Lysosomal-associated transmembrane protein 4A

Overview
NameLysosomal-associated transmembrane protein 4A
Smed IDSMED30010777
Length (bp)1308
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysosomal-associated transmembrane protein 4A (SMED30010777) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysosomal-associated transmembrane protein 4A (SMED30010777) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysosomal-associated transmembrane protein 4A (SMED30010777) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysosomal-associated transmembrane protein 4A (SMED30010777) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010777

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010777SMESG000042736.1 Contig783GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v4_495_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010777SMESG000063816.1 SMESG000063452.1 SMESG000057448.1 SMESG000042736.1 SMESG000032757.1 SMESG000027399.1 SMESG000017350.1 SMESG000011514.1 SMESG000010536.1 SMESG000012070.1 Contig36651newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010777SMESG000063816.1 SMESG000063452.1 SMESG000057448.1 SMESG000042736.1 SMESG000032757.1 SMESG000027399.1 SMESG000017350.1 SMESG000011514.1 SMESG000010536.1 SMESG000012070.1 Contig36651uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010777 Contig22198newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v6_495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v6_495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v6_495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v6_495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010777SMESG000042736.1 SMESG000032757.1 SMESG000017350.1 SMESG000010536.1 SMESG000042735.1 SMESG000012070.1 dd_Smed_v6_495_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 70.8626 bits (172), Expect = 1.558e-13
Identity = 33/69 (47.83%), Postives = 40/69 (57.97%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G  RP +G  I   T  G T++
Sbjct:  140 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTEL 208          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Human
Match: QDPR (quinoid dihydropteridine reductase [Source:HGNC Symbol;Acc:HGNC:9752])

HSP 1 Score: 70.8626 bits (172), Expect = 2.682e-13
Identity = 33/69 (47.83%), Postives = 40/69 (57.97%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G  RP +G  I   T  G T++
Sbjct:  171 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTEL 239          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Celegans
Match: qdpr-1 (Quinoid DihydroPteridine Reductase [Source:UniProtKB/TrEMBL;Acc:Q9XVJ3])

HSP 1 Score: 69.3218 bits (168), Expect = 3.101e-13
Identity = 34/70 (48.57%), Postives = 44/70 (62.86%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKW-IEGTERPKNGDFIYFNTKNGETKI 1308
            +P NS   TI+P TLDT  NR  MPN D  SWTP+SF+SE  +KW  E + RP +G  +   T+NG + I
Sbjct:  164 LPDNSAVLTIMPVTLDTPMNRKWMPNADHSSWTPLSFISEHLLKWTTETSSRPSSGALLKITTENGTSTI 233          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0076531)

HSP 1 Score: 70.0922 bits (170), Expect = 2.097e-13
Identity = 31/69 (44.93%), Postives = 44/69 (63.77%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P  S+  +ILP TLDT  NR  MP+ DF +WTP++ V+  F+KW +  ERPK G  +   T NG T++
Sbjct:  163 LPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQDQERPKTGSLLQLITTNGITQL 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0100531)

HSP 1 Score: 70.0922 bits (170), Expect = 2.097e-13
Identity = 31/69 (44.93%), Postives = 44/69 (63.77%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P  S+  +ILP TLDT  NR  MP+ DF +WTP++ V+  F+KW +  ERPK G  +   T NG T++
Sbjct:  163 LPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQDQERPKTGSLLQLITTNGITQL 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Fly
Match: Dhpr (gene:FBgn0035964 transcript:FBtr0100532)

HSP 1 Score: 70.0922 bits (170), Expect = 2.097e-13
Identity = 31/69 (44.93%), Postives = 44/69 (63.77%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P  S+  +ILP TLDT  NR  MP+ DF +WTP++ V+  F+KW +  ERPK G  +   T NG T++
Sbjct:  163 LPAGSLAVSILPVTLDTPMNRKWMPDADFGTWTPLTEVAGLFLKWTQDQERPKTGSLLQLITTNGITQL 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Match: qdpra (quinoid dihydropteridine reductase a [Source:ZFIN;Acc:ZDB-GENE-070705-197])

HSP 1 Score: 71.633 bits (174), Expect = 8.546e-14
Identity = 30/68 (44.12%), Postives = 42/68 (61.76%), Query Frame = -1
Query: 1105 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETK 1308
            +P  ++   ILP TLDT  NR  MP+ DF SWTP+ +++ETF  W  G+ RP +G  I   T  G+T+
Sbjct:  165 LPSGAVAVAILPVTLDTPMNRKFMPDADFGSWTPLEYIAETFHSWATGSGRPASGSLIQLETTGGKTE 232          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Match: qdprb2 (quinoid dihydropteridine reductase b2 [Source:ZFIN;Acc:ZDB-GENE-070720-19])

HSP 1 Score: 69.3218 bits (168), Expect = 7.201e-13
Identity = 31/67 (46.27%), Postives = 40/67 (59.70%), Query Frame = -1
Query: 1108 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGET 1308
            +P  S+   ILP+TLDT  NR  MPN D  SWTP++ V++ F KW  G  RP +G  +   T NG T
Sbjct:  183 LPPRSVALAILPETLDTPTNRRIMPNADVSSWTPLNHVTQLFFKWTVGESRPPSGSLVELVTANGRT 249          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Match: BX005473.1 (quinoid dihydropteridine reductase b2 [Source:NCBI gene;Acc:101887190])

HSP 1 Score: 68.5514 bits (166), Expect = 8.796e-13
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = -1
Query: 1108 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGET 1308
            +P  S+   ILP TLDT  NR  MPN D  SWTP++ V++ F KW  G  RP +G  +   T NG T
Sbjct:  166 LPPRSVALAILPVTLDTPTNRRIMPNADVSSWTPLNHVTQLFFKWTVGESRPASGSLVELVTANGRT 232          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Match: BX005473.1 (quinoid dihydropteridine reductase b2 [Source:NCBI gene;Acc:101887190])

HSP 1 Score: 68.9366 bits (167), Expect = 8.965e-13
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = -1
Query: 1108 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGET 1308
            +P  S+   ILP TLDT  NR  MPN D  SWTP++ V++ F KW  G  RP +G  +   T NG T
Sbjct:  170 LPPRSVALAILPVTLDTPTNRRIMPNADVSSWTPLNHVTQLFFKWTVGESRPASGSLVELVTANGRT 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Match: BX005473.1 (quinoid dihydropteridine reductase b2 [Source:NCBI gene;Acc:101887190])

HSP 1 Score: 68.5514 bits (166), Expect = 9.802e-13
Identity = 31/67 (46.27%), Postives = 39/67 (58.21%), Query Frame = -1
Query: 1108 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGET 1308
            +P  S+   ILP TLDT  NR  MPN D  SWTP++ V++ F KW  G  RP +G  +   T NG T
Sbjct:  171 LPPRSVALAILPVTLDTPTNRRIMPNADVSSWTPLNHVTQLFFKWTVGESRPASGSLVELVTANGRT 237          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Xenopus
Match: ifrd2 (interferon-related developmental regulator 2 [Source:Xenbase;Acc:XB-GENE-1003246])

HSP 1 Score: 78.1814 bits (191), Expect = 6.996e-16
Identity = 33/69 (47.83%), Postives = 45/69 (65.22%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  S    ILP TLDT  NR+SMP+ D+  WTP+ F++ETF  WI G  RP++G  I   T+ G+T++
Sbjct:  168 MPAKSAAVAILPVTLDTPANRASMPDADYTCWTPLDFIAETFYNWITGQNRPQSGSLIEVITEKGKTEL 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 72.0182 bits (175), Expect = 8.654e-15
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:   66 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 134          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 72.0182 bits (175), Expect = 2.857e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  116 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 184          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 72.0182 bits (175), Expect = 2.857e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  116 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 184          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 72.0182 bits (175), Expect = 2.857e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  116 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 184          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Match: Qdpr (quinoid dihydropteridine reductase [Source:MGI Symbol;Acc:MGI:97836])

HSP 1 Score: 72.4034 bits (176), Expect = 5.769e-14
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  168 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Match: sp|P11348|DHPR_RAT (Dihydropteridine reductase OS=Rattus norvegicus OX=10116 GN=Qdpr PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.489e-13
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  168 MPSGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Match: sp|Q8BVI4|DHPR_MOUSE (Dihydropteridine reductase OS=Mus musculus OX=10090 GN=Qdpr PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 4.036e-13
Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G +RP +G  I   T +G+T++
Sbjct:  168 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTEL 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Match: sp|P09417|DHPR_HUMAN (Dihydropteridine reductase OS=Homo sapiens OX=9606 GN=QDPR PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.288e-12
Identity = 33/69 (47.83%), Postives = 40/69 (57.97%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI G  RP +G  I   T  G T++
Sbjct:  171 MPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTEL 239          
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Match: sp|Q8MJ30|DHPR_PIG (Dihydropteridine reductase OS=Sus scrofa OX=9823 GN=QDPR PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.195e-12
Identity = 32/69 (46.38%), Postives = 41/69 (59.42%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP  +    +LP TLDT  NR SMP+ DF SWTP+ F+ ETF  WI    RP +G  I   T  G+T++
Sbjct:  170 MPSGAAAIAVLPVTLDTPLNRKSMPHADFSSWTPLEFLVETFHDWIIEKNRPSSGSLIQVVTTQGKTEL 238          
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Match: sp|Q3T0Z7|DHPR_BOVIN (Dihydropteridine reductase OS=Bos taurus OX=9913 GN=QDPR PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.503e-11
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P  +    +LP TLDT  NR SMP  DF SWTP+ F+ ETF  WI    RP +G  I   T  G+T++
Sbjct:  169 LPPGAAAVALLPVTLDTPVNRKSMPEADFSSWTPLEFLVETFHDWITEKNRPSSGSLIQVVTTEGKTEL 237          
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Match: Q52KN0 (MGC115198 protein OS=Xenopus laevis OX=8355 GN=qdpr PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 4.252e-14
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            MP+NS    ILP TLDT  NR+SMP+ D+ SWTP+ F++ETF  WI G  RP++G  I   T+ G T++
Sbjct:  168 MPVNSAAVAILPVTLDTPANRASMPDADYTSWTPLDFIAETFYNWINGQNRPQSGSLIEVKTQKGITEL 236          
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Match: A0A0M4EAY3 (Dhpr OS=Drosophila busckii OX=30019 GN=Dbus_chr3Lg1657 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 9.264e-14
Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P +++  +ILP TLDT  NR  MPNGDF +WTP+SFV+E F KWI+  ERPK G  +   T NG T++
Sbjct:  163 LPNDALVVSILPVTLDTPMNRKWMPNGDFGTWTPLSFVAELFCKWIKAEERPKTGALLQLITTNGVTEL 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Match: A0A067QT37 (Dihydropteridine reductase OS=Zootermopsis nevadensis OX=136037 GN=L798_01556 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.726e-13
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P NS++  ILP TLDT  NR  MPN DF +WTP+ FV+E F++W  G ERP NG  ++  TKN  T++
Sbjct:  166 LPPNSLSVAILPVTLDTPMNRKWMPNADFSTWTPLEFVAELFLRWSRGEERPPNGSLVHLVTKNYTTEL 234          
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Match: S4NX17 (Dihydropteridine reductase OS=Pararge aegeria OX=116150 PE=4 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.260e-13
Identity = 34/69 (49.28%), Postives = 46/69 (66.67%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P NS+   ILP TLDT+ NR  MP  DF SWTP++FV+E F KW++G ERP +G  +   TK+  T +
Sbjct:   25 LPENSLAVAILPVTLDTEMNRKWMPKADFGSWTPLTFVAELFGKWLKGEERPPSGSLVALVTKDNITDL 93          
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Match: A0A194QYW2 (Dihydropteridine reductase OS=Papilio machaon OX=76193 GN=RR48_09613 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.268e-13
Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = -1
Query: 1102 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKI 1308
            +P NS+   I+P TLDT+ NR  MP  DF +WTP+SFV++ F KWI+G ERP +G  +   TKN  T++
Sbjct:  163 LPENSLAVAIMPVTLDTEMNRKWMPKADFSTWTPLSFVAQLFDKWIKGEERPASGSLVALVTKNNVTEL 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Cavefish
Match: qdpra (dihydropteridine reductase-like [Source:NCBI gene;Acc:103021866])

HSP 1 Score: 71.633 bits (174), Expect = 7.611e-14
Identity = 30/68 (44.12%), Postives = 41/68 (60.29%), Query Frame = -1
Query: 1105 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETK 1308
            +P  S+   ILP TLDT  NR  MP+ DF SWTP+ ++++TF  W  G+ RP +G  I   T  G T+
Sbjct:  167 LPAGSVAVAILPVTLDTPMNRKFMPDADFSSWTPLEYIAQTFYSWATGSGRPASGSLIQLVTAGGVTE 234          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Cavefish
Match: zgc:171517 (dihydropteridine reductase [Source:NCBI gene;Acc:103041363])

HSP 1 Score: 63.5438 bits (153), Expect = 3.869e-11
Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = -1
Query: 1105 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETK 1308
            +P  +    ILP TLDT  NR  MP+ D  +WTP+ +V+E   KW  G ERP +G  +   T + +T+
Sbjct:  165 LPAGASAIAILPVTLDTPMNRQFMPDADVSAWTPLEYVAELLYKWAVGEERPASGSLVQLVTTDSKTE 232          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Cavefish
Match: qdpra (dihydropteridine reductase-like [Source:NCBI gene;Acc:103021866])

HSP 1 Score: 49.2914 bits (116), Expect = 2.973e-6
Identity = 20/42 (47.62%), Postives = 28/42 (66.67%), Query Frame = -1
Query: 1183 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETF 1308
            +P  S+   ILP TLDT  NR  MP+ DF SWTP+ ++++ F
Sbjct:  167 LPAGSVAVAILPVTLDTPMNRKFMPDADFSSWTPLEYIAQYF 208          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Sea Lamprey
Match: qdpra (quinoid dihydropteridine reductase a [Source:ZFIN;Acc:ZDB-GENE-070705-197])

HSP 1 Score: 67.0106 bits (162), Expect = 5.337e-13
Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = -1
Query: 1096 TLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKINT 1269
            TLDT  NR SMPN D  +WTP+ FV+ET +KW  G  RP +G  +   T++G+T++ T
Sbjct:  182 TLDTPMNRKSMPNADTGTWTPLGFVAETLLKWAGGEGRPASGSLVQLLTESGKTQLLT 239          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Nematostella
Match: EDO42784 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0R5])

HSP 1 Score: 59.6918 bits (143), Expect = 3.367e-10
Identity = 26/67 (38.81%), Postives = 39/67 (58.21%), Query Frame = -1
Query: 1108 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGET 1308
            +P +S    ILP+TLDT  NR  MP  D   WTP+ +V++    W  G++RP +G      TK+G++
Sbjct:  168 LPPDSTALAILPNTLDTPMNRKFMPEADQSQWTPLEYVAKLMFDWSGGSDRPASGSLCKLITKDGQS 234          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Medaka
Match: qdpra (quinoid dihydropteridine reductase [Source:NCBI gene;Acc:101166857])

HSP 1 Score: 74.3294 bits (181), Expect = 8.448e-15
Identity = 32/68 (47.06%), Postives = 42/68 (61.76%), Query Frame = -1
Query: 1105 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETK 1308
            MP  +    ILP TLDT  NR  MPN DF SWTP+ +++ETF KW  G  RP +G  +   T +G+T+
Sbjct:  164 MPPGAAAVAILPVTLDTPMNRKFMPNADFSSWTPLEYIAETFFKWAAGENRPASGSLMQLLTSDGQTQ 231          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Match: SMESG000042736.1 (SMESG000042736.1)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 313/313 (100.00%), Postives = 313/313 (100.00%), Query Frame = 3
Query:   72 MIVNEKEFRRCRVFHVVPLTFTFGFVKVILHVAVIVMICTLLMKPDLLDKHETHNKVFGCLCKNKFPKSNNVIDAKTEKHTTNNDVTILLDFKPQMDEIHKLKHSVQTIHQKKLLNENKITQLYWALLMTIFYLMFSLMLLQGILTKNASNMLPXXXXXXXXXXXXXXXXXGHLIVSSDINKLELEFNCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKYEEVLXXXXXXXXXXXXVEKVDQEEKK 1010
            MIVNEKEFRRCRVFHVVPLTFTFGFVKVILHVAVIVMICTLLMKPDLLDKHETHNKVFGCLCKNKFPKSNNVIDAKTEKHTTNNDVTILLDFKPQMDEIHKLKHSVQTIHQKKLLNENKITQLYWALLMTIFYLMFSLMLLQGILTKNASNMLPFFCLQLFDFVLDLLWLFGHLIVSSDINKLELEFNCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKYEEVLNTPINTYNPPPYVEKVDQEEKK
Sbjct:    1 MIVNEKEFRRCRVFHVVPLTFTFGFVKVILHVAVIVMICTLLMKPDLLDKHETHNKVFGCLCKNKFPKSNNVIDAKTEKHTTNNDVTILLDFKPQMDEIHKLKHSVQTIHQKKLLNENKITQLYWALLMTIFYLMFSLMLLQGILTKNASNMLPFFCLQLFDFVLDLLWLFGHLIVSSDINKLELEFNCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKYEEVLNTPINTYNPPPYVEKVDQEEKK 313          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Match: SMESG000010536.1 (SMESG000010536.1)

HSP 1 Score: 166.777 bits (421), Expect = 4.816e-50
Identity = 82/100 (82.00%), Postives = 84/100 (84.00%), Query Frame = 3
Query:  633 NCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKY 932
            NCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRC ILPTSRNNVNQ+ IWGL+             RKMPEISDIVVEEL KY
Sbjct:   42 NCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCHILPTSRNNVNQSRIWGLE-------------RKMPEISDIVVEELSKY 128          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Match: SMESG000032757.1 (SMESG000032757.1)

HSP 1 Score: 162.54 bits (410), Expect = 7.780e-49
Identity = 76/84 (90.48%), Postives = 78/84 (92.86%), Query Frame = 3
Query:  684 CFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKYE 935
            CFIILMLCVTGLMVQ FFIGVIWSCYRYI ASRC ILPT RNNV QNGIWGLDLWQVILSP+NRQRRKMPEI+DIVVEELPKY 
Sbjct:   23 CFIILMLCVTGLMVQSFFIGVIWSCYRYIFASRCHILPTPRNNVYQNGIWGLDLWQVILSPQNRQRRKMPEINDIVVEELPKYR 106          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Match: SMESG000042735.1 (SMESG000042735.1)

HSP 1 Score: 150.984 bits (380), Expect = 7.135e-43
Identity = 70/72 (97.22%), Postives = 72/72 (100.00%), Query Frame = -1
Query: 1093 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPVSFVSETFIKWIEGTERPKNGDFIYFNTKNGETKINTE 1308
            MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTP+SFV+ETFIKWIEGTERPKNGDFIYFNTKNGETKINTE
Sbjct:  161 MPLNSITATILPDTLDTQPNRSSMPNGDFQSWTPLSFVAETFIKWIEGTERPKNGDFIYFNTKNGETKINTE 232          
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Match: SMESG000011514.1 (SMESG000011514.1)

HSP 1 Score: 144.436 bits (363), Expect = 2.009e-42
Identity = 67/72 (93.06%), Postives = 69/72 (95.83%), Query Frame = 3
Query:  633 NCLPIGKYFHNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQNGIWGLDLW 848
            NCLPIGKYF+NINPAISCFIILMLCVTGLMVQFFFIGVIWSCY+YIIASR  ILPT RNNVNQNGIWGLDLW
Sbjct:    6 NCLPIGKYFYNINPAISCFIILMLCVTGLMVQFFFIGVIWSCYQYIIASRYHILPTPRNNVNQNGIWGLDLW 77          
The following BLAST results are available for this feature:
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
QDPR1.558e-1347.83quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
QDPR2.682e-1347.83quinoid dihydropteridine reductase [Source:HGNC Sy... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpr-13.101e-1348.57Quinoid DihydroPteridine Reductase [Source:UniPro... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Dhpr2.097e-1344.93gene:FBgn0035964 transcript:FBtr0076531[more]
Dhpr2.097e-1344.93gene:FBgn0035964 transcript:FBtr0100531[more]
Dhpr2.097e-1344.93gene:FBgn0035964 transcript:FBtr0100532[more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
qdpra8.546e-1444.12quinoid dihydropteridine reductase a [Source:ZFIN;... [more]
qdprb27.201e-1346.27quinoid dihydropteridine reductase b2 [Source:ZFIN... [more]
BX005473.18.796e-1346.27quinoid dihydropteridine reductase b2 [Source:NCBI... [more]
BX005473.18.965e-1346.27quinoid dihydropteridine reductase b2 [Source:NCBI... [more]
BX005473.19.802e-1346.27quinoid dihydropteridine reductase b2 [Source:NCBI... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ifrd26.996e-1647.83interferon-related developmental regulator 2 [Sour... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Qdpr8.654e-1547.83quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr2.857e-1447.83quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr2.857e-1447.83quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr2.857e-1447.83quinoid dihydropteridine reductase [Source:MGI Sym... [more]
Qdpr5.769e-1447.83quinoid dihydropteridine reductase [Source:MGI Sym... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P11348|DHPR_RAT2.489e-1347.83Dihydropteridine reductase OS=Rattus norvegicus OX... [more]
sp|Q8BVI4|DHPR_MOUSE4.036e-1347.83Dihydropteridine reductase OS=Mus musculus OX=1009... [more]
sp|P09417|DHPR_HUMAN1.288e-1247.83Dihydropteridine reductase OS=Homo sapiens OX=9606... [more]
sp|Q8MJ30|DHPR_PIG7.195e-1246.38Dihydropteridine reductase OS=Sus scrofa OX=9823 G... [more]
sp|Q3T0Z7|DHPR_BOVIN2.503e-1144.93Dihydropteridine reductase OS=Bos taurus OX=9913 G... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q52KN04.252e-1450.72MGC115198 protein OS=Xenopus laevis OX=8355 GN=qdp... [more]
A0A0M4EAY39.264e-1452.17Dhpr OS=Drosophila busckii OX=30019 GN=Dbus_chr3Lg... [more]
A0A067QT371.726e-1350.72Dihydropteridine reductase OS=Zootermopsis nevaden... [more]
S4NX173.260e-1349.28Dihydropteridine reductase OS=Pararge aegeria OX=1... [more]
A0A194QYW23.268e-1349.28Dihydropteridine reductase OS=Papilio machaon OX=7... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
qdpra7.611e-1444.12dihydropteridine reductase-like [Source:NCBI gene;... [more]
zgc:1715173.869e-1139.71dihydropteridine reductase [Source:NCBI gene;Acc:1... [more]
qdpra2.973e-647.62dihydropteridine reductase-like [Source:NCBI gene;... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpra5.337e-1348.28quinoid dihydropteridine reductase a [Source:ZFIN;... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO427843.367e-1038.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
qdpra8.448e-1547.06quinoid dihydropteridine reductase [Source:NCBI ge... [more]
back to top
BLAST of Lysosomal-associated transmembrane protein 4A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042736.10.000e+0100.00SMESG000042736.1[more]
SMESG000010536.14.816e-5082.00SMESG000010536.1[more]
SMESG000032757.17.780e-4990.48SMESG000032757.1[more]
SMESG000042735.17.135e-4397.22SMESG000042735.1[more]
SMESG000011514.12.009e-4293.06SMESG000011514.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010777 ID=SMED30010777|Name=Lysosomal-associated transmembrane protein 4A|organism=Schmidtea mediterranea sexual|type=transcript|length=1308bp
CTTTGTTTATCTTTTATTTAAGGAATAAATATTTAAGTTTGATAATTAAT
TTATATTTGAATAATTAAGTTATGATAGTCAATGAAAAAGAATTTCGACG
CTGTCGAGTATTTCATGTTGTTCCATTAACTTTTACATTTGGATTCGTGA
AAGTTATTCTTCATGTTGCAGTGATAGTGATGATATGTACTCTTTTAATG
AAACCAGATTTACTCGATAAGCATGAAACTCATAATAAAGTTTTTGGTTG
TCTATGCAAAAATAAATTTCCAAAATCTAATAATGTTATTGATGCTAAAA
CCGAAAAGCATACTACAAATAATGATGTAACAATATTATTAGATTTTAAA
CCACAGATGGATGAAATTCATAAATTAAAACATAGCGTACAAACTATTCA
CCAAAAAAAGTTATTAAACGAAAATAAGATTACACAGCTTTACTGGGCTC
TCTTAATGACAATATTTTATTTAATGTTTAGCCTAATGCTGTTACAAGGA
ATCCTGACTAAAAATGCATCAAATATGCTACCCTTTTTCTGTTTACAGTT
GTTTGATTTTGTTTTGGATTTATTATGGTTATTTGGTCATTTAATAGTTT
CCAGTGATATTAATAAATTAGAATTAGAATTTAACTGCTTACCGATTGGA
AAATACTTTCATAACATTAATCCAGCTATTTCATGTTTTATCATATTGAT
GCTTTGTGTTACAGGCTTGATGGTACAATTCTTTTTCATTGGTGTAATAT
GGTCTTGTTATCGATATATTATTGCGTCACGTTGTCAAATATTACCAACA
TCACGAAACAATGTTAATCAAAATGGAATTTGGGGTTTGGATTTATGGCA
AGTTATTTTGTCTCCTAAAAATCGTCAAAGAAGAAAGATGCCGGAAATAA
GTGACATTGTAGTAGAGGAATTGCCGAAATATGAGGAAGTTTTGAACACC
CCAATCAATACATACAACCCTCCGCCTTATGTGGAGAAGGTTGACCAGGA
AGAAAAAAAATAGAACTCTGATTAAATGACAAATGAAACAATAATTATAA
TTTTATCGATGTCAAGTTATTAATAAATAGTCTCATCATTTATTCAGTAT
TTATTTTTGTTTCCCCATTTTTTGTATTGAAATATATGAAATCTCCATTT
TTTGGACGTTCTGTGCCTTCAATCCATTTTATAAAAGTTTCGGATACGAA
AGATACTGGTGTCCAAGATTGAAAATCACCATTAGGCATACTTGATCTAT
TTGGTTGAGTGTCTAAAGTATCTGGTAAGATAGTGGCCGTGATAGAATTT
AATGGCAT
back to top

protein sequence of SMED30010777-orf-1

>SMED30010777-orf-1 ID=SMED30010777-orf-1|Name=SMED30010777-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MIVNEKEFRRCRVFHVVPLTFTFGFVKVILHVAVIVMICTLLMKPDLLDK
HETHNKVFGCLCKNKFPKSNNVIDAKTEKHTTNNDVTILLDFKPQMDEIH
KLKHSVQTIHQKKLLNENKITQLYWALLMTIFYLMFSLMLLQGILTKNAS
NMLPFFCLQLFDFVLDLLWLFGHLIVSSDINKLELEFNCLPIGKYFHNIN
PAISCFIILMLCVTGLMVQFFFIGVIWSCYRYIIASRCQILPTSRNNVNQ
NGIWGLDLWQVILSPKNRQRRKMPEISDIVVEELPKYEEVLNTPINTYNP
PPYVEKVDQEEKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016040NAD(P)-bd_dom
IPR004687LAPTM4/5