALLQPGVNKFSLRMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNT-EIILDPEKIKKKYLRTWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPSDCWVSINNMVNHSWSELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLHKVQHDLSSGVFNNQENAIIQEIV 668          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Match: Hcn3 (hyperpolarization-activated, cyclic nucleotide-gated K+ 3 [Source:MGI Symbol;Acc:MGI:1298211])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 279/507 (55.03%), Postives = 382/507 (75.35%), Query Frame = 1
Query:  928 KEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFN-QIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQN 2433
            + Q  +  QP+ NK ++++FG+  A+  E+ R +  G W+IHP S+FRFYWDL+ML L++ NLI+LPV I+FF ++ S  WI+FN +SDT FLLD+ +NFRTG++  + A EI+L P+ I   YL++WF +D ISSIP+DYIFL++  +   + ++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+PML+D+PSD WV   ++    W  QY+ ALFKAMSHML IGYG+  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI  YYEHRYQGKMF+E  IL ELSE LRE+IIN+ CR LVA +P F +AD +FV+ V+ KL++EVFQPGDL+++EG++G +MYFIQ G++ ++ + G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D F +VLE +P+MRR  E+VA +RL +IG+ 
Sbjct:   45 RRQLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGA-EILLAPRAIRTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSMNRMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLAR-GARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVAMDRLRRIGKK 549          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9TV66|HCN4_RABIT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Oryctolagus cuniculus OX=9986 GN=HCN4 PE=2 SV=1)

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 312/634 (49.21%), Postives = 426/634 (67.19%), Query Frame = 1
Query:  841 DVNIQSDEFGCYEDITFDDAN-RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNGRRK------------SVIQIGLEKFNNMRTKAAAGIAKRKLSREMFRKQSSPGALST 2685
            D  ++ +      D    +A  R   + +++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D  D IIL P++I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY++ALFKAMSHML IGYGR  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL+  +   +E       +  D E    H  RR              +IQ  L+      + A A     +L   +FR    P  L +
Sbjct:  186 DAAVKVEGGAAAGDQILPEAEARLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNTD-IILDPRRIKMKYLKSWFVVDFVSSIPVDYIFLIVETR-IDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSLNNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPMGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLSSGVSNYQENAIVQRIVQHDREM--AHCARRAQATTPVAPAIWTPLIQAPLQAAAATTSVAIALTHHPRLPAAIFRPPPGPTTLGS 814          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9JKA7|HCN4_RAT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Rattus norvegicus OX=10116 GN=Hcn4 PE=1 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 301/565 (53.27%), Postives = 408/565 (72.21%), Query Frame = 1
Query:  841 DVNIQSDEFGCYEDITFDDAN-RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            D  I+ +      D    +A  R   S +++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DFISSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY++ALFKAMSHML IGYGR  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL   +      +++++IV
Sbjct:  185 DTAIKVEGGAAASDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNT-EIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVETR-IDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQENEIIQQIV 746          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9Y3Q4|HCN4_HUMAN (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Homo sapiens OX=9606 GN=HCN4 PE=1 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 300/567 (52.91%), Postives = 408/567 (71.96%), Query Frame = 1
Query:  841 DVNIQSDEFGCYEDITFDDAN-RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIVNE 2502
            D  I+ +      D    +A  R   + +++ QF +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P++I   YLKSWF +DFISSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W  QY++ALFKAMSHML IGYGR  P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQRI +YYEHRYQGKMF+E  IL ELSE LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + LL   + DL   +      +++++IV  
Sbjct:  185 DTAIKVEGGAAAGDQILPEAEVRLGQAGFMQRQFGAMLQPGVNKFSLRMFGSQKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNVVSDTFFLIDLVLNFRTGIVVEDNT-EIILDPQRIKMKYLKSWFMVDFISSIPVDYIFLIVETR-IDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPDDCWVSINNMVNNSWGKQYSYALFKAMSHMLCIGYGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLADGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSILLHKVQHDLNSGVFNYQENEIIQQIVQH 748          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|O60741|HCN1_HUMAN (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Homo sapiens OX=9606 GN=HCN1 PE=1 SV=3)

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 294/525 (56.00%), Postives = 395/525 (75.24%), Query Frame = 1
Query:  868 GCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            G +ED   +   RQ    +++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWDL+ML +++ NL+I+PV I+FF +  +  WIIFN  SDT+FLLD+ +NFRTG +  D + EIIL PK I  NYLKSWF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+P+L+D+P D WV   ++    W  QY++ALFKAMSHML IGYG   P S+ + WIT++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+F+E +ILNEL++ LRE+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+  +ITK  +    L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:   79 GGFEDA--EGPRRQY--GFMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIV-EKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK 596          
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Match: sp|Q9MZS1|HCN1_RABIT (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 OS=Oryctolagus cuniculus OX=9986 GN=HCN1 PE=2 SV=2)

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 299/551 (54.26%), Postives = 405/551 (73.50%), Query Frame = 1
Query:  922 YLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG-QNPLLVSTRQD--------------LTEDLKLVKEIVNESSPIS 2517
            +++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWDL+ML +++ NL+I+PV I+FF +  +  WIIFN  SDT+FLLD+ +NFRTG +  D + EIIL PK I  NYLKSWF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+P+L+D+P D WV   ++    W  QY++ALFKAMSHML IGYG   P S+ + WIT++SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I +YYEHRYQGK+F+E +ILNEL++ LRE+I+N+NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+  +ITK  +    L+DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG +N +L+   Q               L + +K  +E+V   +PIS
Sbjct:   29 FMQRQFTSMLQPGVNKFSLRMFGSQKAVEKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNVASDTVFLLDLIMNFRTGTVNED-SSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIV-EKGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIGYGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANADPNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSK-EMKLTDGSYFGEICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPIS 576          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GGH4 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g4 PE=4 SV=1)

HSP 1 Score: 897.501 bits (2318), Expect = 0.000e+0
Identity = 464/587 (79.05%), Postives = 514/587 (87.56%), Query Frame = 1
Query:  904 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDD------------------------ESFNEHNGRRKSVIQIGLEKFN 2592
            +Q+TSSYLKEQF +FFQPSDNKLAMKLFGNKNAL KEKRRQQQ GKW+IHPCSNFRFYWDLLML LLI NL++LPVAISFFNDDLS +WIIFNC+SDTIFL DI VNFRTGVITND+A+EI+L PK IAQ+Y+KSWF LD ISSIP+DYIFL+LN++   +Q+MHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEE   +ASK  GI  LVL+M+LLGHWNAC QFLIP L D+P DSWV K  LKEA+WF QYTWALFKAMSHMLSIGYG++PPTSI EAWITIVSMMTG++CYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMFNE DIL+ELSECLREQIINYNCRALVAAVPFFTYADQ+FVSEVV +L+YEVFQPGDLIIKEG +GT+MYFIQEGIVDIIT++GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN+YSL+R++FLSVL+NYPLMRRTMESVAAERL KIGQNP LVS+R DL EDL LVKEIVN+ +P +SDD                        +S   H  RRKSV+++GL+K  
Sbjct:  292 KQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLNQRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEEFFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESVAAERLSKIGQNPQLVSSRADLKEDLNLVKEIVNQVTPATSDDNDDSCGGGAGAGACGGSAVCGDGKKSSPPHTERRKSVVKLGLQKLG 878          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A267GPW9 (Cyclic nucleotide-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003625g3 PE=4 SV=1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 464/587 (79.05%), Postives = 514/587 (87.56%), Query Frame = 1
Query:  904 RQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDD------------------------ESFNEHNGRRKSVIQIGLEKFN 2592
            +Q+TSSYLKEQF +FFQPSDNKLAMKLFGNKNAL KEKRRQQQ GKW+IHPCSNFRFYWDLLML LLI NL++LPVAISFFNDDLS +WIIFNC+SDTIFL DI VNFRTGVITND+A+EI+L PK IAQ+Y+KSWF LD ISSIP+DYIFL+LN++   +Q+MHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEE   +ASK  GI  LVL+M+LLGHWNAC QFLIP L D+P DSWV K  LKEA+WF QYTWALFKAMSHMLSIGYG++PPTSI EAWITIVSMMTG++CYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMFNE DIL+ELSECLREQIINYNCRALVAAVPFFTYADQ+FVSEVV +L+YEVFQPGDLIIKEG +GT+MYFIQEGIVDIIT++GEVATSLSDGSYFGEICLLTNARRVASVRAETYCN+YSL+R++FLSVL+NYPLMRRTMESVAAERL KIGQNP LVS+R DL EDL LVKEIVN+ +P +SDD                        +S   H  RRKSV+++GL+K  
Sbjct:  296 KQSTSSYLKEQFFAFFQPSDNKLAMKLFGNKNALLKEKRRQQQSGKWIIHPCSNFRFYWDLLMLVLLITNLVVLPVAISFFNDDLSPQWIIFNCVSDTIFLSDIAVNFRTGVITNDFAEEIVLDPKMIAQHYMKSWFFLDLISSIPMDYIFLVLNQRNNMSQLMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEEFFQIASKCFGIIKLVLIMMLLGHWNACFQFLIPFLNDFPPDSWVAKRGLKEAHWFRQYTWALFKAMSHMLSIGYGQHPPTSISEAWITIVSMMTGSSCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFNENDILSELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTRLKYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITRDGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNLYSLERENFLSVLDNYPLMRRTMESVAAERLSKIGQNPQLVSSRADLKEDLNLVKEIVNQVTPATSDDNDDSCGGGAGAGACGGSAVCGDGKKSSPPHTERRKSVVKLGLQKLG 882          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A4Z2DGN8 (Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001166 PE=4 SV=1)

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 453/546 (82.97%), Postives = 497/546 (91.03%), Query Frame = 1
Query:  895 DANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDES 2532
            D  +Q+TSSYLKEQF +FFQPSDNKLAMKLFG+KNAL KEKRRQ QQGKWVIHPCSNFRFYWDLLML LLIANLIILPVAISFFNDDLS+ WIIFN ISD +F+ DI V FRTGV+ NDYADEIIL PK+IA++YLKSWF LDFISSIP+DY++LI NKK+++NQ   AGR LRILRLAKLLS+LRLLRL+RLVRYVSQWEE LN+ASKF+GIFNLVLLMLLLGHWNACLQ+LIPML ++P DSWV +CKL+ A WF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMM+GATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  ILNE SECLREQ+INYNCRALVAAVPFFTYADQ+FVSEVV KL++EVFQPGDLIIKEG +G +MYFIQEGIVDIITK+GEVATSLSDGSYFGEI LLTNARRVASV+A  Y N+YSLDR+SFLSVLENYPLMRRTMESVAAERL KIGQNP +VS R+DL EDL LVKEIV  SS ++ +D S
Sbjct:  589 DPLKQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGVVANDYADEIILNPKEIARHYLKSWFVLDFISSIPMDYLYLIFNKKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMEFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNARRVASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESVAAERLNKIGQNPSIVSNREDLKEDLSLVKEIV--SSAVTPEDSS 1132          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: A0A3Q0KVG7 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 452/546 (82.78%), Postives = 496/546 (90.84%), Query Frame = 1
Query:  895 DANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDES 2532
            D  +Q+TSSYLKEQF +FFQPSDNKLAMKLFG+KNAL KEKRRQ QQGKWVIHPCSNFRFYWDLLML LLIANLIILPVAISFFNDDLS+ WIIFN ISD +F+ DI V FRTG++TNDYADEIIL PK+IA++YLKSWF LDFISSIP+DY++LI NKK+++NQ   AGR LRILRLAKLLS+LRLLRL+RLVRYVSQWEE LN+ASKF+GIFNLVLLMLLLGHWNACLQ+LIPML D+P DSWV +CKL+ A WF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMM+GATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  ILNE SECLREQ+INYNCRALVAAVPFFTYADQ+FVSEVV KL++EVFQPGDLIIKEG +G +MYFIQEGIVDIITK+GEVATSLSDGSYFGEI LLTN RR ASV+A  Y N+YSLDR+SFLSVLENYPLMRRTMESVAAERL KIGQNP +VS R+DL EDL LVKEIV  SS ++ +D S
Sbjct:  593 DPLKQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGIVTNDYADEIILNPKEIARHYLKSWFILDFISSIPMDYLYLIFNKKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMDFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNTRRTASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESVAAERLNKIGQNPSIVSNREDLKEDLSLVKEIV--SSAVTPEDSS 1136          
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Match: G4M0M0 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_212410 PE=4 SV=1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 452/546 (82.78%), Postives = 496/546 (90.84%), Query Frame = 1
Query:  895 DANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDES 2532
            D  +Q+TSSYLKEQF +FFQPSDNKLAMKLFG+KNAL KEKRRQ QQGKWVIHPCSNFRFYWDLLML LLIANLIILPVAISFFNDDLS+ WIIFN ISD +F+ DI V FRTG++TNDYADEIIL PK+IA++YLKSWF LDFISSIP+DY++LI NKK+++NQ   AGR LRILRLAKLLS+LRLLRL+RLVRYVSQWEE LN+ASKF+GIFNLVLLMLLLGHWNACLQ+LIPML D+P DSWV +CKL+ A WF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMM+GATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  ILNE SECLREQ+INYNCRALVAAVPFFTYADQ+FVSEVV KL++EVFQPGDLIIKEG +G +MYFIQEGIVDIITK+GEVATSLSDGSYFGEI LLTN RR ASV+A  Y N+YSLDR+SFLSVLENYPLMRRTMESVAAERL KIGQNP +VS R+DL EDL LVKEIV  SS ++ +D S
Sbjct:  593 DPLKQSTSSYLKEQFQAFFQPSDNKLAMKLFGSKNALLKEKRRQVQQGKWVIHPCSNFRFYWDLLMLMLLIANLIILPVAISFFNDDLSIHWIIFNSISDVVFIADIAVKFRTGIVTNDYADEIILNPKEIARHYLKSWFILDFISSIPMDYLYLIFNKKDHYNQFFSAGRTLRILRLAKLLSMLRLLRLTRLVRYVSQWEEFLNIASKFMGIFNLVLLMLLLGHWNACLQYLIPMLMDFPPDSWVKRCKLENADWFQQYTWALFKAMSHMLSIGYGRFPPTSIGEAWITIVSMMSGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEAQILNEFSECLREQVINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTIGNKMYFIQEGIVDIITKDGEVATSLSDGSYFGEITLLTNTRRTASVKAVVYSNLYSLDRESFLSVLENYPLMRRTMESVAAERLNKIGQNPSIVSNREDLKEDLSLVKEIV--SSAVTPEDSS 1136          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 297/547 (54.30%), Postives = 405/547 (74.04%), Query Frame = 1
Query:  892 DDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            DD   +   ++++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WIIFN +SDT FL+D+ +NFRTG++  D   EIIL PKQI + YL++WF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV   K+    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+E LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQP D II+EG +G +MYFIQ G+V ++TK G +   LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL ++G+  + L+   + DL   +      +L++EIV
Sbjct:  155 DDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYEDNT-EIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRLGKKNSILMHKVQHDLNSGVFNNHENELIQEIV 698          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 294/516 (56.98%), Postives = 389/516 (75.39%), Query Frame = 1
Query:  895 DANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            D  R   + ++  Q  +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL+ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D + EIIL P+ I   YL+SWFA+DFISSIP+DYIFLI+  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+II++NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G++ ++TK G   T +SDGSYFGEICLLT  RR ASVRAETYC +YSL  D F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:  152 DEERLYQAGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGK 664          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn4l (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3-like [Source:NCBI gene;Acc:103030119])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 294/516 (56.98%), Postives = 389/516 (75.39%), Query Frame = 1
Query:  895 DANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            D  R   + ++  Q  +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL+ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D + EIIL P+ I   YL+SWFA+DFISSIP+DYIFLI+  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+II++NCR LVA +P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G++ ++TK G   T +SDGSYFGEICLLT  RR ASVRAETYC +YSL  D F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:  173 DEERLYQAGFMHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLIMLLLMVGNLIIIPVGITFFKDEHTPAWIVFNVVSDTFFLVDLVLNFRTGIVKED-STEIILDPQLIKVRYLRSWFAVDFISSIPVDYIFLIVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIISFNCRKLVATMPLFANADPNFVTSMLTKLRFEVFQPGDYIIREGTVGKKMYFIQHGVLTVLTK-GSKETKISDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVALDRLDRIGK 685          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: hcn2b (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:103044493])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 297/547 (54.30%), Postives = 405/547 (74.04%), Query Frame = 1
Query:  892 DDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            DD   +   ++++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WIIFN +SDT FL+D+ +NFRTG++  D   EIIL PKQI + YL++WF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+PSD WV   K+    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+E LRE+I+N+NCR LVA++P F  AD NFV+ ++ KL++EVFQP D II+EG +G +MYFIQ G+V ++TK G +   LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL ++G+  + L+   + DL   +      +L++EIV
Sbjct:  107 DDGEARDAQTFMQRQFSSMLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIVYEDNT-EIILDPKQIKKKYLRTWFVVDFISSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIINLIGMMLLLCHWDGCLQFLVPMLQDFPSDCWVSLNKMVNDSWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPLDYIIREGTIGKKMYFIQHGVVSVLTK-GSIGMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRLGKKNSILMHKVQHDLNSGVFNNHENELIQEIV 650          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Match: ENSAMXT00000011919.2 (pep primary_assembly:Astyanax_mexicanus-2.0:10:25443689:25475024:1 gene:ENSAMXG00000011501.2 transcript:ENSAMXT00000011919.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 289/509 (56.78%), Postives = 388/509 (76.23%), Query Frame = 1
Query:  916 SSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFN-QIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG 2427
            S++++ QF +  QP  NK ++++FG+  A+  E+ R +  G W+IHP S+FRFYWDLLML L++ NLIILPV I+FF D+ +  WIIFN +SDT+FL+D+ +NFRTG++  D + EI+L PK I Q YLKSWF +DF+SSIP+DYIFL+++ +   + ++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV K  +    W  QY++ALFKAMSHML IGYG   P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I  YYEHRYQGKMF+E +IL ELSE L+E+I+++NCR+LVA +P F  AD NFV+ V+ KL++EVFQP D II+EG +G +MYFIQ G V ++T+ G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  DSF  VLE +P+MRR  E+VAA+RL +IG
Sbjct:  137 STFIQRQFGAMLQPGVNKFSLRMFGSHKAVALEQERLKSAGVWIIHPYSDFRFYWDLLMLLLMMGNLIILPVGITFFKDENTPPWIIFNVVSDTLFLVDLVLNFRTGIVKED-STEILLDPKAIRQRYLKSWFLVDFVSSIPVDYIFLMVDLEARLDSEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPIDCWVYKNNMVNDSWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADVRQKIHEYYEHRYQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANADPNFVTAVLTKLRFEVFQPNDFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETVAADRLNRIG 643          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007865.1 (pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 gene:ENSPMAG00000007113.1 transcript:ENSPMAT00000007865.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.728 bits (600), Expect = 8.507e-71
Identity = 145/287 (50.52%), Postives = 204/287 (71.08%), Query Frame = 1
Query: 1078 WDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL-NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWV--------------------IKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFK 1875
            WD++ML L++ NLI++PV I+FF+++ +  WI+FN +SDT FL+D+ +NFRTG++  D  D IIL P+ I   YLKSWF +DF+SSIP+DYIFLI+  +   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+  ++AS  + I NL+ +MLLL HW+ CLQFL+PML+++P D W+                    I    +   W  QY++ALFKAMSHML IGYG+  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK +
Sbjct:    1 WDIIMLLLMVGNLIVIPVGITFFHEEDTTAWIVFNVLSDTCFLVDLVLNFRTGIVVEDNTD-IILDPQVIKMRYLKSWFLVDFVSSIPVDYIFLIVETR-IDSEMYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEMTYDLASAVVRIVNLIAMMLLLCHWDGCLQFLVPMLQEFPHDCWISLNGMVVGLAASRTHLRFFAITPVCQNDSWGKQYSYALFKAMSHMLCIGYGQRAPVSMADLWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKMQ 285          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 2.553e-40
Identity = 137/513 (26.71%), Postives = 233/513 (45.42%), Query Frame = 1
Query:  967 KLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLK------------WIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKF-----IGIFNLVLLML---LLGHWNACLQFLIPMLRDYPSDS-------WV--IKCKLKEAY----------WFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELD---ILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEIC--LLTNARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            K+   L    + L + K +  +  KW I   S F+  WD L+L L+I   I  P   +F   D  ++              I + + D +F++DIF+NFRT  I  +  +E++  P +IA +Y K WF +D +++IP D +         F     +G    ++ L K                 ++   L+ VA K       G   LVLLM    L+ HW AC+ + I  + + P DS       W+  +  ++ + Y            D+Y  AL+   S + S+G+G   P +  E   +I  M+ G+  YA   G+ +A+IQ   +    Y  +  +V+E++ + ++P  LRQR+  Y++H +     N +D   +L    ECL+  I  +  R L+ +   F  A +  +  + +K +     PGD ++  G++ T MYF+  G ++I+ +E  V   L     FGE         +  A VRA TYC+++ + R+  L VL+ YP
Sbjct:   64 KVTQVLSLGADVLPEYKLQAPRIHKWTILHYSPFKAVWDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKN--EEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLI--------FGSGSGSGETTTLIGLLK----------------TARLLRLVRVARKLDRYSEYGAAVLVLLMCTFALIAHWLACIWYAIGNM-ERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWS--YTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEIL-REDIVVAILGKNDIFGEPVNQYSRPGKSSADVRALTYCDLHKIVREDMLEVLDMYP 546          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 150.599 bits (379), Expect = 2.033e-37
Identity = 127/481 (26.40%), Postives = 213/481 (44.28%), Query Frame = 1
Query: 1045 VIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXY----VSQWEELLNVASKF-----IGIFNLVLLMLLLG---HWNACLQFLIP----------MLRDYPSDSWVIKC--KLKEAYWFDQYTW------------ALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQ-GKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN--ARRVASVRAETYCNVYSLDRDSFLSVLENY 2370
            ++H C+ F+  WD ++L L     I++P  +SF     ++ W++ + + D IFL+DI +NF T  +    A E+I  PK I  NYLK+WF +D +S +P D I    N  E        G          L +  R+        +    V +   L  VA K       G   LVLL+ + G   HW AC+ + I           ++R +   SW+ +    +   Y F+   W            +L+  M+ + SIG+G   PT+  E    +  MM G+  YA   G+   + Q    +   Y E    V +++   ++P+GL +R+ +Y    +   K  +   +L+   + +R  I  +  R +    P F  A    +  + V+ Q     PGDLI   G     + F+  G +++I ++ EV   L  G  FG++       A   A+VRA TYC+++ + RD+ + VL+ Y
Sbjct:  190 ILHYCA-FKTTWDWIILILTFYTAIMVPYNVSFKTKQNNVAWLVVDSVVDVIFLVDIVLNFHTTFVGP--AGEVISDPKLIRMNYLKTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLDAWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKH---SWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVI-QDDEVVAILGKGDVFGDVFWKERVIAPSCANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 4.471e-25
Identity = 118/505 (23.37%), Postives = 233/505 (46.14%), Query Frame = 1
Query:  964 NKLAMK--LFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISF------FNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLML-LLGHWNACLQFLIPMLRDYPSD--SWVIKC------KLKEAYWFDQ----------YTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQ-GKMFNELDILNELSECLREQI-INYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFG------EICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            NKL +   +FG K +L + K    Q+ ++++     F+  WDLL+L       + +P  + F       +D  S    + +   + +F++DI +NFRT  ++   + +++   + I  +Y+ +WF +D I+++P D ++           ++H           K + LLRLLRL + +   SQ+  +         +  L++ M  LL HW AC+ + I       +D  SW I        KL+  +  +           Y  +L+ A+S + S+G+G     +  E   ++ +M+ GA  +A+  G+  A+IQ   + +  Y  + K +++++   +LP+ L+QR+  Y++  +      +  ++L +  + LR  I ++ N   L  A+  F  A +  +  + + ++     PG+ +I++G+     YF+  G ++++ K+  V   L  G   G      +  L TN    A V+A TYC++  +       VL+ YP
Sbjct:   21 NKLKINNNVFGEKPSLPEYKVAAIQKSRFILLHYGTFKAGWDLLILLATFYVAVTVPYNVCFSETVENISDPRSTA--VVDISVEILFIIDILLNFRTTYVSK--SGQVVYDGRSICVHYVTTWFFIDLIAALPFDLLYAF---NVSVTTLVHL---------LKTVRLLRLLRLLQNLDRYSQYSTV---------VLTLLMFMFGLLAHWMACIWYKIGRAEIEINDRHSWDIGWLHELGKKLETPFHTNNTGGGPSTRSAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKEILQLAI--FESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVL-KDDMVLAILGKGDLIGSDLSSKDQVLKTN----ADVKALTYCDLQCIHLRGLYDVLDLYP 493          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 104.375 bits (259), Expect = 1.289e-23
Identity = 74/278 (26.62%), Postives = 131/278 (47.12%), Query Frame = 1
Query: 1567 HWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGK-MFNELDILNELSECLREQI---INYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGE--VATSLSDGSYFGEICLLT---NARRVASVRAETYCNVYSLDRDSFLSVLENYP 2373
            H NAC  + +  +    S  WV   K    Y   +Y    + A+  +++IG G   P+++ E    + +   G    ++ +G    +I +    +  YR        YM    + R ++ R+  +YE+ +  + M +E ++L +L   +R +I   +NY    +V  V  F   D+  + +++++L+  V+ PGD + K+G LG  MY I+ G V ++       V  +L  GS FGEI LL      RR A+V A  + N++ LD+     +L  YP
Sbjct:  201 HLNACFYYFVSDMEGLGSTRWVYNGK---GY---RYIRCYYWAVKTLITIG-GLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYT---IVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGGGNRRTANVMAHGFANLFILDKRDLNEILRIYP 468          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 65.0846 bits (157), Expect = 2.275e-11
Identity = 32/84 (38.10%), Postives = 46/84 (54.76%), Query Frame = 1
Query: 2110 LQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVL 2361
            L  +++QPG+ II+EG+ G   Y I+ G VD+  K   V   L D  YFGE+ LL +  R A+V A     V +L +  F  +L
Sbjct:  318 LDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLL 401          

HSP 2 Score: 58.9214 bits (141), Expect = 1.609e-9
Identity = 31/86 (36.05%), Postives = 50/86 (58.14%), Query Frame = 1
Query: 2134 GDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTM 2391
            G  IIK+G+ G   Y +++G VD    + +V +S   GS FGE+ L+ N+ R A+V A + C +++LDR +F  +L      +R M
Sbjct:  208 GATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSS-GPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLM 292          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO34316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS0])

HSP 1 Score: 511.916 bits (1317), Expect = 6.196e-173
Identity = 273/496 (55.04%), Postives = 362/496 (72.98%), Query Frame = 1
Query:  943 SFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            S+ +P DNK+ MK+FG+K A+  E+ R  + G WVIHP S FR YWD+ +L LL+ NL  LPV ISFF D++S +WI FN +SDT FLLDI +NFRTGV+ +   ++ IL PK IA+ YLK+WF +D ISS+P+DYI     +      ++ A R L++LR AKLL LL+LLRLSRLVRYV Q+EE+LNV    I   NLV ++LL+ HWN CLQFL+P L+D+P  SWV    L +  W++QY W+LFKAMSHML IGYGRYPP +I E W+T  SM+TGAT YA+F+ +    IQ  D+  R YREK +Q+EEYM+YR+LP  LR R+  YY+HRYQG+MF+E  IL+E+S+ LREQIINYNCR LV +VPFFT A+ +FVS ++ +L +EV+  GD+I++EG LGT MYF++EG+V  +T  G+ A  L DG+YFGEICLLTNARR ASV A+T C+V+ L+ + F  V++ +P MR  ME VA +RL K+G+
Sbjct:    7 SWLKPMDNKMNMKVFGSKRAMKDEQLRYSRAG-WVIHPTSIFRLYWDMWVLLLLLINLFALPVLISFFADNVSARWIAFNAVSDTAFLLDILLNFRTGVLVHGSPNKFILDPKIIAKRYLKTWFFIDLISSLPIDYIVEAATQSST-KSLIGATRTLKLLRFAKLLGLLKLLRLSRLVRYVQQYEEILNVTRSVIRFINLVSIILLIAHWNGCLQFLVPYLQDFPETSWVSIHNLMDNDWWEQYCWSLFKAMSHMLCIGYGRYPPQNIAEVWVTTFSMLTGATFYAMFIAYCINFIQQLDSPGRNYREKIQQIEEYMSYRRLPVELRDRMTKYYDHRYQGRMFDEEKILHEISKPLREQIINYNCRDLVQSVPFFTEAEPDFVSAIITRLSFEVYLEGDIIVREGELGTEMYFLREGVVS-VTVGGKHANELCDGAYFGEICLLTNARRTASVTAKTVCDVFILNAEHFRDVVDEFPTMRILMEIVAEDRLNKMGK 499          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO49064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI02])

HSP 1 Score: 498.819 bits (1283), Expect = 6.128e-168
Identity = 264/495 (53.33%), Postives = 365/495 (73.74%), Query Frame = 1
Query:  961 DNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTN-ARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLL 2442
            DNKLA+KLFGNK A+  E+RRQ QQGK VIHP S FR+YWD+L++  +  ++++LPV+I+F +DDLS+ W+I N +SD  F++DIF+NFRTG++  +  +E+IL  K I+  YL+ WF +D  SS+P DY + I +       ++ A RALRIL+LAKLLSLLRLLR+SRLVRY++++EELLN+A   + I  L+  ML+L HWN C+QF +P L+++P DSWV    LK A   +QY+W+LF+A+SHML IGYG YPP ++ + W+T+ SM  GAT YA+F+G  ++LI S D+S RL+ EK  QVEEYM YRKLP  +R ++ ++YEHR+  K+F+E  IL ELS+ LRE I+ +N + L+  VPFF+ A  +F++++V KL++EVF  GD I + G+ G +MYFIQ+GIVDI+T+EG +ATSL DGS+FGEICLLT  ARRVASVRA T C+VYSL    F  VL++YP M+  +E VA ERL ++G  P L
Sbjct:    1 DNKLALKLFGNKAAVMLEQRRQSQQGKGVIHPFSTFRWYWDILLIIFIFMHVLLLPVSIAFLSDDLSIHWLILNGVSDVFFVVDIFLNFRTGIVDPNNQEEVILDKKVISMMYLRGWFIIDLASSLPFDYAYFIASSTTEEQTLLRASRALRILKLAKLLSLLRLLRVSRLVRYMTRFEELLNIAKGQLRIMKLICCMLVLSHWNGCIQFFVPYLQEFPDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHYPPQNLTDLWLTVCSMTAGATFYAVFIGIMSSLIMSIDSSGRLFNEKLNQVEEYMRYRKLPLRIRLQVQDFYEHRFHHKLFDEDAILTELSKNLRETILVHNIKPLLTTVPFFSGASISFITDIVTKLKFEVFLNGDYICRSGHRGDKMYFIQKGIVDILTREGALATSLGDGSHFGEICLLTKEARRVASVRAATTCDVYSLSATHFHEVLQDYPEMKSVLEEVAKERLSRLGLKPKL 495          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 162.155 bits (409), Expect = 6.808e-43
Identity = 128/432 (29.63%), Postives = 209/432 (48.38%), Query Frame = 1
Query: 1168 WIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVP--KQIAQNYLKSW-FALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKC-------KLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKM-FNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEG-EVATSLSDGSYFGEICLLT----NARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERL 2415
            W + + I D I+ +DI V FRT      Y D+ +LV   K++ QNYL +  F LD IS +P D+++  L            G    + RL +LL + R+++L +     S +  LL         F +VL++LL+ HWNAC  F I     + SD WV          KL   Y +  Y W+     + M+  G    PP +  E    +  +  G   +A  VG   A++     ++  +      +++YM   K+   L++R+ ++ ++ +  K   +   IL +L E LR QI  +   A++  VP F   +   + E+VVKL+ +VF PGD I ++G++G  MY +  G + ++  +G  V   LS+GSYFGEI +L       RR A+VR+  + ++  L +D  L  + +YP  R  +E    E L
Sbjct:   36 WFVMDYICDIIYGMDIMVEFRTA-----YLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGL------------GTRFTLCRLLRLLRIHRVVKLFQRGETKSSYPNLLQT-------FAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNNYDKLSRQYLYSFY-WS-----TRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVVGDDGTTVLAILSEGSYFGEISILNLSGIGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELL 437          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 157.918 bits (398), Expect = 1.804e-41
Identity = 117/446 (26.23%), Postives = 224/446 (50.22%), Query Frame = 1
Query: 1147 NDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIIL--VPKQIAQNYLKSW-FALDFISSIPLDYIFLILNKKEYF--NQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASK-----FIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQ------YTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMF-NELDILNELSECLREQI-INYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEG-EVATSLSDGSYFGEICLLTNA----RRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERL 2415
            ND ++  W+I +   D I++ DI V+ RTG     + +E IL     ++ ++YL ++ F LD  + IPLD  ++ +  +  F  N+I+                            +   W  L    S+      + + +LV  +LL+ HWNAC+ F++     + SD WV     +E     +      Y ++ + +   + +IG    PP S  E  I  +  + G   +A  VG+   +I + + ++  ++ K   ++ YM + K+P+ L++R+  ++++ +  K   +E +IL  L + LR +I IN +  +L   V  F   +  F+ E+V++L+ ++F PGD + ++G +G  MY +  G ++++++ G ++   L  GSYFGEI +L+ +    RR ASVR+  Y  ++ L ++  + VL+ YP ++  +E +A E+L
Sbjct:   33 NDKITYIWLILDYSCDLIYIADILVSMRTG-----FLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPAFRINRILK---------------------------FHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTISRMYIYSFYWSTLTLTTIGEVP-PPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSL-RKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSMSSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 145.206 bits (365), Expect = 3.981e-37
Identity = 125/473 (26.43%), Postives = 228/473 (48.20%), Query Frame = 1
Query: 1045 VIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFN-DDLSLKWIIFNCIS-----DTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSW-FALDFISSIPLDYIFLILNKKEY--FNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWV---IKCKLKEAYWFDQYTWALFKAMSHMLSIGYG-----RYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKM-FNELDILNELSECLREQI-INYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLT----NARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTME 2394
            V+ P   F F W L +   +I N   L V ++F +  + +LK     CI+     D+IF LD  V FR G + +     +++   ++ + Y  S+ F LD IS +P D ++L L       FN++  A                                E+ +   K   +  L+  + L+ HW AC+ F++     + +D W+   +  +L +     QY ++L+++   M ++G G       P T +   ++ IV+ +TG   +A  VG+A  +I     S+  Y  K   ++EY+   +LP  L++R+ +++++ ++ K   NE ++ ++L++  + +I I+ N   L+  V  F   D  F+ E+V+KL+  +  PGD I ++G  G  MY + +G ++++ ++  V  +LS GS+FGEI LL        R ASVR+  + +++ L +     VLE YP  +  ME
Sbjct:    2 VLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLK----TCIAVDYTFDSIFFLDTLVQFRVGFLEHGV---MVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPILRFNRLFKA----------------------HRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLSKLSM--QYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFV-IVTYLTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIR-VEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVLDEKETVLATLSAGSHFGEISLLNMKGIGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQME 441          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: hcn4 (hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [Source:ZFIN;Acc:ZDB-GENE-050420-360])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 295/521 (56.62%), Postives = 390/521 (74.86%), Query Frame = 1
Query:  880 DITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            D    D  R   + ++  Q  +  QP  NK ++++FG++ A+ +E+ R +  G W+IHP S+FRFYWDL ML L++ NLII+PV I+FF D+ +  WI+FN +SDT FL+D+ +NFRTG++  D   EIIL P+QI   YL+SWF +DFISSIP+DYIFL++  +   +      RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P+D WV K K+    W  QY++ALFKAMSHML IGYG YPP  + + W+TI+SM+ GATCYA+FVGHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQRI +YYEHRYQGKMF+E  IL EL+E LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V ++TK G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+
Sbjct:  162 DQILPDDERLYQAGFIHRQLGAMLQPGVNKFSLRMFGSEKAVEREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDEHTPPWIVFNVVSDTFFLMDLVLNFRTGIVKEDNT-EIILDPQQIKIKYLRSWFVVDFISSIPVDYIFLVVETR-IDSDFYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPADCWVSKNKMVNDTWGQQYSYALFKAMSHMLCIGYGMYPPVGMTDVWLTILSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQRIHDYYEHRYQGKMFDEESILGELNEPLREEIINFNCRKLVASMPLFANADPNFVTSMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTK-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGK 679          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: HCN2 (hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2 [Source:NCBI gene;Acc:101162512])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 301/550 (54.73%), Postives = 407/550 (74.00%), Query Frame = 1
Query:  883 ITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            I  +D + + T +Y++ QF S  QP  NK ++++FG++ A+ KE+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WIIFN ISDT FL+D+ +NFRTG++  D   EIIL PK+I   YLKSWF +DF+SSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+PML+D+P D WV    +    W + Y++ALFKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL EL+E LRE+IIN+NCR LVA++P F  AD NFV+ ++ KL++EVFQPGD II+EG +G +MYFIQ G+V I+TK G ++  L DGSYFGEICLLT  RR ASVRA+TYC +YSL  D+F  VLE YP+MRR  E+VA +RL +IG+  + L+   + DL   +      ++++EIV
Sbjct:  205 IVPEDGDSRGTQTYMQRQFSSLLQPGVNKFSLRMFGSQKAVEKEQERVKSAGNWIIHPYSDFRFYWDFTMLMFMVGNLIIIPVGITFFKDETTTPWIIFNVISDTFFLMDLVLNFRTGIVFEDNT-EIILDPKKIKMKYLKSWFVVDFVSSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSLNNMVNDTWSELYSFALFKAMSHMLCIGYGRQAPESMSDIWLTMLSMIIGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILEELNEPLREEIINFNCRKLVASMPLFANADPNFVTAMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSILTK-GNISMKLMDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHKVQHDLNSGVFNNHENEMIQEIV 751          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000019258.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2 [Source:NCBI gene;Acc:101172279])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 302/563 (53.64%), Postives = 410/563 (72.82%), Query Frame = 1
Query:  844 VNIQSDEFGCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ--NPLLVSTRQDLTEDL------KLVKEIV 2496
            V  Q  E G       D   R + +S+++ QF S  QP  NK +++++G++ A+ +E+ R +  G W+IHP S+FRFYWD  ML  ++ NLII+PV I+FF D+ +  WIIFN +SDT FL+D+ +NFRTG+I  D +D IIL PK I   YLK+WF +DFISSIP+DYIFLI+ +K   +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + IFNL+ +MLLL HW+ CLQFL+PML+++PSD WV   K++   W + Y++A+FKAMSHML IGYGR  P S+ + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP   RQ+I +YYEHRYQGKMF+E  IL ELSE LRE+I+N+NCR LVA++P F  A+ NFV+ ++ KL++EVFQP D II+EG +G +MYFIQ G+  +ITK G +A  LSDGSYFGEICLLT  RR ASVRAETYC +YSL  D F  VLE YP+MRR  E+VA +RL +IG+  + L+   + DL   +      ++++EIV
Sbjct:  308 VTFQKQEDGPPIVPAEDAETRGSQASFMQRQFSSMLQPGVNKFSLRMYGSQKAVEREQERVKSAGNWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDETTTPWIIFNVVSDTFFLMDLVLNFRTGIIIEDNSD-IILDPKTIKTKYLKTWFIVDFISSIPVDYIFLIV-EKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVMRIFNLIGMMLLLCHWDGCLQFLVPMLQEFPSDCWVSLNKMENDTWSELYSFAVFKAMSHMLCIGYGRQAPESLSDIWLTMLSMIVGATCYAVFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEESILGELSEPLREEIVNFNCRKLVASMPLFANAEPNFVTAMLTKLRFEVFQPHDYIIREGTIGKKMYFIQHGVCSVITK-GTLAMKLSDGSYFGEICLLTRGRRTASVRAETYCRLYSLSVDHFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSILMHKVQHDLNSGVFNNQENEMIQEIV 867          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000045599.1 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101158796])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 289/530 (54.53%), Postives = 396/530 (74.72%), Query Frame = 1
Query:  853 QSDEFGCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQ 2430
            QS   G    +  +D +    S++++ QF +  QP  NK ++++FG+  A+  E+ R +  G W+IHP S+FRFYWDLLML L++ NLI+LPV I+FF D+ +  WIIFN +SDT+F++D+ +NFRTG++  D   EI+L P++I QNYLKSWF +DF+SSIP+DYIFL+++  +  +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV K  +    W  QY++ALFKAMSHML IGYG   P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I  YYEHR+QGKMF+E +IL ELSE L+E+I+++NCR+LVA +P F  AD NFV+ V+ KL++EVFQP D II+EG +G +MYFIQ G V ++T+ G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  DSF  VLE +P+MRR  E+VA +RL +IG+
Sbjct:  161 QSGFGGFGMGLDGEDYSNSNQSTFIQRQFGAMLQPGVNKFSLRMFGSHKAVAMEQERLKSAGAWIIHPYSDFRFYWDLLMLILMMGNLIVLPVGITFFRDENTASWIIFNVVSDTLFMVDLVLNFRTGIVKEDNT-EILLDPREIRQNYLKSWFLVDFVSSIPVDYIFLMMDSLD--SEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSKNLMVNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHEYYEHRFQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANADPNFVTAVLTKLRFEVFQPADFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETVAVDRLDRIGR 686          
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Match: ENSORLT00000013376.2 (potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 [Source:NCBI gene;Acc:101158796])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 289/529 (54.63%), Postives = 395/529 (74.67%), Query Frame = 1
Query:  853 QSDEFGCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELL----NVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIG 2427
            QS   G    +  +D +    S++++ QF +  QP  NK ++++FG+  A+  E+ R +  G W+IHP S+FRFYWDLLML L++ NLI+LPV I+FF D+ +  WIIFN +SDT+F++D+ +NFRTG++  D   EI+L P++I QNYLKSWF +DF+SSIP+DYIFL+++  +  +++    RALRI+R  K+LSLLRLLRLSRL+RY+ QWEE+     ++AS  + I NL+ +MLLL HW+ CLQFL+PML+D+P D WV K  +    W  QY++ALFKAMSHML IGYG   P  + + W+T++SM+ GATCYA+F+GHA ALIQS D+S+R Y+EK+KQVE+YM++ KLP  +RQ+I  YYEHR+QGKMF+E +IL ELSE L+E+I+++NCR+LVA +P F  AD NFV+ V+ KL++EVFQP D II+EG +G +MYFIQ G V ++T+ G   T LSDGSYFGEICLLT  RR ASVRA+TYC +YSL  DSF  VLE +P+MRR  E+VA +RL +IG
Sbjct:   28 QSGFGGFGMGLDGEDYSNSNQSTFIQRQFGAMLQPGVNKFSLRMFGSHKAVAMEQERLKSAGAWIIHPYSDFRFYWDLLMLILMMGNLIVLPVGITFFRDENTASWIIFNVVSDTLFMVDLVLNFRTGIVKEDNT-EILLDPREIRQNYLKSWFLVDFVSSIPVDYIFLMMDSLD--SEVYRTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAMVRIVNLIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSKNLMVNDTWGVQYSYALFKAMSHMLCIGYGAQAPEGMTDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADMRQKIHEYYEHRFQGKMFDEENILGELSEPLKEEIVSFNCRSLVANMPLFANADPNFVTAVLTKLRFEVFQPADFIIREGTVGRKMYFIQHGRVSVLTR-GNKETKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDSFNEVLEEHPMMRRAFETVAVDRLDRIG 552          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000020049.1 (SMESG000020049.1)

HSP 1 Score: 1622.83 bits (4201), Expect = 0.000e+0
Identity = 850/851 (99.88%), Postives = 850/851 (99.88%), Query Frame = 1
Query:  163 MSNPCGNEEWNTRRASKRIKYPRESYTCRSQQTQNYLSPPKNQSDQDVRDRXXXXXXXXXXXXXCFPYLDEPINDAGDLLSYPSENSAYYSILPARRSSRSLDLEAIYKILDMEQKHKTILEVPLYEDDCSAFTRTNSLRSTNNISGQKVTIGIGTYNSRRPLSFRNRLKSTRRSIKAKFSRISSLRRNRNGQSFTDPQNESHHHSLDDNLISGLVNGIKKSKEFRDVNIQSDEFGCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNGRRKSVIQIGLEKFNNMRTKAAAGIAKRKLSREMFRKQSSPGALSTSEYSKLEGIR 2715
            MSNPCGNEEWNTRRASKRIKYPRESYTCRSQQTQNYLSPPKNQSDQDVRDRSLSKSSIFSSYSSCFPYLDEPINDAGDLLSYPSENSAYYSILPARRSSRSLDLEAIYKILDMEQKHKTILEVPLYEDDCSAFTRTNSLRSTNNISGQKVTIGIGTYNSRRPLSFRNRLKSTRRSIKAKFSRISSLRRNRNGQSFTDPQNESHHHSLDDNLISGLVNGIKKSKEFRDVNIQSDEFGCYEDI FDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDLLMLSLLIANLIILPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNGRRKSVIQIGLEKFNNMRTKAAAGIAKRKLSREMFRKQSSPGALSTSEYSKLEGIR
Sbjct:    1 MSNPCGNEEWNTRRASKRIKYPRESYTCRSQQTQNYLSPPKNQSDQDVRDRSLSKSSIFSSYSSCFPYLDEPINDAGDLLSYPSENSAYYSILPARRSSRSLDLEAIYKILDMEQKHKTILEVPLYEDDCSAFTRTNSLRSTNNISGQKVTIGIGTYNSRRPLSFRNRLKSTRRSIKAKFSRISSLRRNRNGQSFTDPQNESHHHSLDDNLISGLVNGIKKSKEFRDVNIQSDEFGCYEDIIFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDLLMLSLLIANLIILPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNGRRKSVIQIGLEKFNNMRTKAAAGIAKRKLSREMFRKQSSPGALSTSEYSKLEGIR 851          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 500/720 (69.44%), Postives = 573/720 (79.58%), Query Frame = 1
Query:  439 LPARRSSRSLDLEAIYKILDMEQKH--KTILEVPLYEDDCSAFTRTNSLRSTNNISGQKVTIGIGTYNSRRPLSFRNRLKSTRR--SIKAKFSRISSLRRNRNGQSFTDPQNESHH------------HSLDDNLISGLVNGIKKSKE----FRDVNIQSDEFGCYED--ITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILN----KKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISS 2520
            L  RRSS+SL+  ++    +  Q+   ++I+E  +    C A++   +    NN S    TI +   NS    ++R   K+ RR  SIK+KF +  S+ +  + Q      + S H            HSL +   S   + IK+S E    F DV+ +SDE     D     D  N+   SSYLKEQF SFFQPSDNKLA+KLFGNKNA+NKE+RRQQQQGK VIHPCSNFRFYWDL+ML LLI NLI+LPVAISFFNDDLSL WI+FNC+SDTIF+LDI VNFRTG+ITND+ADEIIL PK IA+ Y+KSWF LD +SSIP+DY+FL+LN    K E ++Q  HAGR LRI RLAKLLS+LRLLRLSRLVRYVSQWEE LN+ASKFIGI  LVLLMLLLGHWNACLQFLIPML +YP++SWVIKC LK+AYWF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMMTGATCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  IL ELSECLREQIINYNCRALVAAVPFFTYADQ+FVSEVV KL++EV+QPGDLIIKEG +GT+M+FIQEGIVDIITK+GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCN+YSLD + F +VLENYPLMRRTMESVAAERL KIGQNP +VS+R+DL EDL LVKEIV+  +PI S
Sbjct:   96 LSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNS---TTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGS 812          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038954.1 (SMESG000038954.1)

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 500/737 (67.84%), Postives = 573/737 (77.75%), Query Frame = 1
Query:  439 LPARRSSRSLDLEAIYKILDMEQKH--KTILEVPLYEDDCSAFTRTNSLRSTNNISGQKVTIGIGTYNSRRPLSFRNRLKSTRR--SIKAKFSRISSLRRNRNGQSFTDPQNESHH------------HSLDDNLISGLVNGIKKSKE----FRDVNIQSDEFGCYED--ITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILN----KKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEE-----------------LLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISS 2520
            L  RRSS+SL+  ++    +  Q+   ++I+E  +    C A++   +    NN S    TI +   NS    ++R   K+ RR  SIK+KF +  S+ +  + Q      + S H            HSL +   S   + IK+S E    F DV+ +SDE     D     D  N+   SSYLKEQF SFFQPSDNKLA+KLFGNKNA+NKE+RRQQQQGK VIHPCSNFRFYWDL+ML LLI NLI+LPVAISFFNDDLSL WI+FNC+SDTIF+LDI VNFRTG+ITND+ADEIIL PK IA+ Y+KSWF LD +SSIP+DY+FL+LN    K E ++Q  HAGR LRI RLAKLLS+LRLLRLSRLVRYVSQWEE                  LN+ASKFIGI  LVLLMLLLGHWNACLQFLIPML +YP++SWVIKC LK+AYWF QYTWALFKAMSHMLSIGYGR+PPTSI EAWITIVSMMTGATCYALFVGHAAA+IQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRIANYYEHRYQGKMF+E  IL ELSECLREQIINYNCRALVAAVPFFTYADQ+FVSEVV KL++EV+QPGDLIIKEG +GT+M+FIQEGIVDIITK+GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCN+YSLD + F +VLENYPLMRRTMESVAAERL KIGQNP +VS+R+DL EDL LVKEIV+  +PI S
Sbjct:  159 LSGRRSSKSLEFSSLQFAEESRQETIPESIMEQFVCPTPCKAYSAIANGDIENNGSSVASTILVSNRNS---TTYRTPHKNKRRWPSIKSKFGKFGSMGKVDHLQHSVPLIHRSDHDDNNYQGSEKTAHSLSNIDSSFEKDIIKRSHEADGQFEDVDERSDESNDENDDQTNGDLNNKSRASSYLKEQFFSFFQPSDNKLALKLFGNKNAVNKERRRQQQQGKLVIHPCSNFRFYWDLMMLVLLITNLIVLPVAISFFNDDLSLHWIVFNCVSDTIFILDIAVNFRTGIITNDFADEIILDPKIIARRYVKSWFILDLLSSIPMDYLFLVLNHGPDKNENYSQFFHAGRTLRIFRLAKLLSMLRLLRLSRLVRYVSQWEEKYLISTCDQGYLTFPQKFLNMASKFIGICKLVLLMLLLGHWNACLQFLIPMLMEYPAESWVIKCNLKDAYWFKQYTWALFKAMSHMLSIGYGRFPPTSISEAWITIVSMMTGATCYALFVGHAAAIIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIANYYEHRYQGKMFDEEVILIELSECLREQIINYNCRALVAAVPFFTYADQDFVSEVVTKLKFEVYQPGDLIIKEGTIGTKMFFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDAEHFQAVLENYPLMRRTMESVAAERLSKIGQNPQIVSSREDLKEDLNLVKEIVSSVTPIGS 892          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000001696.1 (SMESG000001696.1)

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 455/615 (73.98%), Postives = 527/615 (85.69%), Query Frame = 1
Query:  838 RDVNIQSDE-FGCYEDITFDDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNG----------RRKSV-IQIGLEKFNNMRTKAAAGIAKRKLSRE 2646
            RDV +Q DE     E +T +D N+ +T+ YLKEQF SFFQP+DNKLAMKLFGNKNALNKEKRRQQQ GKW+IHPCSNFRFYWDL+ML LLIANLIILPVAISFFNDDLSL WI+FNC SDTIFLLDI VNFR+G+I +++ADEIIL P QI +NY+ SWF LD ISSIP+DYIFLI+N+K+ ++Q +HAGR LRIL+LAKLLS+LRLLRLSRLVRYVSQWEE LN+A+KF+GI  LVL+MLLL HWNACLQ+LIP+L D+P+DSWV KCKL+ AYWF QYTWALFKA+SHMLSIGYGR+PPTSI EAWIT+ S++ G TCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPR LRQRI +YYEHRYQGKMFNE  IL+ELSECLREQIINYNCRALVA+VPFFTYADQ+FVSEVV KL++EVFQPGDLIIKEG +GT+MYFIQEGIVDIITK+GEVATSLSDGSYFGEICLLTNA+RVASVRAETYCN+YSLD   FL VLENYPLMRRTMESVAAERL KIG+NP +V+ R+DL EDL LV+E+VN +   +  +ES  E N           RRKS  I++GL+     R+++   ++  + +++
Sbjct:  173 RDVQLQFDEEIMIKEGLTDEDFNKLSTTGYLKEQFFSFFQPADNKLAMKLFGNKNALNKEKRRQQQAGKWIIHPCSNFRFYWDLMMLILLIANLIILPVAISFFNDDLSLHWIVFNCASDTIFLLDIMVNFRSGIIADNFADEIILDPNQICKNYIHSWFFLDLISSIPMDYIFLIINRKDVYSQFVHAGRGLRILKLAKLLSILRLLRLSRLVRYVSQWEEFLNMANKFMGICKLVLMMLLLAHWNACLQYLIPVLNDFPADSWVTKCKLQHAYWFHQYTWALFKALSHMLSIGYGRFPPTSISEAWITVTSVLIGVTCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRALRQRIDSYYEHRYQGKMFNEDLILSELSECLREQIINYNCRALVASVPFFTYADQDFVSEVVTKLKFEVFQPGDLIIKEGTVGTKMYFIQEGIVDIITKDGEVATSLSDGSYFGEICLLTNAKRVASVRAETYCNLYSLDSFHFLEVLENYPLMRRTMESVAAERLNKIGKNPEMVTDRKDLKEDLDLVQEMVNSAEAAAKLEESEIEDNKLLSAYTTEKPRRKSTAIRLGLQLLKFHRSRSHMSLSNNEENKQ 787          
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Match: SMESG000038402.1 (SMESG000038402.1)

HSP 1 Score: 845.114 bits (2182), Expect = 0.000e+0
Identity = 438/597 (73.37%), Postives = 514/597 (86.10%), Query Frame = 1
Query:  892 DDANRQTTSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCSNFRFYWDXXXXXXXXXXXXXXPVAISFFNDDLSLKWIIFNCISDTIFLLDIFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLILNKKEYFNQIMHAGXXXXXXXXXXXXXXXXXXXXXXXXXYVSQWEELLNVASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYWFDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQGKMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKLQYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGEICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAERLIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFN-EHNG---------------RRKSVIQIGLEKFNNMRTKAAAGIAKRK 2634
            D   +Q+TSSYLKEQFLSFFQPSDNKLA+KLFG+KNA+ +EK+RQQ++ KW+IHPCS+FRFYWDL ML +LIANLIILPV +SFF D + ++W+IFNC SDT+FL DI VNFRTG++  D +DEIIL PK IA+NYL+SWF LD ISSIPLDYIFL +N+ E ++  ++AG+ LRILRLAKLLS+LRLLRLSRLVRYVSQWEE LN+ASKFIGI  LVLLMLLLGHWNAC+QFLIP+L ++P++SWV+KCKL+ +YWF+QYTW+LFKAMSHMLSIGYGR+PPTSI EAWITI+SMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYM YRKLPR LRQRIANYYEHRYQGKMFNE  IL EL+ECLREQ+INYNCRALVAAVPFFTYADQ+FVSEVV KL YEVFQPGDLIIKEG +GT+MYFIQEGIVDIITK+GEV TSLSDGSYFGEICLLTNA+R A+VRAE YC++YSLD + F +VLENYPLMRRTMESVAAERL KIG NP +++ R+D  +DL +VKEIV+  SP+ SDDE+ N E NG               RRKSV+++GL K   +++K+   + ++K
Sbjct:  166 DSQQKQSTSSYLKEQFLSFFQPSDNKLALKLFGSKNAVIQEKKRQQKEAKWIIHPCSSFRFYWDLFMLVMLIANLIILPVIVSFFTDSMRIQWVIFNCFSDTVFLADIAVNFRTGILLTDKSDEIILNPKIIARNYLRSWFFLDLISSIPLDYIFLAVNRGENYHHFVYAGKTLRILRLAKLLSMLRLLRLSRLVRYVSQWEEFLNIASKFIGICKLVLLMLLLGHWNACIQFLIPVLMEFPTESWVVKCKLQHSYWFEQYTWSLFKAMSHMLSIGYGRFPPTSISEAWITIISMMTGATCYALFVGHAAALIQSFDTSKRLYREKFKQVEEYMTYRKLPRALRQRIANYYEHRYQGKMFNEDQILTELNECLREQVINYNCRALVAAVPFFTYADQSFVSEVVSKLMYEVFQPGDLIIKEGTIGTKMYFIQEGIVDIITKDGEVVTSLSDGSYFGEICLLTNAKRCATVRAEVYCSLYSLDSEQFKAVLENYPLMRRTMESVAAERLSKIGCNPDIITNREDFKDDLDMVKEIVSSVSPMVSDDENDNAEDNGNDKSFNGSLKKPKESRRKSVVKLGLHKLGLIKSKSNNSLVEKK 762          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCN40.000e+052.91hyperpolarization activated cyclic nucleotide gate... [more]
HCN10.000e+056.00hyperpolarization activated cyclic nucleotide gate... [more]
HCN20.000e+053.22hyperpolarization activated cyclic nucleotide gate... [more]
HCN10.000e+056.07hyperpolarization activated cyclic nucleotide gate... [more]
HCN30.000e+054.64hyperpolarization activated cyclic nucleotide gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1038.453e-3625.72Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1039.041e-3625.72Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.179e-3526.05Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.219e-3526.05Potassium voltage-gated channel unc-103 [Source:U... [more]
unc-1031.419e-3526.05Potassium voltage-gated channel unc-103 [Source:U... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ih0.000e+069.85gene:FBgn0263397 transcript:FBtr0100369[more]
Ih0.000e+069.51gene:FBgn0263397 transcript:FBtr0290109[more]
Ih0.000e+070.79gene:FBgn0263397 transcript:FBtr0290292[more]
Ih0.000e+070.79gene:FBgn0263397 transcript:FBtr0308835[more]
Ih0.000e+070.79gene:FBgn0263397 transcript:FBtr0308836[more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn40.000e+057.47hyperpolarization activated cyclic nucleotide-gate... [more]
hcn2b0.000e+053.48hyperpolarization activated cyclic nucleotide-gate... [more]
hcn4l0.000e+057.59hyperpolarization activated cyclic nucleotide-gate... [more]
hcn2b0.000e+055.66hyperpolarization activated cyclic nucleotide-gate... [more]
hcn40.000e+056.17hyperpolarization activated cyclic nucleotide-gate... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000054882.10.000e+055.91potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054880.10.000e+055.91potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054883.10.000e+056.65potassium/sodium hyperpolarization-activated cycli... [more]
ENSXETT00000054879.10.000e+055.91potassium/sodium hyperpolarization-activated cycli... [more]
cdh190.000e+056.07cadherin 19, type 2 [Source:Xenbase;Acc:XB-GENE-60... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcn40.000e+053.27hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn10.000e+055.81hyperpolarization activated cyclic nucleotide gate... [more]
Hcn20.000e+053.78hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn20.000e+053.78hyperpolarization-activated, cyclic nucleotide-gat... [more]
Hcn30.000e+055.03hyperpolarization-activated, cyclic nucleotide-gat... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TV66|HCN4_RABIT0.000e+049.21Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9JKA7|HCN4_RAT0.000e+053.27Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9Y3Q4|HCN4_HUMAN0.000e+052.91Potassium/sodium hyperpolarization-activated cycli... [more]
sp|O60741|HCN1_HUMAN0.000e+056.00Potassium/sodium hyperpolarization-activated cycli... [more]
sp|Q9MZS1|HCN1_RABIT0.000e+054.26Potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GGH40.000e+079.05Cyclic nucleotide-binding domain-containing protei... [more]
A0A267GPW90.000e+079.05Cyclic nucleotide-binding domain-containing protei... [more]
A0A4Z2DGN80.000e+082.97Potassium/sodium hyperpolarization-activated cycli... [more]
A0A3Q0KVG70.000e+082.78Cyclic nucleotide-binding domain-containing protei... [more]
G4M0M00.000e+082.78Cyclic nucleotide-binding domain-containing protei... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn2b0.000e+054.30potassium/sodium hyperpolarization-activated cycli... [more]
hcn4l0.000e+056.98potassium/sodium hyperpolarization-activated cycli... [more]
hcn4l0.000e+056.98potassium/sodium hyperpolarization-activated cycli... [more]
hcn2b0.000e+054.30potassium/sodium hyperpolarization-activated cycli... [more]
ENSAMXT00000011919.20.000e+056.78pep primary_assembly:Astyanax_mexicanus-2.0:10:254... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007865.18.507e-7150.52pep scaffold:Pmarinus_7.0:GL480431:10244:18565:-1 ... [more]
ENSPMAT00000005594.12.553e-4026.71pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
kcnh1b2.033e-3726.40potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000005922.14.471e-2523.37pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
cngb1a1.289e-2326.62cyclic nucleotide gated channel subunit beta 1a [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY12.275e-1138.10Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343166.196e-17355.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490646.128e-16853.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346336.808e-4329.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353931.804e-4126.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353763.981e-3726.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcn40.000e+056.62hyperpolarization activated cyclic nucleotide-gate... [more]
HCN20.000e+054.73hyperpolarization activated cyclic nucleotide gate... [more]
ENSORLT00000019258.20.000e+053.64potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000045599.10.000e+054.53potassium/sodium hyperpolarization-activated cycli... [more]
ENSORLT00000013376.20.000e+054.63potassium/sodium hyperpolarization-activated cycli... [more]
back to top
BLAST of Cyclic nucleotide gated channel 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020049.10.000e+099.88SMESG000020049.1[more]
SMESG000038954.10.000e+069.44SMESG000038954.1[more]
SMESG000038954.10.000e+067.84SMESG000038954.1[more]
SMESG000001696.10.000e+073.98SMESG000001696.1[more]
SMESG000038402.10.000e+073.37SMESG000038402.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010783 ID=SMED30010783|Name=Cyclic nucleotide gated channel 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2825bp
GAAACGGCGAATTCAATTCGCTGGATTTTTAATTAACATTTACAATTTAT
GCTTCTCATCTACATCAGAGTTTTTGCAATGCTCAATTATTACATTCTTT
CGGGGATCTTTTGTTTTAAGTCTCAAACCAAATCAATCCGATAATTTCTA
TCCTACAAAATCATGAGTAACCCGTGCGGAAACGAAGAGTGGAACACGAG
GCGAGCGTCGAAACGGATAAAATATCCCCGTGAATCTTACACTTGTCGCA
GCCAACAAACTCAGAATTATCTTTCTCCACCTAAAAACCAGTCTGATCAA
GATGTTCGAGATCGAAGCCTCAGCAAATCAAGCATTTTTTCTTCGTACAG
CAGTTGCTTTCCCTATCTCGATGAACCGATAAATGATGCTGGTGACCTAC
TGAGTTACCCATCGGAAAATAGTGCGTATTACTCTATTTTACCGGCAAGA
CGATCCAGTAGATCATTGGATTTAGAAGCAATCTACAAAATTCTTGACAT
GGAACAAAAACACAAAACCATACTTGAAGTACCTCTTTATGAAGACGACT
GTTCTGCATTTACTCGAACAAATTCATTGAGATCTACCAACAATATCTCA
GGTCAAAAAGTAACCATCGGAATCGGAACCTATAATTCTCGACGACCGTT
AAGTTTCAGGAACCGACTAAAAAGTACCCGCCGGTCAATAAAAGCCAAAT
TTTCTCGAATAAGTTCTCTGAGGCGAAATAGAAACGGACAAAGTTTCACA
GATCCCCAGAATGAAAGCCATCATCATTCTCTCGACGACAACCTAATCAG
TGGTCTAGTCAATGGAATTAAGAAAAGTAAAGAGTTTCGAGATGTCAACA
TCCAGTCCGACGAATTCGGATGCTATGAAGACATAACTTTCGATGATGCC
AACCGTCAGACGACTTCCAGCTATTTGAAGGAGCAATTTCTCTCATTCTT
TCAACCATCCGACAACAAACTCGCCATGAAATTGTTTGGAAATAAAAACG
CTCTGAATAAAGAAAAGCGACGTCAACAACAACAAGGCAAATGGGTCATT
CATCCGTGCAGTAATTTCAGGTTTTACTGGGACCTATTAATGCTGTCTCT
CCTAATTGCAAATTTAATAATTCTTCCCGTGGCCATTTCGTTCTTTAATG
ACGACCTCAGTCTCAAGTGGATTATATTCAATTGCATTTCTGACACGATA
TTTCTCCTGGATATTTTTGTGAATTTCCGAACAGGGGTCATCACGAATGA
TTATGCAGACGAGATTATTCTCGTCCCAAAACAAATCGCTCAGAATTATT
TGAAATCCTGGTTCGCTTTGGATTTCATCAGTTCCATTCCGTTGGACTAC
ATTTTTCTCATTTTAAACAAAAAAGAGTATTTCAATCAAATAATGCACGC
TGGTCGTGCTTTGAGGATTTTGAGACTAGCAAAACTTCTCAGCTTGCTAC
GATTATTGAGGTTATCAAGACTTGTTCGCTATGTAAGTCAATGGGAAGAG
TTATTAAATGTCGCCAGTAAATTCATTGGTATATTCAACCTTGTCCTGCT
CATGTTGCTATTAGGACATTGGAATGCCTGCTTACAATTCCTCATCCCCA
TGCTCCGAGATTACCCCTCCGACAGCTGGGTTATCAAATGCAAACTAAAG
GAGGCGTACTGGTTTGATCAGTACACTTGGGCTTTGTTTAAAGCAATGTC
CCATATGCTGAGTATTGGTTATGGGAGATATCCTCCGACAAGCATTTGTG
AAGCATGGATAACTATTGTAAGTATGATGACAGGAGCGACCTGCTATGCG
TTATTTGTCGGACACGCTGCTGCTTTAATCCAATCATTTGATACGTCAAA
ACGGTTATACAGAGAAAAGTTTAAACAAGTAGAAGAATATATGGCCTATA
GGAAACTGCCTCGGGGTCTCCGACAACGCATTGCTAACTACTATGAGCAC
AGATATCAAGGGAAAATGTTCAACGAACTGGACATTCTTAATGAATTGTC
GGAATGCCTAAGAGAGCAAATCATCAACTACAATTGCCGGGCTTTGGTCG
CAGCAGTTCCATTTTTCACATACGCCGACCAGAATTTCGTCTCGGAGGTC
GTTGTCAAATTACAATATGAAGTTTTCCAGCCGGGAGATTTGATTATCAA
AGAAGGAAATCTAGGAACGAGAATGTATTTCATTCAAGAGGGAATCGTAG
ATATCATTACCAAAGAAGGAGAAGTTGCGACAAGTCTTTCTGATGGCTCC
TATTTTGGAGAAATCTGTTTGCTTACAAACGCCAGACGTGTTGCCAGTGT
GAGAGCAGAAACTTACTGTAATGTTTATTCCCTAGACAGAGATAGCTTTC
TCTCAGTTCTCGAAAATTACCCTCTGATGCGAAGAACCATGGAGAGCGTG
GCTGCTGAAAGATTGATAAAAATCGGTCAGAATCCATTATTGGTCAGCAC
CAGACAGGATTTGACTGAAGACTTGAAATTGGTCAAAGAGATCGTTAATG
AGAGTTCCCCAATTAGCAGTGACGATGAGTCCTTTAATGAGCATAATGGC
CGACGAAAATCAGTCATTCAGATCGGGCTTGAAAAATTTAATAATATGAG
GACGAAGGCGGCTGCGGGAATCGCGAAACGGAAATTGTCTCGAGAGATGT
TTAGAAAACAAAGTTCACCCGGAGCGCTGTCTACGAGCGAGTATTCAAAG
CTTGAAGGTATTCGAGAGATTCACGAAACTCCTGAAACTGAAAAAGAGAT
TTAAGAGATAATCTAATAAATATTGTAGCGTCAATCGCCATTTTGTAGTT
CATATTTTGTAAATGCATTTATGAC
back to top

protein sequence of SMED30010783-orf-1

>SMED30010783-orf-1 ID=SMED30010783-orf-1|Name=SMED30010783-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=864bp
MSNPCGNEEWNTRRASKRIKYPRESYTCRSQQTQNYLSPPKNQSDQDVRD
RSLSKSSIFSSYSSCFPYLDEPINDAGDLLSYPSENSAYYSILPARRSSR
SLDLEAIYKILDMEQKHKTILEVPLYEDDCSAFTRTNSLRSTNNISGQKV
TIGIGTYNSRRPLSFRNRLKSTRRSIKAKFSRISSLRRNRNGQSFTDPQN
ESHHHSLDDNLISGLVNGIKKSKEFRDVNIQSDEFGCYEDITFDDANRQT
TSSYLKEQFLSFFQPSDNKLAMKLFGNKNALNKEKRRQQQQGKWVIHPCS
NFRFYWDLLMLSLLIANLIILPVAISFFNDDLSLKWIIFNCISDTIFLLD
IFVNFRTGVITNDYADEIILVPKQIAQNYLKSWFALDFISSIPLDYIFLI
LNKKEYFNQIMHAGRALRILRLAKLLSLLRLLRLSRLVRYVSQWEELLNV
ASKFIGIFNLVLLMLLLGHWNACLQFLIPMLRDYPSDSWVIKCKLKEAYW
FDQYTWALFKAMSHMLSIGYGRYPPTSICEAWITIVSMMTGATCYALFVG
HAAALIQSFDTSKRLYREKFKQVEEYMAYRKLPRGLRQRIANYYEHRYQG
KMFNELDILNELSECLREQIINYNCRALVAAVPFFTYADQNFVSEVVVKL
QYEVFQPGDLIIKEGNLGTRMYFIQEGIVDIITKEGEVATSLSDGSYFGE
ICLLTNARRVASVRAETYCNVYSLDRDSFLSVLENYPLMRRTMESVAAER
LIKIGQNPLLVSTRQDLTEDLKLVKEIVNESSPISSDDESFNEHNGRRKS
VIQIGLEKFNNMRTKAAAGIAKRKLSREMFRKQSSPGALSTSEYSKLEGI
REIHETPETEKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006813potassium ion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0071805potassium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
GO:0005249voltage-gated potassium channel activity
Vocabulary: INTERPRO
TermDefinition
IPR003938K_chnl_volt-dep_EAG/ELK/ERG
IPR000595cNMP-bd_dom
IPR013621Ion_trans_N
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003938Potassium channel, voltage-dependent, EAG/ELK/ERGPRINTSPR01463EAGCHANLFMLYcoord: 340..350
score: 38.07
coord: 504..521
score: 37.33
coord: 548..557
score: 35.62
coord: 351..360
score: 46.56
coord: 713..721
score: 61.11
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 634..751
e-value: 1.7E-19
score: 80.8
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 654..736
e-value: 9.8E-20
score: 70.4
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 634..750
score: 28.897
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 634..743
e-value: 1.86444E-26
score: 102.404
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 626..754
e-value: 8.7E-45
score: 153.5
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 304..560
e-value: 1.1E-20
score: 73.9
IPR013621Ion transport N-terminalPFAMPF08412Ion_trans_Ncoord: 259..302
e-value: 5.4E-26
score: 89.9
NoneNo IPR availableGENE3DG3DSA:1.10.287.630coord: 557..625
e-value: 1.0E-32
score: 114.4
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 307..556
e-value: 5.5E-10
score: 41.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 829..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 847..863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 25..43
NoneNo IPR availablePANTHERPTHR45689:SF7POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED CYCLIC NUCLEOTIDE-GATED CHANNEL 3coord: 249..767
NoneNo IPR availablePANTHERPTHR45689FAMILY NOT NAMEDcoord: 249..767
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 297..557
NoneNo IPR availableTMHMMTMhelixcoord: 533..555
NoneNo IPR availableTMHMMTMhelixcoord: 336..355
NoneNo IPR availableTMHMMTMhelixcoord: 498..520
NoneNo IPR availableTMHMMTMhelixcoord: 456..478
NoneNo IPR availableTMHMMTMhelixcoord: 304..326
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 661..677
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 561..751