Cytochrome c heme lyase

Overview
NameCytochrome c heme lyase
Smed IDSMED30010757
Length (bp)972
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytochrome c heme lyase (SMED30010757) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytochrome c heme lyase (SMED30010757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytochrome c heme lyase (SMED30010757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytochrome c heme lyase (SMED30010757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30010757h1SMcG0006094 dd_Smed_v4_2573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010757h1SMcG0006094 dd_Smed_v4_2573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010757h1SMcG0006094 dd_Smed_v4_2573_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytochrome c heme lyase vs. Ensembl Human
Match: HCCS (holocytochrome c synthase [Source:HGNC Symbol;Acc:HGNC:4837])

HSP 1 Score: 261.536 bits (667), Expect = 2.970e-86
Identity = 124/206 (60.19%), Postives = 155/206 (75.24%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP+       +  +DP+N + PP Q PA DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM +KGWKWKD++++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+  +QF  LDVRPA+DS  A++DR K   WRWTS
Sbjct:   65 ECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEK--KWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS 268          
BLAST of Cytochrome c heme lyase vs. Ensembl Human
Match: HCCS (holocytochrome c synthase [Source:HGNC Symbol;Acc:HGNC:4837])

HSP 1 Score: 261.536 bits (667), Expect = 2.970e-86
Identity = 124/206 (60.19%), Postives = 155/206 (75.24%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP+       +  +DP+N + PP Q PA DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM +KGWKWKD++++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+  +QF  LDVRPA+DS  A++DR K   WRWTS
Sbjct:   65 ECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEK--KWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS 268          
BLAST of Cytochrome c heme lyase vs. Ensembl Human
Match: HCCS (holocytochrome c synthase [Source:HGNC Symbol;Acc:HGNC:4837])

HSP 1 Score: 261.536 bits (667), Expect = 2.970e-86
Identity = 124/206 (60.19%), Postives = 155/206 (75.24%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP+       +  +DP+N + PP Q PA DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM +KGWKWKD++++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+  +QF  LDVRPA+DS  A++DR K   WRWTS
Sbjct:   65 ECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEK--KWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS 268          
BLAST of Cytochrome c heme lyase vs. Ensembl Celegans
Match: cchl-1 (Probable cytochrome c-type heme lyase [Source:UniProtKB/Swiss-Prot;Acc:P53703])

HSP 1 Score: 217.238 bits (552), Expect = 4.664e-69
Identity = 120/242 (49.59%), Postives = 153/242 (63.22%), Query Frame = 2
Query:  152 NECPIS-QNAKNESNLTAPAPSECPMSKGDDVEQPQIDP-NNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRL-LGYEYPFDRHDWIVDRCG-KEVRYVIDYYD-GEVDAKFQ-FASLDVRPAMDSFQALFDRTKATVWRWT----SAKPNLPI 847
            ++CP++ +     S     A   CP+      ++  I+P NN +  P Q PA DQPF L   R +S+IPK  G E + W YPS QMFWNAM +KGW+W+DD +++ D+ NII +HN NNE AWREVL WE++   EC  PKLK F G AK  SPRAR R L LGY+ PFDRHDWIVDRCG K+V+YVIDYYD G VD   + F  LDVRPA++    ++DR     WR+        P+LPI
Sbjct:   34 SQCPLTPEQRAAASGENCGAGGACPVG----ADKASINPLNNELEHPNQKPAPDQPFALPTKREKSTIPKA-GTETETWTYPSPQMFWNAMLKKGWRWQDDSLSKSDMENIISIHNANNEEAWREVLKWENLLHPECAEPKLKSFKGDAKNLSPRARFRNLFLGYDLPFDRHDWIVDRCGTKQVQYVIDYYDGGAVDPSSKLFTILDVRPAVNDIGNIWDRMVVAYWRFKFETLGFTPSLPI 270          
BLAST of Cytochrome c heme lyase vs. Ensembl Celegans
Match: cchl-1 (Probable cytochrome c-type heme lyase [Source:UniProtKB/Swiss-Prot;Acc:P53703])

HSP 1 Score: 217.238 bits (552), Expect = 4.664e-69
Identity = 120/242 (49.59%), Postives = 153/242 (63.22%), Query Frame = 2
Query:  152 NECPIS-QNAKNESNLTAPAPSECPMSKGDDVEQPQIDP-NNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRL-LGYEYPFDRHDWIVDRCG-KEVRYVIDYYD-GEVDAKFQ-FASLDVRPAMDSFQALFDRTKATVWRWT----SAKPNLPI 847
            ++CP++ +     S     A   CP+      ++  I+P NN +  P Q PA DQPF L   R +S+IPK  G E + W YPS QMFWNAM +KGW+W+DD +++ D+ NII +HN NNE AWREVL WE++   EC  PKLK F G AK  SPRAR R L LGY+ PFDRHDWIVDRCG K+V+YVIDYYD G VD   + F  LDVRPA++    ++DR     WR+        P+LPI
Sbjct:   34 SQCPLTPEQRAAASGENCGAGGACPVG----ADKASINPLNNELEHPNQKPAPDQPFALPTKREKSTIPKA-GTETETWTYPSPQMFWNAMLKKGWRWQDDSLSKSDMENIISIHNANNEEAWREVLKWENLLHPECAEPKLKSFKGDAKNLSPRARFRNLFLGYDLPFDRHDWIVDRCGTKQVQYVIDYYDGGAVDPSSKLFTILDVRPAVNDIGNIWDRMVVAYWRFKFETLGFTPSLPI 270          
BLAST of Cytochrome c heme lyase vs. Ensembl Fly
Match: Cchl (gene:FBgn0038925 transcript:FBtr0335198)

HSP 1 Score: 252.677 bits (644), Expect = 6.604e-83
Identity = 130/265 (49.06%), Postives = 169/265 (63.77%), Query Frame = 2
Query:   56 IGISFIINCE*MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAP-------SECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKF--DGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGE-VDAKFQFASLDVRPAMDSFQALFDRTKATVWRW 820
            +G + I   +   + S  + +   ++     P ECP+ Q   +  + +A  P       SECP+      +   ++P N + P  Q PA DQPFPL  DR  S+IPK   DG     W YPS QMFWNAM RKGW+WK ++V+++D+ +II +HN NNE AW+EVL WE++H  EC  P+LK FGGKAK++SPRAR R  LGYE PFDRHDWIVDRCGK+VRYVIDYYDG  VD  ++FA LDVRPAMDS   ++DR +    RW
Sbjct:    1 MGNTAITRVQMEATKSVPVDHAKYMSGSGAPPPECPMHQKHGDAKSASAVPPHPKMQAASECPVQH----DNSDVNPLNMMPPANQQPAADQPFPLPTDRQTSTIPKVTEDGSV-QFWQYPSQQMFWNAMLRKGWRWKTEDVSQKDMGDIIRIHNANNEQAWQEVLKWEALHAKECGNPRLKSFGGKAKDFSPRARFRSWLGYELPFDRHDWIVDRCGKDVRYVIDYYDGGLVDKDYRFALLDVRPAMDSVDNVWDRMRVAYMRW 260          
BLAST of Cytochrome c heme lyase vs. Ensembl Fly
Match: Cchl (gene:FBgn0038925 transcript:FBtr0084185)

HSP 1 Score: 252.677 bits (644), Expect = 6.604e-83
Identity = 130/265 (49.06%), Postives = 169/265 (63.77%), Query Frame = 2
Query:   56 IGISFIINCE*MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAP-------SECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKF--DGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGE-VDAKFQFASLDVRPAMDSFQALFDRTKATVWRW 820
            +G + I   +   + S  + +   ++     P ECP+ Q   +  + +A  P       SECP+      +   ++P N + P  Q PA DQPFPL  DR  S+IPK   DG     W YPS QMFWNAM RKGW+WK ++V+++D+ +II +HN NNE AW+EVL WE++H  EC  P+LK FGGKAK++SPRAR R  LGYE PFDRHDWIVDRCGK+VRYVIDYYDG  VD  ++FA LDVRPAMDS   ++DR +    RW
Sbjct:    1 MGNTAITRVQMEATKSVPVDHAKYMSGSGAPPPECPMHQKHGDAKSASAVPPHPKMQAASECPVQH----DNSDVNPLNMMPPANQQPAADQPFPLPTDRQTSTIPKVTEDGSV-QFWQYPSQQMFWNAMLRKGWRWKTEDVSQKDMGDIIRIHNANNEQAWQEVLKWEALHAKECGNPRLKSFGGKAKDFSPRARFRSWLGYELPFDRHDWIVDRCGKDVRYVIDYYDGGLVDKDYRFALLDVRPAMDSVDNVWDRMRVAYMRW 260          
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Match: hccsb (holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-GENE-000607-78])

HSP 1 Score: 267.7 bits (683), Expect = 8.199e-89
Identity = 130/206 (63.11%), Postives = 156/206 (75.73%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDA-KFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECPM   +      IDP N + PP Q+PA DQPFPLS+ R ES IP+  G E + W+YPS QMFWNAM RKGW+WKDD +  ED++NII +HN NN+ AW+E+L WE++H  EC   P LKRFGGKAKE+SPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYYDG++D   +QF+ LDVRPA DS QA++DR K   WRWTS
Sbjct:   70 ECPMRAKEGA----IDPTNMMPPPNQVPAPDQPFPLSVKREESKIPR-SGTEQN-WVYPSEQMFWNAMLRKGWRWKDDTLAPEDMSNIIQIHNRNNDQAWQEILKWEALHASECPCGPSLKRFGGKAKEFSPRARIRHWMGYELPFDRHDWIVDRCGKEVRYVIDYYDGDIDKDSYQFSILDVRPAFDSMQAVWDRMKVAWWRWTS 269          
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Match: hccsb (holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-GENE-000607-78])

HSP 1 Score: 267.7 bits (683), Expect = 8.199e-89
Identity = 130/206 (63.11%), Postives = 156/206 (75.73%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDA-KFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECPM   +      IDP N + PP Q+PA DQPFPLS+ R ES IP+  G E + W+YPS QMFWNAM RKGW+WKDD +  ED++NII +HN NN+ AW+E+L WE++H  EC   P LKRFGGKAKE+SPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYYDG++D   +QF+ LDVRPA DS QA++DR K   WRWTS
Sbjct:   70 ECPMRAKEGA----IDPTNMMPPPNQVPAPDQPFPLSVKREESKIPR-SGTEQN-WVYPSEQMFWNAMLRKGWRWKDDTLAPEDMSNIIQIHNRNNDQAWQEILKWEALHASECPCGPSLKRFGGKAKEFSPRARIRHWMGYELPFDRHDWIVDRCGKEVRYVIDYYDGDIDKDSYQFSILDVRPAFDSMQAVWDRMKVAWWRWTS 269          
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Match: hccsa.1 (holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-GENE-040718-202])

HSP 1 Score: 253.447 bits (646), Expect = 4.531e-83
Identity = 127/245 (51.84%), Postives = 163/245 (66.53%), Query Frame = 2
Query:  131 TDENVHPNECPISQNAKNESNLTAPAPS---------ECPM--SKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
             +E+V P ECP+ Q +++ +      P+         ECPM  + G       I+P N + PP Q P+ DQPFPLS+ R ES+IP+   ++   W+YPS QMFWNAM RKGW+W  D++ + D+ +II +HN NNE AW+E+L WE +H  EC   P L RFGGKAK++SPRAR R  +G+E PFDRHDWIVDRCGKEVRYVIDYYDG + +K     LDVRPA DS  A++DR K T WRWTS 
Sbjct:   36 VNESVPPPECPMHQASRDHTKKAPDVPAHQDRAYEFVECPMRAASGTKPTLSDINPANMMPPPNQQPSADQPFPLSVVREESTIPRAGAEQ--NWVYPSEQMFWNAMLRKGWRWNKDDINQNDMGDIIKIHNQNNEQAWQEILRWEKLHSKECPCGPSLLRFGGKAKDFSPRARFRYWMGHELPFDRHDWIVDRCGKEVRYVIDYYDGGLVSKHTI--LDVRPAFDSLGAVWDRMKVTWWRWTST 276          
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Match: hccsa.1 (holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-GENE-040718-202])

HSP 1 Score: 253.447 bits (646), Expect = 4.531e-83
Identity = 127/245 (51.84%), Postives = 163/245 (66.53%), Query Frame = 2
Query:  131 TDENVHPNECPISQNAKNESNLTAPAPS---------ECPM--SKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
             +E+V P ECP+ Q +++ +      P+         ECPM  + G       I+P N + PP Q P+ DQPFPLS+ R ES+IP+   ++   W+YPS QMFWNAM RKGW+W  D++ + D+ +II +HN NNE AW+E+L WE +H  EC   P L RFGGKAK++SPRAR R  +G+E PFDRHDWIVDRCGKEVRYVIDYYDG + +K     LDVRPA DS  A++DR K T WRWTS 
Sbjct:   36 VNESVPPPECPMHQASRDHTKKAPDVPAHQDRAYEFVECPMRAASGTKPTLSDINPANMMPPPNQQPSADQPFPLSVVREESTIPRAGAEQ--NWVYPSEQMFWNAMLRKGWRWNKDDINQNDMGDIIKIHNQNNEQAWQEILRWEKLHSKECPCGPSLLRFGGKAKDFSPRARFRYWMGHELPFDRHDWIVDRCGKEVRYVIDYYDGGLVSKHTI--LDVRPAFDSLGAVWDRMKVTWWRWTST 276          
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Match: hccsa.1 (holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-GENE-040718-202])

HSP 1 Score: 253.447 bits (646), Expect = 4.531e-83
Identity = 127/245 (51.84%), Postives = 163/245 (66.53%), Query Frame = 2
Query:  131 TDENVHPNECPISQNAKNESNLTAPAPS---------ECPM--SKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
             +E+V P ECP+ Q +++ +      P+         ECPM  + G       I+P N + PP Q P+ DQPFPLS+ R ES+IP+   ++   W+YPS QMFWNAM RKGW+W  D++ + D+ +II +HN NNE AW+E+L WE +H  EC   P L RFGGKAK++SPRAR R  +G+E PFDRHDWIVDRCGKEVRYVIDYYDG + +K     LDVRPA DS  A++DR K T WRWTS 
Sbjct:   36 VNESVPPPECPMHQASRDHTKKAPDVPAHQDRAYEFVECPMRAASGTKPTLSDINPANMMPPPNQQPSADQPFPLSVVREESTIPRAGAEQ--NWVYPSEQMFWNAMLRKGWRWNKDDINQNDMGDIIKIHNQNNEQAWQEILRWEKLHSKECPCGPSLLRFGGKAKDFSPRARFRYWMGHELPFDRHDWIVDRCGKEVRYVIDYYDGGLVSKHTI--LDVRPAFDSLGAVWDRMKVTWWRWTST 276          
BLAST of Cytochrome c heme lyase vs. Ensembl Xenopus
Match: hccs (holocytochrome c synthase [Source:NCBI gene;Acc:448226])

HSP 1 Score: 275.018 bits (702), Expect = 5.627e-91
Identity = 142/263 (53.99%), Postives = 170/263 (64.64%), Query Frame = 2
Query:  104 SSLRNRSGLTDENVHPNECPISQ-----------NAKNESNLTAPAPSE-------CPMSKG--DDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            SS+ ++S       HP ECP+ Q           + +N  N + P   E       CPM  G  DD     IDP+N + PP Q PA DQPF LS+ R ES+IP+    +   W+YPS QMFWNAM RKGW+WK+D++  ED+ NII +HN NNE AW E+L WE++H  EC   P L RFGGKA EYSPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYYD GEVD  +QF  LDVRPA DS  A++DR K   WRWTS
Sbjct:   53 SSIPSQSSTESAKTHPAECPMHQKKMEGCPMHKESIQNTENCSGPTHQEEAYRYVQCPMRSGVKDD-----IDPSNMMPPPNQTPATDQPFSLSLAREESTIPRSSTDKN--WVYPSEQMFWNAMLRKGWRWKEDDLKPEDMTNIIRIHNKNNEQAWSEILKWEALHAKECPCGPTLVRFGGKATEYSPRARMRSWMGYELPFDRHDWIVDRCGKEVRYVIDYYDGGEVDKNYQFTILDVRPAFDSMGAIWDRMKVAWWRWTS 308          
BLAST of Cytochrome c heme lyase vs. Ensembl Mouse
Match: Hccs (holocytochrome c synthetase [Source:MGI Symbol;Acc:MGI:106911])

HSP 1 Score: 268.085 bits (684), Expect = 8.202e-89
Identity = 125/206 (60.68%), Postives = 158/206 (76.70%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP++     ++  +DP+N + PP Q P+ DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM RKGWKWKDD+++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKA+EYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+ ++QF  LDVRPA DSF A++DR K   WRWTS
Sbjct:   69 ECPVTGARAKDKESLDPSNLMPPPNQTPSPDQPFTLSTSREESSIPRADSEK--KWVYPSEQMFWNAMLRKGWKWKDDDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWTS 272          
BLAST of Cytochrome c heme lyase vs. Ensembl Mouse
Match: Hccs (holocytochrome c synthetase [Source:MGI Symbol;Acc:MGI:106911])

HSP 1 Score: 268.085 bits (684), Expect = 8.202e-89
Identity = 125/206 (60.68%), Postives = 158/206 (76.70%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP++     ++  +DP+N + PP Q P+ DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM RKGWKWKDD+++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKA+EYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+ ++QF  LDVRPA DSF A++DR K   WRWTS
Sbjct:   69 ECPVTGARAKDKESLDPSNLMPPPNQTPSPDQPFTLSTSREESSIPRADSEK--KWVYPSEQMFWNAMLRKGWKWKDDDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWTS 272          
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Match: sp|Q5F339|CCHL_CHICK (Cytochrome c-type heme lyase OS=Gallus gallus OX=9031 GN=HCCS PE=2 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 6.408e-90
Identity = 139/248 (56.05%), Postives = 165/248 (66.53%), Query Frame = 2
Query:  149 PNECPISQ-------------NAKNESNLTAPAPSE-------CPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            P+ECP+ Q             + + E+    PA  E       CP+  G       IDP+N + PP Q+P+ DQPFPLS  R ESSIP+       KW+YPS QMFWNAM RKGW+WKDD++T ED+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYYD G VD  +QF  LDVRPA DS  A++DR K   WRWTS
Sbjct:   28 PSECPMHQEKMRGCPMHMKASDRRAENTDDVPAHQERAYEYVACPVKSGASQVNDDIDPSNMMPPPNQLPSPDQPFPLSTVREESSIPR--AHSDKKWVYPSEQMFWNAMLRKGWRWKDDDITSEDMTNIIKIHNQNNEQAWKEILKWEALHAMECPCGPSLMRFGGKAKEYSPRARIRSWMGYELPFDRHDWIVDRCGKEVRYVIDYYDGGAVDKNYQFTILDVRPAFDSLSAVWDRMKVAWWRWTS 273          
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Match: sp|A5PJG7|CCHL_BOVIN (Cytochrome c-type heme lyase OS=Bos taurus OX=9913 GN=HCCS PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 5.318e-88
Identity = 125/206 (60.68%), Postives = 156/206 (75.73%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            +CP++      +  +DP+N + PP Q PA DQPFPLS  R ESSIP+ D  +  KW+YPS QMFWNAM RKGWKWKD++++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+  +QF  LDVRPA+DS  A++DR K   WRWTS
Sbjct:   72 QCPITGAKAANKENLDPSNLMPPPNQTPAPDQPFPLSTVREESSIPRADSDK--KWVYPSEQMFWNAMLRKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNQDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS 275          
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Match: sp|P53702|CCHL_MOUSE (Cytochrome c-type heme lyase OS=Mus musculus OX=10090 GN=Hccs PE=1 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 5.737e-88
Identity = 125/206 (60.68%), Postives = 158/206 (76.70%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP++     ++  +DP+N + PP Q P+ DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM RKGWKWKDD+++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKA+EYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+ ++QF  LDVRPA DSF A++DR K   WRWTS
Sbjct:   69 ECPVTGARAKDKESLDPSNLMPPPNQTPSPDQPFTLSTSREESSIPRADSEK--KWVYPSEQMFWNAMLRKGWKWKDDDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAHECPCGPSLVRFGGKAREYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKEYQFTILDVRPAFDSFSAVWDRMKVAWWRWTS 272          
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Match: sp|P53701|CCHL_HUMAN (Cytochrome c-type heme lyase OS=Homo sapiens OX=9606 GN=HCCS PE=1 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.426e-85
Identity = 124/206 (60.19%), Postives = 155/206 (75.24%), Query Frame = 2
Query:  215 ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            ECP+       +  +DP+N + PP Q PA DQPF LS  R ESSIP+ D ++  KW+YPS QMFWNAM +KGWKWKD++++++D+ NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAKEYSPRAR+R  +GYE PFDRHDWI++RCG EVRYVIDYYD GEV+  +QF  LDVRPA+DS  A++DR K   WRWTS
Sbjct:   65 ECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEK--KWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS 268          
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Match: sp|P53703|CCHL_CAEEL (Probable cytochrome c-type heme lyase OS=Caenorhabditis elegans OX=6239 GN=cchl-1 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.933e-68
Identity = 120/242 (49.59%), Postives = 153/242 (63.22%), Query Frame = 2
Query:  152 NECPIS-QNAKNESNLTAPAPSECPMSKGDDVEQPQIDP-NNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRL-LGYEYPFDRHDWIVDRCG-KEVRYVIDYYD-GEVDAKFQ-FASLDVRPAMDSFQALFDRTKATVWRWT----SAKPNLPI 847
            ++CP++ +     S     A   CP+      ++  I+P NN +  P Q PA DQPF L   R +S+IPK  G E + W YPS QMFWNAM +KGW+W+DD +++ D+ NII +HN NNE AWREVL WE++   EC  PKLK F G AK  SPRAR R L LGY+ PFDRHDWIVDRCG K+V+YVIDYYD G VD   + F  LDVRPA++    ++DR     WR+        P+LPI
Sbjct:   34 SQCPLTPEQRAAASGENCGAGGACPVG----ADKASINPLNNELEHPNQKPAPDQPFALPTKREKSTIPKA-GTETETWTYPSPQMFWNAMLKKGWRWQDDSLSKSDMENIISIHNANNEEAWREVLKWENLLHPECAEPKLKSFKGDAKNLSPRARFRNLFLGYDLPFDRHDWIVDRCGTKQVQYVIDYYDGGAVDPSSKLFTILDVRPAVNDIGNIWDRMVVAYWRFKFETLGFTPSLPI 270          
BLAST of Cytochrome c heme lyase vs. TrEMBL
Match: A0A3S1BIX1 (Cytochrome c heme lyase OS=Elysia chlorotica OX=188477 GN=EGW08_007540 PE=3 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.092e-92
Identity = 139/232 (59.91%), Postives = 178/232 (76.72%), Query Frame = 2
Query:  149 PNECPISQNAKNE-SNLTAPAPSECPMSKGDDVEQPQID---PNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
            P+ECP+SQ  +++ S+  A  PS CPMS+G+D  +  I+    NN + PP Q PA DQPF L  +R+ SSIPK D  E  KW+YPS QMFWNAM RKGW+WK+ ++++ D+++II +HN NNELAWREVL WE++H DEC+TP+LKRF G A +YSPRAR+R  LGYE PFDRHDW+VDR GKEVRYVIDYYD G+V+  ++FA LDVRPA+DSF+A+ DR K  +WRWT A
Sbjct:  161 PSECPMSQGVQSQKSSNPASYPSACPMSQGEDKAKAIIEDLNTNNMMPPPNQRPAPDQPFELPTERVVSSIPKADSDE--KWVYPSPQMFWNAMLRKGWRWKESDISQRDMDHIINIHNSNNELAWREVLKWEALHADECETPRLKRFAGFASKYSPRARIRSWLGYELPFDRHDWVVDRNGKEVRYVIDYYDGGKVNKDYEFALLDVRPALDSFEAVKDRVKVAIWRWTVA 390          
BLAST of Cytochrome c heme lyase vs. TrEMBL
Match: A0A4Z2DS69 (Cytochrome c heme lyase OS=Schistosoma japonicum OX=6182 GN=EWB00_009047 PE=3 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.500e-91
Identity = 131/213 (61.50%), Postives = 166/213 (77.93%), Query Frame = 2
Query:  212 SECPMSKGDDVEQPQ----IDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKP 835
            +ECP+ KG++         ++ +N + PP Q+P+  QPFPLS +R  SSIPK D  EG+KW+YPS+QMFWNAM RKGW+W+D+++  ED+NNII++HN+NNELAWREVL WE++H DEC TPKL+RF G AK YSPRAR+R L+GYE PFDRHDW++DRCGKEVRYVIDYYD G VD  +QFA LDVRPA+DSF A +DR +    R+TS  P
Sbjct:   19 TECPVGKGNECPMNDGYVDLNSDNLMPPPNQLPSPGQPFPLSTEREVSSIPKADCSEGEKWVYPSSQMFWNAMLRKGWRWRDNDIKPEDMNNIIHIHNLNNELAWREVLKWEALHADECMTPKLRRFAGDAKNYSPRARIRHLMGYELPFDRHDWVIDRCGKEVRYVIDYYDGGSVDEAYQFAILDVRPALDSFGAFWDRAQVAWMRFTSPDP 231          
BLAST of Cytochrome c heme lyase vs. TrEMBL
Match: C1LDX2 (Cytochrome c heme lyase OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 282.337 bits (721), Expect = 1.618e-91
Identity = 131/213 (61.50%), Postives = 166/213 (77.93%), Query Frame = 2
Query:  212 SECPMSKGDDVEQ----PQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKP 835
            +ECP+ KG++         ++ +N + PP Q+P+  QPFPLS +R  SSIPK D  EG+KW+YPS+QMFWNAM RKGW+W+D+++  ED+NNII++HN+NNELAWREVL WE++H DEC TPKL+RF G AK YSPRAR+R L+GYE PFDRHDW++DRCGKEVRYVIDYYD G VD  +QFA LDVRPA+DSF A +DR +    R+TS  P
Sbjct:   19 TECPVGKGNECPMNDGYVDLNSDNLMPPPNQLPSPGQPFPLSTEREVSSIPKADCSEGEKWVYPSSQMFWNAMLRKGWRWRDNDIKPEDMNNIIHIHNLNNELAWREVLKWEALHADECMTPKLRRFAGDAKNYSPRARIRHLMGYELPFDRHDWVIDRCGKEVRYVIDYYDGGSVDEAYQFAILDVRPALDSFGAFWDRAQVAWMRFTSPDP 231          
BLAST of Cytochrome c heme lyase vs. TrEMBL
Match: K1PBV7 (Cytochrome c heme lyase OS=Crassostrea gigas OX=29159 GN=CGI_10004088 PE=3 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 2.838e-90
Identity = 133/226 (58.85%), Postives = 168/226 (74.34%), Query Frame = 2
Query:  149 PNECPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDAK-FQFASLDVRPAMDSFQALFDRTKATVWRW 820
            P+ECP+ Q        T   PS CPM +G   E+ +IDP N + PP Q P+ DQPFPLS DR+ S+IPK D  E   W+YPS QMFWNAM RKGW+WK+ ++ ++D++NII +HN NNE AW+EVL WE++H  EC  P+LKRFGGKAKE+SPRA++R  LGY  PFDRHDW+VDRCGKEVRY+IDYYD GEVD + ++F +LDVRPA DSF A+ DR+K  + RW
Sbjct:   60 PSECPMHQKT------TPSPPSGCPMHEGGANEE-EIDPRNMMPPPNQRPSPDQPFPLSTDRVVSNIPKADSDEN--WVYPSPQMFWNAMLRKGWRWKEGDINKQDMDNIISIHNANNEQAWKEVLKWEALHARECSEPRLKRFGGKAKEFSPRAKIRNWLGYSLPFDRHDWVVDRCGKEVRYIIDYYDIGEVDKRTYEFTALDVRPAFDSFSAVMDRSKVAMMRW 276          
BLAST of Cytochrome c heme lyase vs. TrEMBL
Match: A0A5J4NCL6 (Cytochrome c heme lyase OS=Paragonimus westermani OX=34504 GN=DEA37_0005599 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 9.859e-90
Identity = 137/231 (59.31%), Postives = 168/231 (72.73%), Query Frame = 2
Query:  176 AKNESNLTAPAP------SECPMSKGDDV----EQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEV-DAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKP 835
              + SNL  P+        ECPM K           ++DPNN + PP Q P+  QPFPLS++R  SSIPK D   GD+W+YPSAQMFWNAM RKGW+W+D+++ ++D+ NII +HNVNNELAWREVL WE++H  EC+ PKL+RF G AK YSPRAR+R LLGYE PFDRHDWIVDRCG++VRYVIDYYDG V D   QFA LDVRPA+DSF+AL+DRTK    R+   +P
Sbjct:    2 GTSSSNLPNPSAENYDEYGECPMKKPPGGCSFKANTELDPNNMMPPPNQKPSPGQPFPLSIEREVSSIPKADDPNGDRWVYPSAQMFWNAMVRKGWRWRDEDIGQQDMENIIRIHNVNNELAWREVLKWEALHAHECRAPKLRRFAGDAKNYSPRARIRSLLGYELPFDRHDWIVDRCGRDVRYVIDYYDGGVLDENGQFALLDVRPALDSFEALWDRTKVAWMRFRFPEP 232          
BLAST of Cytochrome c heme lyase vs. Ensembl Cavefish
Match: hccsa.1 (holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-GENE-040718-202])

HSP 1 Score: 250.366 bits (638), Expect = 7.053e-82
Identity = 124/246 (50.41%), Postives = 165/246 (67.07%), Query Frame = 2
Query:  131 TDENVHPNECPISQNAKNESNLTAP-APS---------ECPMSKGDDVEQP--QIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
            T ++  P ECP+   +  E     P AP+         ECP+       QP   I+P N + PP Q P+  QPF LS+ R ES+IP+  G     W+YPS QMFWNAM RKGW+W++ +++++D++NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAK+++PRARLR  +G+E PFDRHDWI+DRCGKEVRYVIDYYDG  ++K     LDVRPA D+ +A++DR K   WRWTS+
Sbjct:   37 TKQSSPPPECPMHSTSVKEPPKNIPDAPAHQDGAYEFVECPVKAARGSSQPVSDINPANMMPPPNQQPSPGQPFDLSVKREESNIPR--GGSEQNWVYPSEQMFWNAMLRKGWRWREQDISQKDMSNIITIHNQNNEQAWKEILRWEALHLKECPCGPSLLRFGGKAKDFTPRARLRHWMGHELPFDRHDWIIDRCGKEVRYVIDYYDGGQESKHTI--LDVRPAFDTLEAVWDRMKVAWWRWTSS 278          
BLAST of Cytochrome c heme lyase vs. Ensembl Cavefish
Match: hccsb (holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-GENE-000607-78])

HSP 1 Score: 237.654 bits (605), Expect = 3.890e-77
Identity = 128/244 (52.46%), Postives = 158/244 (64.75%), Query Frame = 2
Query:  131 TDENVHPNECPISQNAKNESNLTAPAPS----------ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDA-KFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            T ++ +P+ECP+    K ES   APA            ECPM    +     IDP N + PP Q PA DQPF L ++R ES IP+    +   W+YPS QMFWNAM RKG K          + NII +HN NN+ AW E+L WE++H  EC   P LKRFGGKAKE+SPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYY+G+++   +QF+ LDVRPA+DS  A++DR K   WRWTS
Sbjct:   38 TKKSSYPSECPMH---KAESPAPAPAGPVHQDRAYEFVECPMKAAREGTS-DIDPTNMMPPPNQQPAPDQPFTLPINREESKIPRAGTDK--NWVYPSEQMFWNAMLRKGRK------KPLSVMNIIKIHNRNNDQAWEEILKWEALHAGECPCGPSLKRFGGKAKEFSPRARMRHWMGYELPFDRHDWIVDRCGKEVRYVIDYYEGDINKDSYQFSILDVRPALDSIGAVWDRAKVAWWRWTS 269          
BLAST of Cytochrome c heme lyase vs. Ensembl Cavefish
Match: hccsb (holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-GENE-000607-78])

HSP 1 Score: 229.95 bits (585), Expect = 4.779e-74
Identity = 125/238 (52.52%), Postives = 150/238 (63.03%), Query Frame = 2
Query:  149 PNECPISQNAKNESNLTAPAPS----------ECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDA-KFQFASLDVRPAMDSFQALFDRTKATVWRWTS 826
            P+ CP+    K ES   APA            ECPM    +     IDP N + PP Q PA DQPF L ++R ES IP+        W+YPS QMFWNAM RKG              NII +HN NN+ AW E+L WE++H  EC   P LKRFGGKAKE+SPRAR+R  +GYE PFDRHDWIVDRCGKEVRYVIDYY+G+++   +QF+ LDVRPA+DS  A++DR K   WRWTS
Sbjct:   53 PHLCPMH---KAESPAPAPAGPVHQDRAYEFVECPMKAAREGTS-DIDPTNMMPPPNQQPAPDQPFTLPINREESKIPR--AGTDKNWVYPSEQMFWNAMLRKG-------------MNIIKIHNRNNDQAWEEILKWEALHAGECPCGPSLKRFGGKAKEFSPRARMRHWMGYELPFDRHDWIVDRCGKEVRYVIDYYEGDINKDSYQFSILDVRPALDSIGAVWDRAKVAWWRWTS 271          
BLAST of Cytochrome c heme lyase vs. Ensembl Cavefish
Match: hccsa.1 (holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-GENE-040718-202])

HSP 1 Score: 221.09 bits (562), Expect = 5.521e-71
Identity = 101/173 (58.38%), Postives = 133/173 (76.88%), Query Frame = 2
Query:  314 FPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
            F LS+ R ES+IP+  G     W+YPS QMFWNAM RKGW+W++ +++++D++NII +HN NNE AW+E+L WE++H  EC   P L RFGGKAK+++PRARLR  +G+E PFDRHDWI+DRCGKEVRYVIDYYDG  ++K     LDVRPA D+ +A++DR K   WRWTS+
Sbjct:   76 FDLSVKREESNIPR--GGSEQNWVYPSEQMFWNAMLRKGWRWREQDISQKDMSNIITIHNQNNEQAWKEILRWEALHLKECPCGPSLLRFGGKAKDFTPRARLRHWMGHELPFDRHDWIIDRCGKEVRYVIDYYDGGQESKHTI--LDVRPAFDTLEAVWDRMKVAWWRWTSS 244          
BLAST of Cytochrome c heme lyase vs. Ensembl Yeast
Match: CYC3 (Cytochrome c heme lyase (holocytochrome c synthase); attaches heme to apo-cytochrome c (Cyc1p or Cyc7p) in mitochondrial intermembrane space; human homolog HCCS implicated in microphthalmia with linear skin defects (MLS), and can complement yeast null mutant [Source:SGD;Acc:S000000037])

HSP 1 Score: 129.028 bits (323), Expect = 6.460e-36
Identity = 96/244 (39.34%), Postives = 123/244 (50.41%), Query Frame = 2
Query:  158 CPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKT-PKLKRFGGKAKEYSPRARLRRLLGY--------EYPFDRHDWIVDRCG----------KEVRYVIDYYDGEVDAK-FQFASLDVRPAMDSFQALFDRTKATVWRWTSA 829
            CP+     +ES+ ++P  SECP+ +GD+    +I+P NN+          Q   L +DR  SSIPK      + W YPS Q  +NAM RKG      EV E+ + +++ +HN  NE  W+EVL WE  H DE    PKL +F GK    SPRAR   L G         E PFDRHDWIV R            KEVRYV+D+Y G  D        +DVRPA+DS     DR    + R  S 
Sbjct:   26 CPV----MHESSSSSPPSSECPVMQGDN---DRINPLNNMPELAASKQPGQKMDLPVDRTISSIPK-SPDSNEFWEYPSPQQMYNAMVRKGKIGGSGEVAEDAVESMVQVHNFLNEGCWQEVLEWEKPHTDESHVQPKLLKFMGKPGVLSPRARWMHLCGLLFPSHFSQELPFDRHDWIVLRGERKAEQQPPTFKEVRYVLDFYGGPDDENGMPTFHVDVRPALDSLDNAKDRMTRFLDRMISG 261          
BLAST of Cytochrome c heme lyase vs. Ensembl Yeast
Match: CYT2 (Cytochrome c1 heme lyase; involved in maturation of cytochrome c1, which is a subunit of the mitochondrial ubiquinol-cytochrome-c reductase; links heme covalently to apocytochrome c1; human homolog HCCS can complement yeast cyt2 null mutant [Source:SGD;Acc:S000001570])

HSP 1 Score: 114.775 bits (286), Expect = 6.029e-31
Identity = 81/225 (36.00%), Postives = 113/225 (50.22%), Query Frame = 2
Query:  155 ECPISQNAK--------NESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDE-CKTPKLKRFGGKAKEYSPRARLR-RLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEV-DAKFQ---FASLDVRPAMDSFQAL 787
            +CP+ +  K        NE++  A AP       G+ +E    +P +N   P     VD    LS  R  S+IP+ +      WIYPS + F+ AM +K W     +   +D+  ++ LHN  NE  W  +  WE     E C   KL  F G +K+ +PRA  R R+L    PFDRHDW +DRCGK V YVID+Y  ++ DA  Q      LDVRP ++SF+  
Sbjct:    9 KCPVDEETKKLWLREHGNEAHPGATAP-------GNQLE-CSANPQDNDKTPEYHTTVD----LSQSREVSTIPRTNSDRN--WIYPSEKQFYEAMMKKNW-----DPNSDDMKVVVPLHNSINERVWNYIKSWEDKQGGEACGGIKLTNFKGDSKKLTPRAWFRSRILHLAKPFDRHDWQIDRCGKTVDYVIDFYSTDLNDANSQQQPLIYLDVRPKLNSFEGF 214          
BLAST of Cytochrome c heme lyase vs. Ensembl Nematostella
Match: EDO45116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTZ6])

HSP 1 Score: 235.343 bits (599), Expect = 5.362e-77
Identity = 118/228 (51.75%), Postives = 152/228 (66.67%), Query Frame = 2
Query:  152 NECPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYD-GEVDA--KFQFASLDVRPA-MDSFQALFDRTKATVWRWT 823
            +ECP S          A +   CPM       +  +DP N + P  Q P+  QPFPLS DR+ SSIPK  G   DKW+YPS QMFWNAM RKGWKW+ D++  +D+ +II +HN NNE AW+E+L WE++H  EC+ PKL  F G+A++++ RAR+R LLGYE PFDRHDWIVDRCG+ VRY+IDYYD G+ DA    +F  LDVRPA  DSF +  DR +  + RW+
Sbjct:   13 SECPAS---------GAMSAGRCPM------REDGLDPTNMMPPANQQPSPGQPFPLSTDRVVSSIPK--GGSNDKWVYPSPQMFWNAMVRKGWKWEKDDLNPKDMGHIIKIHNANNERAWQEILKWEALHAKECRNPKLISFKGRAQDFTIRARIRSLLGYELPFDRHDWIVDRCGRHVRYIIDYYDVGDEDAYKTGEFVELDVRPAPFDSFGSALDRMRVAMLRWS 223          
BLAST of Cytochrome c heme lyase vs. Planmine SMEST
Match: SMESG000012893.1 (SMESG000012893.1)

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 255/256 (99.61%), Postives = 255/256 (99.61%), Query Frame = 2
Query:   89 MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKPNLPIDEM 856
            MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGE DAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKPNLPIDEM
Sbjct:    1 MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAPSECPMSKGDDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEFDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKPNLPIDEM 256          
BLAST of Cytochrome c heme lyase vs. Planmine SMEST
Match: SMESG000013016.1 (SMESG000013016.1)

HSP 1 Score: 268.855 bits (686), Expect = 9.493e-90
Identity = 134/228 (58.77%), Postives = 170/228 (74.56%), Query Frame = 2
Query:  152 NECPISQNAKNESNLTAPAPSECPMSKG----DDVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIYPSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWESMHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKEVRYVIDYYDGEVDAKF---QFASLDVRPAMDSFQALFDRTKATVW 814
            +EC +  N  ++ N      S+CP+S+     +D     + P+N +  P Q P+  QPFPLS++RI SSIPK+DGKEG+ W+YPS QMFWNAM RKGW+W D +++E D+NNII +HN NNELAWREVL+WES+HF+ECKTPKLK+FGGKA E+SPRAR R LLGY+YPFDRHDWIVDRCG+E+RY+IDYYD   + K        +DVRPA+DS QA+FDR K T W
Sbjct:    8 DECNLKSNNTSD-NTGKMNSSQCPISQNTSLINDENTLDLSPDNLMTAPNQTPSKGQPFPLSVERIVSSIPKYDGKEGETWVYPSPQMFWNAMIRKGWRWNDQDISESDMNNIINIHNANNELAWREVLIWESLHFNECKTPKLKKFGGKATEFSPRARFRHLLGYKYPFDRHDWIVDRCGREIRYIIDYYDEGNEGKRPVPGLTMIDVRPAIDSLQAVFDRVKVTFW 234          
The following BLAST results are available for this feature:
BLAST of Cytochrome c heme lyase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
HCCS2.970e-8660.19holocytochrome c synthase [Source:HGNC Symbol;Acc:... [more]
HCCS2.970e-8660.19holocytochrome c synthase [Source:HGNC Symbol;Acc:... [more]
HCCS2.970e-8660.19holocytochrome c synthase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cchl-14.664e-6949.59Probable cytochrome c-type heme lyase [Source:Uni... [more]
cchl-14.664e-6949.59Probable cytochrome c-type heme lyase [Source:Uni... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cchl6.604e-8349.06gene:FBgn0038925 transcript:FBtr0335198[more]
Cchl6.604e-8349.06gene:FBgn0038925 transcript:FBtr0084185[more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hccsb8.199e-8963.11holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-G... [more]
hccsb8.199e-8963.11holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-G... [more]
hccsa.14.531e-8351.84holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-G... [more]
hccsa.14.531e-8351.84holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-G... [more]
hccsa.14.531e-8351.84holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hccs5.627e-9153.99holocytochrome c synthase [Source:NCBI gene;Acc:44... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hccs8.202e-8960.68holocytochrome c synthetase [Source:MGI Symbol;Acc... [more]
Hccs8.202e-8960.68holocytochrome c synthetase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Cytochrome c heme lyase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F339|CCHL_CHICK6.408e-9056.05Cytochrome c-type heme lyase OS=Gallus gallus OX=9... [more]
sp|A5PJG7|CCHL_BOVIN5.318e-8860.68Cytochrome c-type heme lyase OS=Bos taurus OX=9913... [more]
sp|P53702|CCHL_MOUSE5.737e-8860.68Cytochrome c-type heme lyase OS=Mus musculus OX=10... [more]
sp|P53701|CCHL_HUMAN1.426e-8560.19Cytochrome c-type heme lyase OS=Homo sapiens OX=96... [more]
sp|P53703|CCHL_CAEEL5.933e-6849.59Probable cytochrome c-type heme lyase OS=Caenorhab... [more]
back to top
BLAST of Cytochrome c heme lyase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S1BIX11.092e-9259.91Cytochrome c heme lyase OS=Elysia chlorotica OX=18... [more]
A0A4Z2DS691.500e-9161.50Cytochrome c heme lyase OS=Schistosoma japonicum O... [more]
C1LDX21.618e-9161.50Cytochrome c heme lyase OS=Schistosoma japonicum O... [more]
K1PBV72.838e-9058.85Cytochrome c heme lyase OS=Crassostrea gigas OX=29... [more]
A0A5J4NCL69.859e-9059.31Cytochrome c heme lyase OS=Paragonimus westermani ... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hccsa.17.053e-8250.41holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-G... [more]
hccsb3.890e-7752.46holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-G... [more]
hccsb4.779e-7452.52holocytochrome c synthase b [Source:ZFIN;Acc:ZDB-G... [more]
hccsa.15.521e-7158.38holocytochrome c synthase a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CYC36.460e-3639.34Cytochrome c heme lyase (holocytochrome c synthase... [more]
CYT26.029e-3136.00Cytochrome c1 heme lyase; involved in maturation o... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO451165.362e-7751.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytochrome c heme lyase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytochrome c heme lyase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000012893.10.000e+099.61SMESG000012893.1[more]
SMESG000013016.19.493e-9058.77SMESG000013016.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010757 ID=SMED30010757|Name=Cytochrome c heme lyase|organism=Schmidtea mediterranea sexual|type=transcript|length=972bp
GTTGCAACTATTACATTCAATTCTTAGTTTTGAATTTAAAAAAATTCGAT
ATCTTATCGGCATTTCATTTATTATAAATTGTGAGTAAATGGGATCTTAT
TCTTCATCACTAAGAAATCGTTCTGGCTTAACAGATGAAAATGTGCATCC
CAATGAGTGTCCAATTTCTCAGAATGCAAAAAATGAATCAAATCTCACTG
CTCCTGCTCCAAGTGAATGCCCTATGTCAAAAGGAGATGATGTTGAACAG
CCGCAAATAGATCCAAACAATAATATAGTTCCTCCCGGTCAAATACCTGC
AGTTGATCAACCTTTTCCATTATCTATGGATAGAATTGAATCATCAATTC
CTAAATTTGATGGAAAAGAAGGAGATAAATGGATATATCCGTCAGCTCAG
ATGTTTTGGAATGCAATGACCCGTAAAGGATGGAAGTGGAAAGATGATGA
AGTTACTGAAGAAGATATAAATAACATTATTTATTTGCATAATGTGAACA
ATGAACTAGCTTGGCGAGAAGTTCTTCTATGGGAATCCATGCATTTTGAT
GAATGCAAAACTCCAAAATTAAAAAGATTTGGAGGCAAGGCAAAAGAATA
CTCGCCAAGAGCTCGTTTAAGACGCTTACTCGGATACGAATATCCGTTTG
ATAGACACGATTGGATTGTTGACCGATGTGGAAAGGAAGTGCGTTATGTC
ATTGACTATTATGATGGTGAGGTTGATGCGAAATTTCAATTTGCCTCCCT
TGATGTTCGACCAGCTATGGATTCGTTTCAAGCTTTATTTGACAGAACAA
AAGCCACAGTATGGCGCTGGACTAGTGCAAAGCCAAATTTGCCAATTGAT
GAAATGCAACAAAATAATAAATCATCTAGCTCAAAATAATTTAGACGACC
AATAAATAAAATAAAATGTTATTTTATGTATGAATTTATTTTTAATTTTG
TTTATTTCTTATTTAATGTTAG
back to top

protein sequence of SMED30010757-orf-1

>SMED30010757-orf-1 ID=SMED30010757-orf-1|Name=SMED30010757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
MGSYSSSLRNRSGLTDENVHPNECPISQNAKNESNLTAPAPSECPMSKGD
DVEQPQIDPNNNIVPPGQIPAVDQPFPLSMDRIESSIPKFDGKEGDKWIY
PSAQMFWNAMTRKGWKWKDDEVTEEDINNIIYLHNVNNELAWREVLLWES
MHFDECKTPKLKRFGGKAKEYSPRARLRRLLGYEYPFDRHDWIVDRCGKE
VRYVIDYYDGEVDAKFQFASLDVRPAMDSFQALFDRTKATVWRWTSAKPN
LPIDEMQQNNKSSSSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000511Cyt_C/C1_haem_lyase
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004408holocytochrome-c synthase activity
GO:0016829lyase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000511Cytochrome c/c1 haem-lyasePFAMPF01265Cyto_heme_lyasecoord: 14..238
e-value: 2.5E-57
score: 194.7
IPR000511Cytochrome c/c1 haem-lyasePANTHERPTHR12743CYTOCHROME C1 HEME LYASEcoord: 15..249
IPR000511Cytochrome c/c1 haem-lyasePROSITEPS00821CYTO_HEME_LYASE_1coord: 134..149
IPR000511Cytochrome c/c1 haem-lyasePROSITEPS00822CYTO_HEME_LYASE_2coord: 186..192
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..54
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..41
NoneNo IPR availablePANTHERPTHR12743:SF0CYTOCHROME C-TYPE HEME LYASEcoord: 15..249