SMED30010770

Overview
NameSMED30010770
Smed IDSMED30010770
Length (bp)1136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30010770 (SMED30010770) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30010770 (SMED30010770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010770 (SMED30010770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010770 (SMED30010770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010770h1SMcG0020649 dd_Smed_v4_8158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010770h1SMcG0020649 dd_Smed_v4_8158_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30010770h1SMcG0020649 dd_Smed_v4_12528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30010770h1SMcG0020649 dd_Smed_v4_12528_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010770 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000481:10629..13104 +4846
Homology
BLAST of SMED30010770 vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 52.373 bits (124), Expect = 4.228e-7
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 52.7582 bits (125), Expect = 7.823e-7
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 52.7582 bits (125), Expect = 7.823e-7
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 52.7582 bits (125), Expect = 7.823e-7
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. Ensembl Human
Match: ZBED1 (zinc finger BED-type containing 1 [Source:HGNC Symbol;Acc:HGNC:447])

HSP 1 Score: 52.7582 bits (125), Expect = 7.823e-7
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. Ensembl Xenopus
Match: ENSXETT00000038245.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:100486384])

HSP 1 Score: 51.2174 bits (121), Expect = 1.892e-6
Identity = 26/74 (35.14%), Postives = 35/74 (47.30%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGFLS-IRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTGP 493
            LV L  + S  W +FGF     G I D+  + CK C +R+ YS NT+NL +H    H   Y  L   +     P
Sbjct:  142 LVSLGRAQSRYWTFFGFQGDAYGRIIDKTKIICKLCGVRLSYSGNTTNLRQHLIYKHRRQYNDLVGTQGAVVDP 215          
BLAST of SMED30010770 vs. Ensembl Xenopus
Match: ENSXETT00000026109.1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:100486384])

HSP 1 Score: 51.6026 bits (122), Expect = 1.936e-6
Identity = 26/74 (35.14%), Postives = 35/74 (47.30%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGFLS-IRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTGP 493
            LV L  + S  W +FGF     G I D+  + CK C +R+ YS NT+NL +H    H   Y  L   +     P
Sbjct:  256 LVSLGRAQSRYWTFFGFQGDAYGRIIDKTKIICKLCGVRLSYSGNTTNLRQHLIYKHRRQYNDLVGTQGAVVDP 329          
BLAST of SMED30010770 vs. Ensembl Xenopus
Match: ZBED1 (zinc finger BED domain-containing protein 1-like [Source:NCBI gene;Acc:105945140])

HSP 1 Score: 50.8322 bits (120), Expect = 3.148e-6
Identity = 26/61 (42.62%), Postives = 34/61 (55.74%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY 454
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPDEF 75          
BLAST of SMED30010770 vs. UniProt/SwissProt
Match: sp|O96006|ZBED1_HUMAN (Zinc finger BED domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBED1 PE=1 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 3.757e-6
Identity = 52/190 (27.37%), Postives = 75/190 (39.47%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDY--------EQL---YAMRKIRTGPEV-----HEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEV-TPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNL 790
            LV  P + S VWKYFGF  +  G I     +YC+ C  +I YS NTSNL  H   +H  ++        EQ+   +A    +  PE       +  A K     +      + A++LG                  C    P   V +P     ++T++P   + S  YIS  A    P+K   V  V L
Sbjct:   15 LVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMAQIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPESSQQPGQDALAVKAGHGYDSKKQQELTAAVLGLI----------------CEGLYPASIVDEPTFKVLLKTADPRYELPSRKYISTKA---IPEKYGAVREVIL 185          
BLAST of SMED30010770 vs. TrEMBL
Match: A0A232EEF3 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_016529 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.673e-7
Identity = 48/136 (35.29%), Postives = 67/136 (49.26%), Query Frame = 2
Query:  299 SIVWKYFGFLSIR-GEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYA----MRKIRTGPEVHEPTAAKR-FRSSNPSGDNNI---NASLLGNCQIKLDM---VDPEPIYIDSCSSSEPLKNVSKP 670
            SI WK+FGFL+   GEI  R  + C  CK +I Y+ NTSN   H    H  +  +L A    M++I T PE  E  A KR  +++  S   +I   NA   G  QI  D+    DP   + + C   +   N++KP
Sbjct:  508 SIYWKFFGFLADENGEIVTRVRIVCLLCKAQITYNRNTSNRRMHLQNKHVQELHELEALSPPMKQIIT-PESKERRAQKRMLKAAMASSSQHIYTTNAD--GTVQIGGDIQFVTDPSVAFPEQCMEEDVTVNINKP 640          

HSP 2 Score: 61.2326 bits (147), Expect = 2.710e-6
Identity = 46/135 (34.07%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  299 SIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAM---RKIRTGPEVHEPTAAKR-FRSSNPSGDNNI---NASLLGNCQIKLDM---VDPEPIYIDSCSSSEPLKNVSKP 670
            SI WK+FGF     GEI  R  + C  CK +I Y+ NTSNL  H    H  +  +L A+   RK    PE  E  A KR  +++  S   +I   NA   G  QI  D+    D    + + C   +   N++KP
Sbjct:  748 SIYWKFFGFPADDDGEILTRVKIVCLLCKTQIAYNRNTSNLRMHLQNKHVQELHELEALSPPRKQIITPESKERRAQKRMLKAAMASSSQHIYTTNAD--GTVQIGGDIQFVTDSSVAFPEQCMEEDMTVNINKP 880          
BLAST of SMED30010770 vs. TrEMBL
Match: K7JTF5 (BED-type domain-containing protein OS=Nasonia vitripennis OX=7425 GN=100678264 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.770e-7
Identity = 46/135 (34.07%), Postives = 64/135 (47.41%), Query Frame = 2
Query:  299 SIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAM---RKIRTGPEVHEPTAAKR-FRSSNPSGDNNI---NASLLGNCQIKLDM---VDPEPIYIDSCSSSEPLKNVSKP 670
            SI WK+FGF     GEI  R  + C  CK +I Y+ NTSNL  H    H  +  +L A+   +K    PE  E  A KR  +++  S   +I   NA   G  QI  D+    DP   + + C   +   N++KP
Sbjct:   75 SIYWKFFGFPADDDGEILTRVKIVCLLCKTQIAYNRNTSNLRMHLQNKHVQELHELEALSPPKKQTITPESKERRAQKRMLKAAMASSSQHIYTTNAD--GTVQIGGDIQFVTDPSVAFPEQCMEEDMTVNINKP 207          
BLAST of SMED30010770 vs. TrEMBL
Match: A0A1X7UWF3 (BED-type domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 5.342e-7
Identity = 31/77 (40.26%), Postives = 44/77 (57.14%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGFLSIRGEIDD-----RNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTG 490
            L+PLP +TS+VWKYFGF ++ G   +     R  VYCK C   +KYS NT+N+  H   +H + +  L   +K   G
Sbjct:   17 LLPLPGATSVVWKYFGFPAVDGNFTEPDKKKRTNVYCKLCPKVLKYSGNTTNMCYHLELNHRTQFLLLQENKKKENG 93          
BLAST of SMED30010770 vs. TrEMBL
Match: T1JQC2 (BED-type domain-containing protein OS=Tetranychus urticae OX=32264 GN=107369698 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 1.100e-6
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  275 LVPLPLSTSIVWKYFGFLS-IRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHH 442
            +VPLP + S VW YFGF++   GEI D+  V CK C   + YS NT+NL+ H    H
Sbjct:   63 VVPLPHARSEVWAYFGFIAGDDGEIQDKKKVVCKLCATTLSYSGNTTNLFTHLKALH 119          
BLAST of SMED30010770 vs. TrEMBL
Match: A0A232EQH3 (BED-type domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_008478 PE=4 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 1.493e-6
Identity = 46/135 (34.07%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  299 SIVWKYFGF-LSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAM---RKIRTGPEVHEPTAAKR-FRSSNPSGDNNI---NASLLGNCQIKLDM---VDPEPIYIDSCSSSEPLKNVSKP 670
            SI WK+FGF     GEI  R  + C  CK +I Y+ NTSNL  H    H  +  +L A+   RK    PE  E  A KR  +++  S   +I   NA   G  QI  D+    D    + + C   +   N++KP
Sbjct:   75 SIYWKFFGFPADDDGEILTRVKIVCLLCKTQIAYNRNTSNLRMHLQNKHVQELHELEALSPPRKQIITPESKERRAQKRMLKAAMASSSQHIYTTNAD--GTVQIGGDIQFVTDSSVAFPEQCMEEDMTVNINKP 207          
BLAST of SMED30010770 vs. Ensembl Cavefish
Match: ENSAMXT00000046756.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:9736382:9743382:-1 gene:ENSAMXG00000040138.1 transcript:ENSAMXT00000046756.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 4.606e-6
Identity = 23/60 (38.33%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  290 LSTSIVWKYFGFLSIRGEID-DRNYVYCKRCKMRIKYSNNTSNLYKHFATHH--SSDYEQ 460
            L  + +W +FGF  + G+ + D +++ CK CKM+IK   NT+N   H   HH    D EQ
Sbjct:   13 LKAAKIWNHFGFYRMPGKTELDMSFIVCKVCKMKIKNFGNTTNARAHITRHHPELKDAEQ 72          
BLAST of SMED30010770 vs. Planmine SMEST
Match: SMESG000019888.1 (SMESG000019888.1)

HSP 1 Score: 488.419 bits (1256), Expect = 1.141e-174
Identity = 236/238 (99.16%), Postives = 236/238 (99.16%), Query Frame = 2
Query:  254 MDIDIDSLVPLPLSTSIVWKYFGFLSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTGPEVHEPTAAKRFRSSNPSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEVTPIQTSNPNRFITSSPYISVNAAHNFPKKSSYVNSVNLPTREAPSAVVNNGNLSNSYSYQIPNISESGSFLNCPVTHKSVKCSENPHKPSQWGAYCQ 967
            MDIDIDSLVPLPLSTSIVWKYFGFLSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTGPEVHEPTAAKRFRSSN SGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEVTPIQTSNPNRFITSSPYI VNAAHNFPKKSSYVNSVNLPTREAPSAVVNNGNLSNSYSYQIPNISESGSFLNCPVTHKSVKCSENPHKPSQWGAYCQ
Sbjct:    1 MDIDIDSLVPLPLSTSIVWKYFGFLSIRGEIDDRNYVYCKRCKMRIKYSNNTSNLYKHFATHHSSDYEQLYAMRKIRTGPEVHEPTAAKRFRSSNLSGDNNINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEVTPIQTSNPNRFITSSPYIPVNAAHNFPKKSSYVNSVNLPTREAPSAVVNNGNLSNSYSYQIPNISESGSFLNCPVTHKSVKCSENPHKPSQWGAYCQ 238          
BLAST of SMED30010770 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.816e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query: 1028 LTSQNSHNLPRSYSHNQMCPTLSETLSSII 1117
            LTSQNSHNLPRSYSHNQMCPTLSETLSSII
Sbjct:  535 LTSQNSHNLPRSYSHNQMCPTLSETLSSII 564          
BLAST of SMED30010770 vs. Planmine SMEST
Match: SMESG000049136.1 (SMESG000049136.1)

HSP 1 Score: 64.6994 bits (156), Expect = 3.926e-11
Identity = 30/30 (100.00%), Postives = 30/30 (100.00%), Query Frame = 2
Query: 1028 LTSQNSHNLPRSYSHNQMCPTLSETLSSII 1117
            LTSQNSHNLPRSYSHNQMCPTLSETLSSII
Sbjct:  494 LTSQNSHNLPRSYSHNQMCPTLSETLSSII 523          
The following BLAST results are available for this feature:
BLAST of SMED30010770 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED14.228e-727.37zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED17.823e-727.37zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED17.823e-727.37zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED17.823e-727.37zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
ZBED17.823e-727.37zinc finger BED-type containing 1 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30010770 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000038245.11.892e-635.14zinc finger BED domain-containing protein 1-like [... [more]
ENSXETT00000026109.11.936e-635.14zinc finger BED domain-containing protein 1-like [... [more]
ZBED13.148e-642.62zinc finger BED domain-containing protein 1-like [... [more]
back to top
BLAST of SMED30010770 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|O96006|ZBED1_HUMAN3.757e-627.37Zinc finger BED domain-containing protein 1 OS=Hom... [more]
back to top
BLAST of SMED30010770 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A232EEF32.673e-735.29Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
K7JTF52.770e-734.07BED-type domain-containing protein OS=Nasonia vitr... [more]
A0A1X7UWF35.342e-740.26BED-type domain-containing protein OS=Amphimedon q... [more]
T1JQC21.100e-647.37BED-type domain-containing protein OS=Tetranychus ... [more]
A0A232EQH31.493e-634.07BED-type domain-containing protein OS=Trichomalops... [more]
back to top
BLAST of SMED30010770 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000046756.14.606e-638.33pep primary_assembly:Astyanax_mexicanus-2.0:22:973... [more]
back to top
BLAST of SMED30010770 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010770 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000019888.11.141e-17499.16SMESG000019888.1[more]
SMESG000049136.13.816e-11100.00SMESG000049136.1[more]
SMESG000049136.13.926e-11100.00SMESG000049136.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010770 ID=SMED30010770|Name=SMED30010770|organism=Schmidtea mediterranea sexual|type=transcript|length=1136bp
CACACAAACACATCGACACGACAAAACAAAATACTAGGACAGAGTATTGA
GCTGTTTGTGCGTGTTCTATGCAAGCATGCTATTGCACACACCACATGCG
CGATACCTCTGCAATACCGCACACTCACAAATACCAGTAAGCGTGTGTGT
ATGTGTGCGTATTGATTACTGCAATACATTACTGCATACAGAATGAAGTG
ATTAATGCGTCAATAATACAATCGATCGATTGATACAATAAATCACCAAC
AAAATGGATATCGACATCGACAGTCTCGTGCCTTTGCCTCTATCTACGAG
CATCGTTTGGAAATACTTTGGATTCCTGAGCATCCGTGGAGAGATTGACG
ATCGGAATTATGTCTATTGCAAGCGATGCAAAATGCGAATCAAATATTCT
AACAATACTTCCAATCTCTACAAGCATTTTGCGACCCACCATTCCAGTGA
TTATGAGCAGCTCTATGCCATGCGCAAGATACGAACCGGTCCAGAAGTTC
ATGAACCGACAGCGGCGAAACGATTCAGAAGCAGCAACCCATCCGGCGAT
AACAATATCAATGCTTCTCTTCTAGGAAATTGTCAAATAAAACTTGATAT
GGTGGATCCAGAACCGATTTATATTGACTCGTGTTCTTCCAGTGAGCCGT
TGAAAAATGTATCGAAACCGGAAGTCACCCCAATCCAGACCTCTAATCCC
AACAGATTCATCACTTCCTCACCTTATATCTCGGTAAACGCTGCTCACAA
TTTCCCCAAGAAATCCTCTTATGTAAACTCGGTGAATTTGCCCACTCGTG
AGGCGCCTTCTGCAGTGGTTAACAATGGAAATCTTTCAAATTCTTACAGT
TATCAGATTCCGAATATTTCTGAATCTGGGAGTTTCCTCAATTGTCCAGT
CACGCACAAATCAGTGAAATGTTCGGAAAATCCCCACAAACCGAGCCAGT
GGGGAGCTTATTGTCAGAATAATAATAATAATAACAATACCAATAATACT
AATAATTATAATTATTATAATAACAATCTTACTAGTCAAAATTCTCACAA
TCTCCCTAGATCGTATTCCCACAACCAGATGTGCCCCACTCTCAGTGAAA
CATTATCATCTATCATATAATGATTCTGTCTCGAAT
back to top

protein sequence of SMED30010770-orf-1

>SMED30010770-orf-1 ID=SMED30010770-orf-1|Name=SMED30010770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MDIDIDSLVPLPLSTSIVWKYFGFLSIRGEIDDRNYVYCKRCKMRIKYSN
NTSNLYKHFATHHSSDYEQLYAMRKIRTGPEVHEPTAAKRFRSSNPSGDN
NINASLLGNCQIKLDMVDPEPIYIDSCSSSEPLKNVSKPEVTPIQTSNPN
RFITSSPYISVNAAHNFPKKSSYVNSVNLPTREAPSAVVNNGNLSNSYSY
QIPNISESGSFLNCPVTHKSVKCSENPHKPSQWGAYCQNNNNNNNTNNTN
NYNYYNNNLTSQNSHNLPRSYSHNQMCPTLSETLSSII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR003656Znf_BED
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity