Ig-like domain-containing protein

Overview
NameIg-like domain-containing protein
Smed IDSMED30010755
Length (bp)2074
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ig-like domain-containing protein (SMED30010755) t-SNE clustered cells

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30010755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ig-like domain-containing protein (SMED30010755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ig-like domain-containing protein (SMED30010755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30010755SMESG000068292.1 dd_Smed_v4_3852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30010755SMESG000068292.1 dd_Smed_v4_3852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010755SMESG000068292.1 dd_Smed_v4_3852_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010755SMESG000068292.1 dd_Smed_v6_3852_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30010755SMESG000068292.1 dd_Smed_v4_3852_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010755SMESG000068292.1 dd_Smed_v4_3852_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 103.219 bits (256), Expect = 6.746e-22
Identity = 94/344 (27.33%), Postives = 137/344 (39.83%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQ--NSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL-----KRHANHNY-GMLNEESN 1182
               W PCS  C  G +T++  CL    +     A   +C+ D+ P   + C    CP        W +  W  C + CGG G+Q R V C  + + G FL+     C    +     SC   DCPP      W KCS S  C   I+RR   C  +   G+    S  +C  +   P     +  S     C +IK E K +      +I +      Q R  KR+ + +G  AY+L  T + I CP+    +S I+W+      +    + +R+ + + G L I      D G + C AG       L L     G DN L      R     Y GM + E+N
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCL----HPGETPAPPEECR-DEKPHALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLP-----LVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQ----NSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL----IGTDNRLIARPALREPMREYPGMDHSEAN 1024          

HSP 2 Score: 65.855 bits (159), Expect = 2.362e-10
Identity = 58/222 (26.13%), Postives = 92/222 (41.44%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCPPL-KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCNK 1863
            W  S WS CS +C       GY +R+VTC++ +A    +++  + C P  +P+  K C     C +W        +C   C+   V     +  CQ N+     S CD +K P +   C +  C + ++ GPW  C+ +C        +SR + CI   + KP      +Q+    S  + C  P C   C D T  C+       C    +   CC  C +
Sbjct: 1487 WFTSVWSQCSVSC-----GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHP-CVQW----EPGNRCPGRCMGRAVRMQQRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR----GFQSRKVDCIHTRSCKPVAKRHCVQKKKPISW-RHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQE 1690          

HSP 3 Score: 63.1586 bits (152), Expect = 1.890e-9
Identity = 39/106 (36.79%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  370 WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEP-PRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            W+ GNWS C   CG  G++ +   C+M  + GQ +S  L  CD   +P   F  C   DCP ++ TS W +CS S  C      R V C   K +G V++ SP  C
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVM--ANGQEVSEAL--CDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRAC 1527          

HSP 4 Score: 53.5286 bits (127), Expect = 1.458e-6
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 1
Query:  157 TFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSC-------------PQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
            TF+  P   W+ CS  C  G + +   C     +   E     +          RPC L +C             P++S  T+ W+   ++ C   C G G Q     C+ I ++ Q ++  L  CD    PP    +C    CPP++    W  CS +  C   I+ RDV C+
Sbjct:  567 TFIPEP---WSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQ-QTVNDSL--CDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSAT--CGVGIQTRDVYCL 731          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL3 (ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633])

HSP 1 Score: 103.219 bits (256), Expect = 7.469e-22
Identity = 94/344 (27.33%), Postives = 137/344 (39.83%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQ--NSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL-----KRHANHNY-GMLNEESN 1182
               W PCS  C  G +T++  CL    +     A   +C+ D+ P   + C    CP        W +  W  C + CGG G+Q R V C  + + G FL+     C    +     SC   DCPP      W KCS S  C   I+RR   C  +   G+    S  +C  +   P     +  S     C +IK E K +      +I +      Q R  KR+ + +G  AY+L  T + I CP+    +S I+W+      +    + +R+ + + G L I      D G + C AG       L L     G DN L      R     Y GM + E+N
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCL----HPGETPAPPEECR-DEKPHALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLP-----LVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQ----NSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL----IGTDNRLIARPALREPMREYPGMDHSEAN 1024          

HSP 2 Score: 63.1586 bits (152), Expect = 1.825e-9
Identity = 39/106 (36.79%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  370 WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEP-PRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            W+ GNWS C   CG  G++ +   C+M  + GQ +S  L  CD   +P   F  C   DCP ++ TS W +CS S  C      R V C   K +G V++ SP  C
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVM--ANGQEVSEAL--CDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRAC 1527          

HSP 3 Score: 62.003 bits (149), Expect = 4.099e-9
Identity = 45/164 (27.44%), Postives = 73/164 (44.51%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCPPL-KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA 1692
            W  S WS CS +C       GY +R+VTC++ +A    +++  + C P  +P+  K C     C +W        +C   C+   V     +  CQ N+     S CD +K P +   C +  C + ++ GPW  C+ +C        +SR + CI   + KP 
Sbjct: 1487 WFTSVWSQCSVSC-----GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHP-CVQW----EPGNRCPGRCMGRAVRMQQRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR----GFQSRKVDCIHTRSCKPV 1633          

HSP 4 Score: 53.5286 bits (127), Expect = 1.482e-6
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 1
Query:  157 TFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSC-------------PQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
            TF+  P   W+ CS  C  G + +   C     +   E     +          RPC L +C             P++S  T+ W+   ++ C   C G G Q     C+ I ++ Q ++  L  CD    PP    +C    CPP++    W  CS +  C   I+ RDV C+
Sbjct:  567 TFIPEP---WSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQ-QTVNDSL--CDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSAT--CGVGIQTRDVYCL 731          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 82.0333 bits (201), Expect = 2.306e-15
Identity = 83/305 (27.21%), Postives = 121/305 (39.67%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVC---LKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPP----SSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
             +W+PCS  C  G +T++  C   L R    T   A+   C+  K P   + C   +CP        W    W  C + CGG G Q R+V C    + G FL    + C    +P    +C   DCP ++L S W +CS S  C    + R   C  +   G   + +  +C      PP    SS   C   T   C    + + K +    I        Q R  ++L  +VG  AY+L  T + + CP   + +  I W+        H IS   + V   G L I      D+G + C AG
Sbjct:  673 GKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPK-PSTVQACNRFNCPP------AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFCSAS-KPACQQACKKDDCPSEWLLSDWTECSTS--CGEGTQTRSAICRKMLKTGLSTVVNSTLC------PPLPFSSSIRPCMLAT---CARPGRPSTKHSP--HIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQ----HLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAG 950          

HSP 2 Score: 68.5514 bits (166), Expect = 3.872e-11
Identity = 64/229 (27.95%), Postives = 103/229 (44.98%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  +  +P+  + C   + C +W    +   QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC      + C+D T  C  VKQ K  C+ S F   CC  C K
Sbjct: 1549 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAF--SSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCEN----MECRDTTRYCEKVKQLKL-CQLSQFKSRCCGTCGK 1761          

HSP 3 Score: 63.5438 bits (153), Expect = 1.286e-9
Identity = 48/162 (29.63%), Postives = 74/162 (45.68%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQ----FLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDG 654
            +T CS+ C  G +     CL   N +T E A  N C   + P +  + C L  CP        W++G WS C   C G G Q RDV C  + S+       L+ +L +   + +P    +C   +CPP +  ++W  CS +  C   +++R+V C     DG
Sbjct:  616 FTKCSESCGGGVQEAVVSCL---NKQTREPAEENLCVTSRRPPQLLKSCNLDPCPAR------WEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNRFNCPPAWYPAQWQPCSRT--CGGGVQKREVLCKQRMADG 762          

HSP 4 Score: 55.4546 bits (132), Expect = 3.990e-7
Identity = 53/194 (27.32%), Postives = 72/194 (37.11%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCD--------SQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W    WSPCS TC       G QTR V C  +   E     I+ D+ C   KP T++ C  F   P W   +   + CS  C   G       ++C+   R  D S  +        S+      C  D C   +    W++CS SC   T    RS   + + K       N      LP  S  +PC +  C
Sbjct:  670 WEIGKWSPCSLTC-----GVGLQTRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPPAWYPAQW--QPCSRTC---GGGVQKREVLCK--QRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGEGTQT--RSAICRKMLKTGLSTVVNSTLCPPLPFSSSIRPCMLATC 849          

HSP 5 Score: 51.2174 bits (121), Expect = 8.028e-6
Identity = 52/210 (24.76%), Postives = 85/210 (40.48%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP------CFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L+ DF++ +    S S  +    + +      W  T+ + PCS  C  G +  +  C    + R+        C    YP+  +P      C L  CP +     +           W+   W++C  +CGG G Q R V+C+    +G   S +  KC    + P    C   DC PK+L  +W  C+ +  C   +R R V C+  +G
Sbjct:  271 LTADFIVKIR--NSGSADSTVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY---DLRSNRVVADQYCHY--YPENIKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPIAQPCNIFDC-PKWLAQEWSPCTVT--CGQGLRYRVVLCIDHRG 468          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTSL1 (ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632])

HSP 1 Score: 68.5514 bits (166), Expect = 1.756e-11
Identity = 64/229 (27.95%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  +  +P+  + C   + C +W        QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC      + C+D T  C  VKQ K  C+ S F   CC  C K
Sbjct:  250 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAFSSWG--QCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCEN----MECRDTTRYCEKVKQLKL-CQLSQFKSRCCGTCGK 462          
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Match: ADAMTS10 (ADAM metallopeptidase with thrombospondin type 1 motif 10 [Source:HGNC Symbol;Acc:HGNC:13201])

HSP 1 Score: 67.781 bits (164), Expect = 6.384e-11
Identity = 55/187 (29.41%), Postives = 74/187 (39.57%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC------VTIKGDGKVKIQSPGVCYRMNER--PPSSWM 720
            WT CS  C  G + Q   C  R    +   A        K PK+ R C    CP +      W VGNWS C ++C   G + R V C    S  +  +   S C  +  PP   +C    CPP++    W +C+ S  C P +R R V C       T+          P    R N R  PP+ W+
Sbjct:  834 WTKCSAQCAGGSQVQAVEC--RNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPD------WVVGNWSLCSRSCDA-GVRSRSVVCQRRVSAAEEKALDDSAC-PQPRPPVLEACHGPTCPPEWAALDWSECTPS--CGPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWV 1008          

HSP 2 Score: 59.3066 bits (142), Expect = 2.324e-8
Identity = 41/159 (25.79%), Postives = 69/159 (43.40%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP-KFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
               W+ CS+ CD G  +++ VC +R +    +  + + C   + P     C   +CP        W   +WS C  +C G G + R V C    S     +   + C    +PP  + C    CPP +++  +W +C  S+ C    R+R V+C +  G
Sbjct:  890 VGNWSLCSRSCDAGVRSRSVVCQRRVSAAEEKALDDSACPQPR-PPVLEACHGPTCPPE------WAALDWSECTPSC-GPGLRHRVVLC---KSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGEC--SAQCGVGQRQRSVRCTSHTG 1035          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8937718:-1 gene:WBGene00009958.1 transcript:F53B6.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 122.479 bits (306), Expect = 1.076e-28
Identity = 154/679 (22.68%), Postives = 252/679 (37.11%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYA-NSNKCQMDKYPKKTRPCFLGSCP-------QNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPP-RFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV-----TIKGDGKVKIQSPGVCYRMNERP--------PSSWMICH-----------SKTNQHCLEIKKENKKQNSKIEIKTD-----------------------NSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQ---PSTGFDNWLK----------RHANHNYGMLNEES------NFSFIRPESII----------------------WIKSDWSPC-STTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRT-VDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPH--RSLTKPCRVPKCILGCKDL---TSACVKQSKY--------RCRSSLFNHFCCAFC 1857
              EW+ CS  C  G  ++   C+      +       ++CQ  + PK    C + SCP             + W+ G+W+ C  +C G G Q   + CI +++     S + S+CD +  PP +   C    CPP +LTSK+  CS S  C     RR VKC      T   D  + ++     ++  +          P++W+               +  Q   EI+    K   + +++ D                       N    Q    K+L + +G  A +   T + I CP     + KI W+      +        I+V+  G L +    + D+G + C   R     TL+ +    P++  D   K          R       +L E++      N S I  E+++                      W    WS C   TC      AGYQ R ++C+       + +++  C  L   +P   + C   E CP+W  E +   +CS   CV+  +A+   N+ C+F N T VD   CD    P  T  C N  C+  +    W  CS  C       ++ R + C+W  + +PA   C+  + PH  R+      +P C+     L    ++C  QS++         C S      CC+ C
Sbjct:   47 AGEWSTCSSTCGTGVMSRTVECVAVNPISSAPIKLPMSECQDQEQPKLFESCEVRSCPLQEDSKLSEDEAPYQWRYGDWTQCSASCLG-GKQKAALKCIQVSTGK---SVQWSQCDARRRPPEKSRPCNQHPCPPFWLTSKYSDCSMS--CGSGTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRSCDSGERRRQVWCEIRDSRGKTQRRPDVECDANTKPQTVEVCSFGSCSRPELLSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKIKNDA----HIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLI--EALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCH----VAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHR-EDCPRW--EASQWSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECG---TGGVQLRLLSCVWISSGRPAGRNCEQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTC 703          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 121.709 bits (304), Expect = 2.950e-28
Identity = 149/638 (23.35%), Postives = 246/638 (38.56%), Query Frame = 1
Query:  139 LSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTK--FEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQ---PSTGFDNWLK----------RHANHNYGMLNEES------NFSFIRPESII----------------------WIKSDWSPC-STTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRT-VDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPH--RSLTKPCRVPKCILGCKDL---TSACVKQSKY--------RCRSSLFNHFCCAFC 1857
            LS   + + W    +WT CS  C  G++     C++ +  ++ +++  +     + P+K+RPC    CP        W    +S C  +CG  G+  R V C    SK     + +   D +  F+ P+   +C    CP  ++T++W +CS S  C    RRR V C      GK +            RP    + C + T    +E+         ++     N    Q    K+L + +G  A +   T + I CP     + KI W+      +        I+V+  G L +    + D+G + C   R     TL+ +    P++  D   K          R       +L E++      N S I  E+++                      W    WS C   TC      AGYQ R ++C+       + +++  C  L   +P   + C   E CP+W  E +   +CS   CV+  +A+   N+ C+F N T VD   CD    P  T  C N  C+  +    W  CS  C       ++ R + C+W  + +PA   C+  + PH  R+      +P C+     L    ++C  QS++         C S      CC+ C
Sbjct:  443 LSEDEAPYQWR-YGDWTQCSASCLGGKQKAALKCIQVSTGKSVQWSQCDA--RRRPPEKSRPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQ-----------RRPD---VECDANTKPQTVEVCSFGSCSRPEL---LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKIKNDA----HIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLI--EALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCH----VAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHR-EDCPRW--EASQWSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECG---TGGVQLRLLSCVWISSGRPAGRNCEQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTC 1035          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: madd-4 (pep chromosome:WBcel235:I:8931035:8942287:-1 gene:WBGene00009958.1 transcript:F53B6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:madd-4)

HSP 1 Score: 121.324 bits (303), Expect = 3.910e-28
Identity = 149/638 (23.35%), Postives = 246/638 (38.56%), Query Frame = 1
Query:  139 LSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTK--FEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQ---PSTGFDNWLK----------RHANHNYGMLNEES------NFSFIRPESII----------------------WIKSDWSPC-STTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRT-VDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPH--RSLTKPCRVPKCILGCKDL---TSACVKQSKY--------RCRSSLFNHFCCAFC 1857
            LS   + + W    +WT CS  C  G++     C++ +  ++ +++  +     + P+K+RPC    CP        W    +S C  +CG  G+  R V C    SK     + +   D +  F+ P+   +C    CP  ++T++W +CS S  C    RRR V C      GK +            RP    + C + T    +E+         ++     N    Q    K+L + +G  A +   T + I CP     + KI W+      +        I+V+  G L +    + D+G + C   R     TL+ +    P++  D   K          R       +L E++      N S I  E+++                      W    WS C   TC      AGYQ R ++C+       + +++  C  L   +P   + C   E CP+W  E +   +CS   CV+  +A+   N+ C+F N T VD   CD    P  T  C N  C+  +    W  CS  C       ++ R + C+W  + +PA   C+  + PH  R+      +P C+     L    ++C  QS++         C S      CC+ C
Sbjct:  445 LSEDEAPYQWR-YGDWTQCSASCLGGKQKAALKCIQVSTGKSVQWSQCDA--RRRPPEKSRPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQ-----------RRPD---VECDANTKPQTVEVCSFGSCSRPEL---LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKIKNDA----HIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLI--EALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCH----VAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHR-EDCPRW--EASQWSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECG---TGGVQLRLLSCVWISSGRPAGRNCEQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTC 1037          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 65.855 bits (159), Expect = 1.109e-10
Identity = 50/169 (29.59%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            + WTPCS  C KG +T+N  C+   N    E    + C+ +     T+P F  SC +       W  G+W SC   CG  G Q+R V C  + + G+ ++ +   C T   PP   +C    C P++    W  CSE   C  + + R V C + K   + K+ +   C
Sbjct:  348 DNWTPCSVSCGKGVQTRNLYCIDGKNKGRVE---DDLCEENN---ATKPEFEKSC-ETVDCEAEWFTGDWESCSSTCGDQGQQYRVVYCHQVFANGRRVTVEDGNC-TVERPPVKQTCNRFAC-PEWQAGPWSACSEK--CGDAFQYRSVTCRSEKEGEEGKLLAADAC 505          
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Match: mig-6 (Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840])

HSP 1 Score: 65.855 bits (159), Expect = 1.109e-10
Identity = 50/169 (29.59%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            + WTPCS  C KG +T+N  C+   N    E    + C+ +     T+P F  SC +       W  G+W SC   CG  G Q+R V C  + + G+ ++ +   C T   PP   +C    C P++    W  CSE   C  + + R V C + K   + K+ +   C
Sbjct:  348 DNWTPCSVSCGKGVQTRNLYCIDGKNKGRVE---DDLCEENN---ATKPEFEKSC-ETVDCEAEWFTGDWESCSSTCGDQGQQYRVVYCHQVFANGRRVTVEDGNC-TVERPPVKQTCNRFAC-PEWQAGPWSACSEK--CGDAFQYRSVTCRSEKEGEEGKLLAADAC 505          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0339131)

HSP 1 Score: 77.0258 bits (188), Expect = 4.402e-14
Identity = 95/386 (24.61%), Postives = 154/386 (39.90%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG-------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPPSS------------------WMICH------------------------SKTNQHCLEIKKENKK---------QNSKIEIKTDNSEIHQMRHTKRLKIL--VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRER-IRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLE 1104
            NEW+PCS  C +G   + + C     Y RT    N + C+  K   +   C    C   S G                   T+VW+   ++SC  +C G G +   +NC+     G+ +S  L   +TK E  R  +C    CPP++  S +  CS+S  C   I+ R+V+C   VT  GD  + + +      M  +PP +                  W  C                          +    C   K  +KK         ++ K  I+ +NS  H     K+ KI   VG    V   T++ I CP+   +R+KIKW     + ++  + R R  +V++KG L I +    D+G + C AG  +A+ ++ ++
Sbjct:  545 NEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPCMLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLG-GVEELIINCVR-EDNGRVVSPFLCSPETKPEA-RVRTCNDRPCPPRWNYSDYTPCSKS--CGIGIKTREVQCIHEVTRGGDNTMVVPN-----SMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNS-THIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKW-----SKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0085902)

HSP 1 Score: 76.6406 bits (187), Expect = 5.458e-14
Identity = 95/386 (24.61%), Postives = 154/386 (39.90%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG-------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPPSS------------------WMICH------------------------SKTNQHCLEIKKENKK---------QNSKIEIKTDNSEIHQMRHTKRLKIL--VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRER-IRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLE 1104
            NEW+PCS  C +G   + + C     Y RT    N + C+  K   +   C    C   S G                   T+VW+   ++SC  +C G G +   +NC+     G+ +S  L   +TK E  R  +C    CPP++  S +  CS+S  C   I+ R+V+C   VT  GD  + + +      M  +PP +                  W  C                          +    C   K  +KK         ++ K  I+ +NS  H     K+ KI   VG    V   T++ I CP+   +R+KIKW     + ++  + R R  +V++KG L I +    D+G + C AG  +A+ ++ ++
Sbjct:  545 NEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPCMLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLG-GVEELIINCVR-EDNGRVVSPFLCSPETKPEA-RVRTCNDRPCPPRWNYSDYTPCSKS--CGIGIKTREVQCIHEVTRGGDNTMVVPN-----SMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNS-THIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKW-----SKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0307497)

HSP 1 Score: 76.6406 bits (187), Expect = 5.558e-14
Identity = 95/386 (24.61%), Postives = 154/386 (39.90%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG-------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPPSS------------------WMICH------------------------SKTNQHCLEIKKENKK---------QNSKIEIKTDNSEIHQMRHTKRLKIL--VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRER-IRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLE 1104
            NEW+PCS  C +G   + + C     Y RT    N + C+  K   +   C    C   S G                   T+VW+   ++SC  +C G G +   +NC+     G+ +S  L   +TK E  R  +C    CPP++  S +  CS+S  C   I+ R+V+C   VT  GD  + + +      M  +PP +                  W  C                          +    C   K  +KK         ++ K  I+ +NS  H     K+ KI   VG    V   T++ I CP+   +R+KIKW     + ++  + R R  +V++KG L I +    D+G + C AG  +A+ ++ ++
Sbjct:  545 NEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPCMLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLG-GVEELIINCVR-EDNGRVVSPFLCSPETKPEA-RVRTCNDRPCPPRWNYSDYTPCSKS--CGIGIKTREVQCIHEVTRGGDNTMVVPN-----SMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNS-THIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKW-----SKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 72.0182 bits (175), Expect = 1.338e-12
Identity = 62/242 (25.62%), Postives = 107/242 (44.21%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYK---------IIEDK--FCPPLK-PITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILG--------CKDLTSACV-KQSKYRCRSSLFNHFCCAFCNKQ 1866
            W+  +WS CS  C   +  +G Q R V+C++                ++++   F   L+ P   + C + E CP+W   K D   C    C     A     + C++ N T + S+CD  + P +   C N++C+  +   PWS+C+  C       I+ R ++C+W  + +PA N+C+ Q  P  ++ K C+ P C           C+D +  C   ++   CR   +   CC  C +Q
Sbjct: 1157 WMLGEWSQCSQEC--GAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRK---GIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQ 1387          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0110959)

HSP 1 Score: 76.6406 bits (187), Expect = 5.558e-14
Identity = 95/386 (24.61%), Postives = 154/386 (39.90%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG-------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPPSS------------------WMICH------------------------SKTNQHCLEIKKENKK---------QNSKIEIKTDNSEIHQMRHTKRLKIL--VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRER-IRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLE 1104
            NEW+PCS  C +G   + + C     Y RT    N + C+  K   +   C    C   S G                   T+VW+   ++SC  +C G G +   +NC+     G+ +S  L   +TK E  R  +C    CPP++  S +  CS+S  C   I+ R+V+C   VT  GD  + + +      M  +PP +                  W  C                          +    C   K  +KK         ++ K  I+ +NS  H     K+ KI   VG    V   T++ I CP+   +R+KIKW     + ++  + R R  +V++KG L I +    D+G + C AG  +A+ ++ ++
Sbjct:  545 NEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPCMLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLG-GVEELIINCVR-EDNGRVVSPFLCSPETKPEA-RVRTCNDRPCPPRWNYSDYTPCSKS--CGIGIKTREVQCIHEVTRGGDNTMVVPN-----SMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNS-THIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKW-----SKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 72.0182 bits (175), Expect = 1.338e-12
Identity = 62/242 (25.62%), Postives = 107/242 (44.21%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYK---------IIEDK--FCPPLK-PITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILG--------CKDLTSACV-KQSKYRCRSSLFNHFCCAFCNKQ 1866
            W+  +WS CS  C   +  +G Q R V+C++                ++++   F   L+ P   + C + E CP+W   K D   C    C     A     + C++ N T + S+CD  + P +   C N++C+  +   PWS+C+  C       I+ R ++C+W  + +PA N+C+ Q  P  ++ K C+ P C           C+D +  C   ++   CR   +   CC  C +Q
Sbjct: 1157 WMLGEWSQCSQEC--GAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRK---GIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQ 1387          
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Match: nolo (gene:FBgn0051619 transcript:FBtr0301000)

HSP 1 Score: 76.6406 bits (187), Expect = 5.647e-14
Identity = 95/386 (24.61%), Postives = 154/386 (39.90%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG-------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPPSS------------------WMICH------------------------SKTNQHCLEIKKENKK---------QNSKIEIKTDNSEIHQMRHTKRLKIL--VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRER-IRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLE 1104
            NEW+PCS  C +G   + + C     Y RT    N + C+  K   +   C    C   S G                   T+VW+   ++SC  +C G G +   +NC+     G+ +S  L   +TK E  R  +C    CPP++  S +  CS+S  C   I+ R+V+C   VT  GD  + + +      M  +PP +                  W  C                          +    C   K  +KK         ++ K  I+ +NS  H     K+ KI   VG    V   T++ I CP+   +R+KIKW     + ++  + R R  +V++KG L I +    D+G + C AG  +A+ ++ ++
Sbjct:  545 NEWSPCSVTCGEGIRRRTYNCKIFLEYSRTVATVNDSLCEGKKPHDEVERCVEDPCMLPSHGFDDQFPRDSIKVGVSEPGKTYVWREQGYTSCSASCLG-GVEELIINCVR-EDNGRVVSPFLCSPETKPEA-RVRTCNDRPCPPRWNYSDYTPCSKS--CGIGIKTREVQCIHEVTRGGDNTMVVPN-----SMCPQPPPADRQYCNVLDCPVRWEVGEWSKCSHTCGYGFKDRKVECKQIMAQEHKIERPESMCPSAKPADKKPCNVKPCPPEDPKPVIQINNS-THIQHDPKKTKITLKVGGAGLVFFGTQVKIKCPVKRYNRTKIKW-----SKDHKPLQRSRKYKVSKKGALRILDITFRDAGVYSCHAGLSSAEISIEVK 914          

HSP 2 Score: 72.0182 bits (175), Expect = 1.269e-12
Identity = 62/242 (25.62%), Postives = 107/242 (44.21%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYK---------IIEDK--FCPPLK-PITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILG--------CKDLTSACV-KQSKYRCRSSLFNHFCCAFCNKQ 1866
            W+  +WS CS  C   +  +G Q R V+C++                ++++   F   L+ P   + C + E CP+W   K D   C    C     A     + C++ N T + S+CD  + P +   C N++C+  +   PWS+C+  C       I+ R ++C+W  + +PA N+C+ Q  P  ++ K C+ P C           C+D +  C   ++   CR   +   CC  C +Q
Sbjct: 1151 WMLGEWSQCSQEC--GAAGSGLQRRTVSCQRAAKATSSGSTSDTENNVVDNSECFAHGLELPEFFQSCGN-EACPQW--SKGDWTPCQRSHCHGRNTAMQRREVTCRYPNGT-EGSICDEYERPAMRQECYNERCEGVWRVEPWSECNAPCGRK---GIKYRILQCVWYGSRRPAGNVCKHQ--PRPAVMKVCKSPACQAQLSSSPAQLCRDSSRYCRNARAMGLCRLHRYKLKCCGSCEQQ 1381          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 83.9593 bits (206), Expect = 4.780e-16
Identity = 90/344 (26.16%), Postives = 145/344 (42.15%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCP-PKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHAN---------HNYGMLNEESNF 1185
            W  CS  C  G +T++  C++       E  +S  C ++K P + + C   +CP +      W+   W  C  +CG  GSQ+R V C    + G +   +   C    +P     C +ADC  P+    +W KCS +  C   ++RR+  C      G++       C  +   PP       S  N+H     K +KK+  ++ I      I Q R  KRL   +G  AY+L  T + I CP+    +++I+W+   +       S +R+ + + G L I      D G + C A + +    L L     G++N L  H +         H Y  LN+E  F
Sbjct:  713 WNLCSVSCGVGLQTRSVSCVRSVAGNRTESLSSKDC-VEKRPNELQACNQVACPPS------WEAEEWQQCSHSCG-RGSQWRKVYCKQRLATGSYRRLRDEDCSGP-KPDVHRICTNADCLLPRLEGGEWSKCSVT--CGKGVQRREPVCRRQTASGQLVTLDRTSCSDL-PLPPLIRSCRMSPCNKH-----KHSKKRCPQV-IGLKRIYI-QNRPEKRLSFTIGGRAYLLPKTTVIIKCPVRHFPKAQIRWEKDGDEL----TSSKRLSITKSGALRIYNLEAEDIGVYRCWANQDSDTFILKL----IGYNNRLLDHPSLGKERRGNFHPY--LNKEGGF 1027          

HSP 2 Score: 73.559 bits (179), Expect = 7.200e-13
Identity = 94/416 (22.60%), Postives = 168/416 (40.38%), Query Frame = 1
Query:  757 IKKENKKQNSKIEIKTDNSEIHQMRHTKRLKIL----VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYG-----------------------MLNEESNF----------SFIRPESII-----WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCP-PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQ-FNNRTVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNL-CQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFC 1857
            I K        +E      ++   +   R ++L    VG +AYV     L I CP+   HR  I+W+  N T         R+ V  + VL I       +G +   +GRY  +   + +Q  T + + L +      G                           ES+           S  RP +++     W+ + WS CS++C       G++ R+V+C+++EA    K++    C    +P   ++C S + C +WI       +C+  C+   +A  +  + C+ F+N T  S  CD ++ P+    C ++ C + +   PW  C+++C     +  +SR ++C+ +   K   +  C  Q+ P     + C +  C   CKD T  C    + + C   L+   CC  C
Sbjct: 1362 IGKSAASSRISVEGAVGEPDLQSSKQMNRKRVLMASQVGTSAYVRPGDTLRIGCPVVPGHRRPIRWRFENRTLAAAAGGLYRLLVGGR-VLEIN----THTGSF---SGRYQCQTQTNNQQQLTAWIHLLSQEFEWRLGDWSTCSSSCGNRGTQMKKIKCVSSEGRESSHAACHYLPKPSSQTRPCNLLHCPPSWVSTVWSRCSSSC-----GRGFRERRVSCQQVEASGSVKVLPSSECEGSPRPEDRQECSS-QACVEWI--SGPWGKCAGRCLGPAMATQTRTVSCRLFSNST--SKTCDPKERPSAVRNCSSEMCDVHWKVFPWRTCTVAC----GSGFQSRRVECVHRQNKKTLPDQHCAWQRRP--VTWQHCNITSCGSECKDRTHYCPAVKRLKLCSVDLYRQRCCQTC 1753          

HSP 3 Score: 58.5362 bits (140), Expect = 2.573e-8
Identity = 52/205 (25.37%), Postives = 88/205 (42.93%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLK-RTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L+ DF + + +       T+   + +    + W  T+ + PCS  C  G +  +  C+  R N    E+   +  +  K   K + C +  CP++     V           W+   W+SC  +CGG GSQ R + C+     GQ +  +  KC     P    +C   DC P+++  +W +C+ +  C P +R R V CV   G
Sbjct:  313 LTADFTVKVKYAGPKD--TVIQFMFYQPIRYQWRETD-FFPCSVTCGGGYQLNSADCVDIRYNRSVAEHLCHSFPENTKPTPKLKECNMEPCPESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQERSIVCVEEDVHGQIVQVEDWKCTHSPRPISKQNCNTFDC-PQWMAMEWSQCTVT--CGPGLRYRVVLCVDYNG 510          

HSP 4 Score: 58.5362 bits (140), Expect = 3.183e-8
Identity = 33/105 (31.43%), Postives = 55/105 (52.38%), Query Frame = 1
Query:  364 FVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSK----LSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKI 666
            F W++G+WS+C  +CG  G+Q + + C  ++S+G+  S      L K  ++  P     C    CPP ++++ W +C  SS C    R R V C  ++  G VK+
Sbjct: 1487 FEWRLGDWSTCSSSCGNRGTQMKKIKC--VSSEGRESSHAACHYLPKPSSQTRP-----CNLLHCPPSWVSTVWSRC--SSSCGRGFRERRVSCQQVEASGSVKV 1582          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif, 18 [Source:ZFIN;Acc:ZDB-GENE-070815-1])

HSP 1 Score: 72.7886 bits (177), Expect = 9.534e-13
Identity = 48/157 (30.57%), Postives = 74/157 (47.13%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP----KFLTSKWHKCSESSDCRPSIRRRDVKC 633
            T +W  CS+ C  G++T+N  CL++  Y+  E A  + C +   P + +PC   SCP        W   +W+ C K C G G + R V C       + +    S C    +P    SC  + CP     +++TS W +CS S  C   +RRR++ C
Sbjct:  937 TGKWGVCSRTCGGGQQTRNIRCLRKVTYQREEVAAQSLCPV-MAPAQLQPCNTQSCPPE------WSTSSWTQCSKTC-GRGLKKRSVFCRSTDPGARAVVVPDSMCKLHLKPKAQESCVLSRCPKNERLQWITSAWGECSAS--CGAGVRRRELHC 1083          

HSP 2 Score: 52.373 bits (124), Expect = 2.049e-6
Identity = 41/165 (24.85%), Postives = 67/165 (40.61%), Query Frame = 1
Query:  193 CSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPK-KTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            CS  C  G  +   +CL+    +     NS+ C     P   +  C    CP        W  G W  C + CGG G Q R++ C+   +  +   +  S C     P +   C    CPP++ TS W +CS++  C   +++R V C +     +  +    +C
Sbjct:  885 CSAPCAGGRVSTKAICLQDQQTQV----NSSLCNPQTRPVVGSHLCNTQPCPA------YWTTGKWGVCSRTCGG-GQQTRNIRCLRKVTYQREEVAAQSLCPV-MAPAQLQPCNTQSCPPEWSTSSWTQCSKT--CGRGLKKRSVFCRSTDPGARAVVVPDSMC 1035          

HSP 3 Score: 50.8322 bits (120), Expect = 5.646e-6
Identity = 52/206 (25.24%), Postives = 80/206 (38.83%), Query Frame = 1
Query: 1195 RPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTC-EKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-----TVDSSLCDSQKLPNI--TCLNDKC----QISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWK-----HTNKPAYNLCQLQQLPHRSLTKPCRVPKC 1761
            +P    W    W  CS TC G     G QTR + C  K+  Q  ++     CP + P  ++ C +    P+W    +   QCS  C   G      ++ C+  +       V  S+C     P    +C+  +C    ++ +    W +CS SC     A +R R + C  K     +T  PA   C+  Q P   L + C    C
Sbjct:  929 QPCPAYWTTGKWGVCSRTCGG-----GQQTRNIRCLRKVTYQREEVAAQSLCPVMAPAQLQPCNTQSCPPEW--STSSWTQCSKTC---GRGLKKRSVFCRSTDPGARAVVVPDSMCKLHLKPKAQESCVLSRCPKNERLQWITSAWGECSASC----GAGVRRRELHCGEKDSQGGYTEFPARR-CRNLQKPEADLEQSCNNGPC 1119          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 71.633 bits (174), Expect = 2.182e-12
Identity = 54/188 (28.72%), Postives = 87/188 (46.28%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            LS+ +++  + L    VIT + +L     T+ W     W+ CSK C  G +   + C ++++ R     + N C+++K PK  R      C  NS    +W +  W +C K+CG  G Q R V C+         +     C T+ +P    +C  + CP ++ T  W +CS S  C   IR+R V C
Sbjct:  455 LSYKYIIHEDLL---PVITNNNVLLAELDTYEW-ALKSWSQCSKTCGGGVQYTKYGCRRKSDAR---LVHRNFCEVNKKPKPIRK----RCNTNSCSQPLWVLEEWGACSKSCGTQGFQTRVVQCMQPLHNNTNRAVHAKYC-TEEKPLTRRACNASACPSQWRTGAWSQCSVS--CGEGIRQRQVIC 628          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: LO018340.1 (ADAMTS-like 4 [Source:NCBI gene;Acc:100333903])

HSP 1 Score: 66.2402 bits (160), Expect = 1.082e-10
Identity = 50/154 (32.47%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  181 EWT-PCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVT 639
            +WT  CS  C  G + +  VC+     R  E     +C  DK P   + C  G C    T T++W  G W  C   CG +G+Q RDV C+   S  +F  S  S C    +P     C    C P++ T+ W  CS S  C   ++ R+V+C+T
Sbjct:  874 DWTHTCSAECGPGVQRREVVCVSAGGRR--EGDGGLECVGDK-PADMKACNGGPC----TATYLWYTGPWGYCNAVCG-NGTQRRDVICVR-KSGSEFTVSSSSDCSHLEKPSPVQPCELQPCTPQWFTTDWSTCSRS--CGEGLQTREVRCLT 1016          
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:NCBI gene;Acc:560364])

HSP 1 Score: 63.1586 bits (152), Expect = 1.129e-9
Identity = 55/188 (29.26%), Postives = 75/188 (39.89%), Query Frame = 1
Query:  148 GTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPK-KTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCG-HADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG---DGKVKIQSPGVCYRMN 696
              S F W     WT CS  C  G + Q   C+++T+    E+     C     P  K   C  G CP       +W  G+W  C  +CG  G + R V CI      +  + + ++C    +P   I C     CP  + T  W +CS S  C   +R RDV C    G   D K K  S   CY  +
Sbjct:  823 AVSYFQW-IYGAWTECSATCGTGMQRQIVHCVEKTSGIVEEH----YCDASMRPDDKQTSCNKGLCPA------IWWAGDWQKCSSSCGEMGLRKRTVLCIRSLGLDEQRALQPAECQHLPKPESIIPCNTQVSCPADWTTGSWSECSVS--CATGLRIRDVTCRWNTGSDCDPKAKPNSTMPCYAQD 997          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 110.923 bits (276), Expect = 2.318e-24
Identity = 91/326 (27.91%), Postives = 140/326 (42.94%), Query Frame = 1
Query:  166 WNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNS---KIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL 1134
            WN T  W+ CS  C  G +T++  C   ++       +  +C  +K P   +PC    CP        W   +W  C + CGG G Q R V C  + + G FL      C  + +P     CG ADCPP+  T +W KC  S+ C   I+RR + C+ I   G +   +   C+ +    PS  ++      + C   K+ N  + +     EI + +    Q R  KR+   +G  AY+L  T + I CP+  + +S IKW+  +   +Y     +++ V + G L I      D G + C A        L L     G DN L
Sbjct:  625 WN-TGSWSRCSATCGVGIQTRDVYC---SSVSESGNNSEQECGAEK-PSAIQPCNQIDCPP------AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKC--SAKCSVGIQRRKMICLKITAKGHLIPINDSHCHGL----PSPALV------RSCHMAKQHNPNRETSPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKY----SKKLGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLKL----IGRDNRL 917          

HSP 2 Score: 67.781 bits (164), Expect = 5.991e-11
Identity = 93/359 (25.91%), Postives = 137/359 (38.16%), Query Frame = 1
Query:  883 FTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKG-VLVIREFYLIDSGEWIC------KAGRYTAKATLH-------LEQPSTGFDNWLKRHANHNYGMLNEESNFSF--------IRPES-------IIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCP-PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCN 1860
            +    + CP+   HR+ I W  G    E  GI   + RV   G VL I        GE+ C      K        TL        L   ST  +N  +    H   +     N S+        IR ++         W    WS CST+C       G+Q R+V C++ +     K++    C    +P+T K C S + C  WI +     QC + C+  G+      ++CQ +N T       ++K    TC ++ C + +  GPW  C+ +C N      +SR + C+ K  +K   +  Q      R  T   R     L   D T  C  VK  K  C   L+   CC  CN
Sbjct: 1255 YINFVVGCPVQTSHRNTIHWFLGTQPIE--GIEGFQYRVLVSGRVLEIYPLSEQSVGEYRCWTSNNSKTMSAWVNVTLQSKLLATLLHCSSTCGNNGTQSSTQHCVNVKGHRVNDSWCEHLHPLVIRSQACNRKDCPARWFPGAWSDCSTSC-----GTGFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSS-DACVDWIPQPWG--QCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASSARK----TCPSEMCDVYWRTGPWRPCTAACGN----GFQSRKVDCMHKKNSKAVAD--QYCVWKRRPTTWQARQHSHNL---DTTHYCTFVKHLKL-CHIDLYKQRCCESCN 1589          

HSP 3 Score: 55.8398 bits (133), Expect = 2.880e-7
Identity = 49/197 (24.87%), Postives = 83/197 (42.13%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP----CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L  DF++ + +      I       +   +  W  T ++ PC+  C  G +  +  C+   + R     N + C      KK +P    C +  CP        W+   W++C  +CGG G Q R + C+  T  G+ L  +  KC    +P    +C   DC PK++  +W +C+ +  C   +R R V C   +G
Sbjct:  248 LRADFIIKIKYAAPKDSIVQ--FYFYQPISHQWRQT-DFFPCTVTCGGGYQLNSAECV---DIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPSR------WEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCTVT--CGRGLRYRVVLCNDHRG 428          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: vash1 (vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494])

HSP 1 Score: 110.538 bits (275), Expect = 2.941e-24
Identity = 92/325 (28.31%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  166 WNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMI--CHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL 1134
            WN T  W+ CS  C  G +T++  C   ++       +  +C  +K P   +PC    CP        W   +W  C + CGG G Q R V C  + + G FL      C  + +P     CG ADCPP+  T +W KC  S+ C   I+RR + C+ I   G +   +   C+ +    PS  ++  CH    Q     K          EI + +    Q R  KR+   +G  AY+L  T + I CP+  + +S IKW+  +   +Y     +++ V + G L I      D G + C A        L L     G DN L
Sbjct:  686 WN-TGSWSRCSATCGVGIQTRDVYC---SSVSESGNNSEQECGAEK-PSAIQPCNQIDCPP------AWHTEDWQQCSRTCGG-GVQIRRVTCKQLLADGSFLKLGDELCQMQ-KPGSHKPCGKADCPPQLTTGEWSKC--SAKCSVGIQRRKMICLKITAKGHLIPINDSHCHGL----PSPALVRSCHMGVCQS----KTSKLGDPESPEILSIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRGIQKSLIKWEKDDQPLKY----SKKLGVTKSGSLKIHNLEAQDIGVYKCIANSAHETFVLKL----IGRDNRL 979          

HSP 2 Score: 72.4034 bits (176), Expect = 2.277e-12
Identity = 66/227 (29.07%), Postives = 103/227 (45.37%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCP-PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNN-RTVDSSLCDSQKL-----PNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKP-AYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCN 1860
            W    WS CST+C       G+Q R+V C++ +     K++    C    +P+T K C S + C  WI +     QC + C+  G+      ++CQ +N  T+  + CD +K         TC ++ C + +  GPW  C+ +C N      +SR + C+ K  +K  A   C  ++ P  +  + C+   C   CKD T  C  VK  K  C   L+   CC  CN
Sbjct: 1434 WFPGAWSDCSTSC-----GTGFQQRQVICQQTKLDGSIKVLPSGSCQYADRPVTQKPCSS-DACVDWIPQPWG--QCLNQCIGQGMGLQHRQVLCQHHNGTTLPEASCDRKKRYLFHGTRKTCPSEMCDVYWRTGPWRPCTAACGN----GFQSRKVDCMHKKNSKAVADQYCVWKRRP--TTWQHCKATSC-GKCKDTTHYCTFVKHLKL-CHIDLYKQRCCESCN 1644          

HSP 3 Score: 51.9878 bits (123), Expect = 4.368e-6
Identity = 49/208 (23.56%), Postives = 85/208 (40.87%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP----CFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L  DF++ + +      I       +   +  W  T ++ PC+  C  G +  +  C+   + R     N + C      KK +P    C +  CP +     +           W+   W++C  +CGG G Q R + C+  T  G+ L  +  KC    +P    +C   DC PK++  +W +C+ +  C   +R R V C   +G
Sbjct:  292 LRADFIIKIKYAAPKDSIVQ--FYFYQPISHQWRQT-DFFPCTVTCGGGYQLNSAECV---DIRLNRTVNDHYCHYYPENKKPKPKLKECNMEPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSIVCVEETMHGEILQVEEWKCMYAPKPTIMQTCNLFDC-PKWMAMEWSQCTVT--CGRGLRYRVVLCNDHRG 489          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 83.5741 bits (205), Expect = 7.484e-16
Identity = 93/353 (26.35%), Postives = 139/353 (39.38%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKV-----------KIQSPGVCYRMNERPPSSWMICH----------------------SKTNQH-------CLEI--------------KKENKKQNSKIEIKTDNSEIH-QMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
            +T CS+ C  G +    VCL   N +T      + C   + P    + C + +CP        W++GNWS+C   CG  G Q RDV C  + S+    +  L     +   P  + +C   DCPP + +S+W +CS++  C   I  R+V C     DG +           K  S  +C   NE  P  W I                         KT Q+       C  I               K   KQ+ +I   T   +++ Q R  K+L+ +VG  AY+L  T L + CP+    + +I W+        H IS E + V   G + I      D+G + C AG
Sbjct:  616 FTECSESCGGGLQEAIVVCL---NKQTRVTVGESLCVASRRPPPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLC--ENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQI---TGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 947          

HSP 2 Score: 67.781 bits (164), Expect = 5.329e-11
Identity = 64/229 (27.95%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDS-SLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYN-LCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS CS +C G     G+QTR+VTC+K+ +    + + +  C     +P+  + C S + C +W        QC   C+   +A     + C+  + T+ S   C +   P  T  C  D C + +    W+ C+ +C    N   +SR ++C+   TNK   + LC  +  P    R    PC      + C+D T  C  VKQ K  C+ + F   CC  C K
Sbjct: 1547 WMVTSWSSCSQSCGG-----GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC-SRQLCVEWTTSPWG--QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCG---NYGFQSRRVECVHHRTNKSVPDHLCSWRSRPINWQRCNITPCEN----IDCRDTTRYCEKVKQLKL-CQLAQFRSRCCGTCGK 1759          

HSP 3 Score: 58.9214 bits (141), Expect = 3.282e-8
Identity = 57/200 (28.50%), Postives = 83/200 (41.50%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSL-------CDSQKLPN-ITCLNDKCQISYNYGPWSQCSLSCSNTT---NASIRSRTMKCIWKHTNK---PAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W   +WS CS TC       G QTR V C  +   E     ++ D FC   KP  ++ C  F+  P W    ++ +QCS  C   G    +  ++C+   R  D S+       C S K P+   C N+ C   ++   WSQCS++C   T   NA  R +     +   N    P+ NL          L +PC +  C
Sbjct:  670 WEIGNWSTCSLTC-----GVGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWY--SSEWKQCSQTC---GGGIHTREVLCK--QRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINL----------LVRPCSLATC 847          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 83.5741 bits (205), Expect = 7.866e-16
Identity = 93/353 (26.35%), Postives = 139/353 (39.38%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKV-----------KIQSPGVCYRMNERPPSSWMICH----------------------SKTNQH-------CLEI--------------KKENKKQNSKIEIKTDNSEIH-QMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
            +T CS+ C  G +    VCL   N +T      + C   + P    + C + +CP        W++GNWS+C   CG  G Q RDV C  + S+    +  L     +   P  + +C   DCPP + +S+W +CS++  C   I  R+V C     DG +           K  S  +C   NE  P  W I                         KT Q+       C  I               K   KQ+ +I   T   +++ Q R  K+L+ +VG  AY+L  T L + CP+    + +I W+        H IS E + V   G + I      D+G + C AG
Sbjct:  605 FTECSESCGGGLQEAIVVCL---NKQTRVTVGESLCVASRRPPPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLC--ENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQI---TGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 936          

HSP 2 Score: 67.781 bits (164), Expect = 5.947e-11
Identity = 64/229 (27.95%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDS-SLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYN-LCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS CS +C G     G+QTR+VTC+K+ +    + + +  C     +P+  + C S + C +W        QC   C+   +A     + C+  + T+ S   C +   P  T  C  D C + +    W+ C+ +C    N   +SR ++C+   TNK   + LC  +  P    R    PC      + C+D T  C  VKQ K  C+ + F   CC  C K
Sbjct: 1536 WMVTSWSSCSQSCGG-----GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC-SRQLCVEWTTSPWG--QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCG---NYGFQSRRVECVHHRTNKSVPDHLCSWRSRPINWQRCNITPCEN----IDCRDTTRYCEKVKQLKL-CQLAQFRSRCCGTCGK 1748          

HSP 3 Score: 58.9214 bits (141), Expect = 3.279e-8
Identity = 57/200 (28.50%), Postives = 83/200 (41.50%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSL-------CDSQKLPN-ITCLNDKCQISYNYGPWSQCSLSCSNTT---NASIRSRTMKCIWKHTNK---PAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W   +WS CS TC       G QTR V C  +   E     ++ D FC   KP  ++ C  F+  P W    ++ +QCS  C   G    +  ++C+   R  D S+       C S K P+   C N+ C   ++   WSQCS++C   T   NA  R +     +   N    P+ NL          L +PC +  C
Sbjct:  659 WEIGNWSTCSLTC-----GVGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWY--SSEWKQCSQTC---GGGIHTREVLCK--QRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINL----------LVRPCSLATC 836          
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Match: ADAMTSL1 (ADAMTS like 1 [Source:NCBI gene;Acc:100494603])

HSP 1 Score: 83.5741 bits (205), Expect = 8.268e-16
Identity = 93/353 (26.35%), Postives = 139/353 (39.38%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKV-----------KIQSPGVCYRMNERPPSSWMICH----------------------SKTNQH-------CLEI--------------KKENKKQNSKIEIKTDNSEIH-QMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
            +T CS+ C  G +    VCL   N +T      + C   + P    + C + +CP        W++GNWS+C   CG  G Q RDV C  + S+    +  L     +   P  + +C   DCPP + +S+W +CS++  C   I  R+V C     DG +           K  S  +C   NE  P  W I                         KT Q+       C  I               K   KQ+ +I   T   +++ Q R  K+L+ +VG  AY+L  T L + CP+    + +I W+        H IS E + V   G + I      D+G + C AG
Sbjct:  590 FTECSESCGGGLQEAIVVCL---NKQTRVTVGESLCVASRRPPPLLKSCNMEACPPR------WEIGNWSTCSLTCG-VGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWYSSEWKQCSQT--CGGGIHTREVLCKQRLSDGSILELPETFCSSSKPPSQDLCE--NEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINLLVRPCSLATCTRSKHGHKQSPQI---TGLRKLYIQTRRQKKLQFVVGGYAYLLPKTSLVLRCPVRRFRKPQIIWEKDGK----HLISSEHVTVAPHGYIKIHNLRPSDTGIYTCMAG 921          

HSP 2 Score: 67.3958 bits (163), Expect = 6.693e-11
Identity = 64/229 (27.95%), Postives = 102/229 (44.54%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDS-SLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYN-LCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS CS +C G     G+QTR+VTC+K+ +    + + +  C     +P+  + C S + C +W        QC   C+   +A     + C+  + T+ S   C +   P  T  C  D C + +    W+ C+ +C    N   +SR ++C+   TNK   + LC  +  P    R    PC      + C+D T  C  VKQ K  C+ + F   CC  C K
Sbjct: 1525 WMVTSWSSCSQSCGG-----GFQTRRVTCQKLTSMGLPVAVANDACTVFSKRPVDSQSC-SRQLCVEWTTSPWG--QCHGPCIGPRMALQHRQVYCKTRDGTIVSPEQCQALPRPLNTQNCWADICSVHWRVSAWTLCTATCG---NYGFQSRRVECVHHRTNKSVPDHLCSWRSRPINWQRCNITPCEN----IDCRDTTRYCEKVKQLKL-CQLAQFRSRCCGTCGK 1737          

HSP 3 Score: 58.5362 bits (140), Expect = 3.754e-8
Identity = 57/200 (28.50%), Postives = 83/200 (41.50%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSL-------CDSQKLPN-ITCLNDKCQISYNYGPWSQCSLSCSNTT---NASIRSRTMKCIWKHTNK---PAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W   +WS CS TC       G QTR V C  +   E     ++ D FC   KP  ++ C  F+  P W    ++ +QCS  C   G    +  ++C+   R  D S+       C S K P+   C N+ C   ++   WSQCS++C   T   NA  R +     +   N    P+ NL          L +PC +  C
Sbjct:  644 WEIGNWSTCSLTC-----GVGLQTRDVFCSHLISRETNETVVLGDDFCRQPKPTLVQACNRFDCPPAWY--SSEWKQCSQTC---GGGIHTREVLCK--QRLSDGSILELPETFCSSSKPPSQDLCENEDCPGEWHITDWSQCSVTCGEGTQIQNAVCRKKLKTGQYIVGNSSMCPSINL----------LVRPCSLATC 821          

HSP 4 Score: 52.7582 bits (125), Expect = 2.664e-6
Identity = 50/194 (25.77%), Postives = 81/194 (41.75%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPK-KTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            LS DF + +++  +   +     + +      W  T+ + PCS  C  G +  +  C    + R       N    +  PK K + C +  C         W+   W++C  +CGG G Q R V+C+     GQ  S +  KC    + P    C   DC PK+L  +W  C+ +  C   +R R V C+  +G
Sbjct:  262 LSADFSVKVHYAGAADSVV--QFIFYQPIIHRWRETD-FFPCSASCGGGYQLTSAECYDLRSGRVVADQYCNYYPENVKPKPKLQECNMDPCLAR------WENTPWTACSSSCGG-GIQSRTVSCVEEDIHGQISSVEEWKCMYTPKMPIVQPCNIFDC-PKWLAQEWSPCTVT--CGHGLRYRVVLCIDHRG 442          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl3 (ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499])

HSP 1 Score: 95.5153 bits (236), Expect = 1.344e-19
Identity = 87/342 (25.44%), Postives = 136/342 (39.77%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERP---PSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNW------LKRHANHNYGMLNEESN 1182
            W  CS  C  G +T++  CL    +     A   +C+ +K P   R C    CP +      W +  W  C + CGG G+Q R V C  + + G FL+     C    +     SC   DCPP+     W KCS +  C    +RR   C  +   G+    +  +C  +   P   P    IC         ++  + K      +I        Q R  KR+ + VG  AY+L  T + I CP+    +S I+W+   +  +    + +++ + + G L I      D G + C AG       L L     G DN       L+ H   + G+ + E+N
Sbjct:  725 WGACSATCGVGIQTRDVYCL----HPEEFPAPPEECREEK-PHALRACNQFDCPPS------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPQLAAGDWSKCSVT--CGVGFQRRKQVCQKLTAKGRRVSVAETLCRDLPGLPLVRPCQMPICSKA------KLGTKTKLGERGPQILGVRRVYIQTREEKRINLTVGSRAYLLLNTSVIIKCPVRRFQKSLIQWEKDGHCLK----NSKQLGITKSGSLKIHSLAAPDIGVYRCIAGSAQETVVLKL----IGTDNRLIAHPSLREHVRGHPGVDHNEAN 1037          

HSP 2 Score: 73.1738 bits (178), Expect = 1.041e-12
Identity = 135/609 (22.17%), Postives = 221/609 (36.29%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP------CFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDG--------KVKIQS----PGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIE----IKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRE---RIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKAT-LHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTST--NIVCQFNNRTVDSSLCDSQKLP-NITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKP-----AYNLCQLQQLPHRSLTKPCRVPKC 1761
            L  DF+    +  +V+  ++     +   +  W  T+ + PC+  C  G +  +  C+   + R       + C    YP+  +P      C +  CP +     +           W+   W++C  +CGG G Q R   C+  +   + L  +  KC    +P    +C   DCP K++  +W +C+ +  C   +R R V C+  +G          K+ I+     P  CY+  E+ P    +   K  Q   E +   ++     E      T      Q+R   R ++L+  T             P P   R  ++        +   +SRE   R++     +    E+         C  G   A A  LH +   T  D+       H    +++  N     P    W    W  CS TC       G QTR V C   E         + C   KP  ++ C  F+  P W +E  + +QCS  C      R  T   ++   +   +   LC   K   + +C    C      G WS+CS++C        + R   C  K T K      A  LC  + LP   L +PC++P C
Sbjct:  325 LMADFIFKTRY--TVAKGSVVQFFFYQPISHQWRQTD-FFPCTVTCGGGYQLNSAECM---DIRLKRVVPDHYCHY--YPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWEHNPWTACSVSCGG-GIQRRSFVCVEESMHAEILQVEEWKCMYAPKPTVMQACNLFDCP-KWVAMEWSQCTVT--CGRGLRYRVVLCINHRGQHVGGCNPQMKLHIKEECVIPIPCYKPREKSPVEAKLPWLKQAQELEETRIATEEPKFIPEPWSACSTTCGPGIQVREV-RCRVLLTFTQTEAELPEEECEGPKPPTDRPCLR-----QACDQSPVSRELGGRLQEKDSEMTYDWEYAGFTPCTATCLGGHQEAIAVCLHTQTHQTVNDSLCD--TVHRPPPMSQACNMEPCPPR---WHMGSWGACSATC-----GVGIQTRDVYCLHPEEFPAPP---EECREEKPHALRACNQFDCPPSWHIE--EWQQCSRTCGGGTQNRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPQLAAGDWSKCSVTC----GVGFQRRKQVC-QKLTAKGRRVSVAETLC--RDLPGLPLVRPCQMPIC 893          

HSP 3 Score: 62.3882 bits (150), Expect = 1.751e-9
Identity = 38/106 (35.85%), Postives = 52/106 (49.06%), Query Frame = 1
Query:  370 WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEP-PRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            W+ GNW+ C   CG  G + +   C+M  + GQ +S  L  C    +P   F SC   DCP ++ TS W +CS S  C      R V C   K +G V++ SP  C
Sbjct: 1442 WEPGNWTHCSATCGPLGFRLQRPRCVM--ASGQEVSEAL--CGPHRKPLAGFQSCNIRDCPARWFTSMWSECSAS--CGEGFHSRQVTCKQTKANGTVQVVSPRAC 1541          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 86.6557 bits (213), Expect = 7.502e-17
Identity = 86/305 (28.20%), Postives = 121/305 (39.67%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVC---LKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPP----SSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
             +W+PCS  C  G +T++ VC   L R        A+   C   K P   + C   +CP        W    W  C + CGG G Q RDV C    + G FL    + C    +P     C   DCP ++L S+W +CS S  C    + R   C  +   G   + +  +C      PP    SS   C   T   C    + + K +  I     N  I Q R  ++L  +VG  AY+L  T + + CP     +  I W+        H IS   + V   G L I      D+G + C AG
Sbjct:  656 GKWSPCSLTCGVGLQTRDVVCSHLLSREMNEVVVLAD-ELCHHPK-PSTVQACNRFNCPP------AWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLAT---CARPGRPSTKHSPHI-AAARNIYI-QTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAG 933          

HSP 2 Score: 67.3958 bits (163), Expect = 6.337e-11
Identity = 61/228 (26.75%), Postives = 100/228 (43.86%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  L  +P+  + C   + C +W        QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC   +    C+D T  C K  + + C+   F   CC  C K
Sbjct: 1540 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAFSSWG--QCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTE----CRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1752          

HSP 3 Score: 65.0846 bits (157), Expect = 2.769e-10
Identity = 50/162 (30.86%), Postives = 73/162 (45.06%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQ----FLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDG 654
            +T CS+ C  G +     CL   N +T E A+ N C   + P +  + C L  CP        W++G WS C   C G G Q RDV C  + S+       L+ +L       +P    +C   +CPP +  ++W  CS +  C   I++RDV C     DG
Sbjct:  599 FTKCSESCGGGVQEAVVSCL---NKQTRELADENLCVTSRRPPQLLKSCNLDPCPAR------WEIGKWSPCSLTC-GVGLQTRDVVCSHLLSREMNEVVVLADELCH---HPKPSTVQACNRFNCPPAWYPAQWQLCSRT--CGGGIQKRDVLCKQRMADG 745          

HSP 4 Score: 59.3066 bits (142), Expect = 1.679e-8
Identity = 53/194 (27.32%), Postives = 75/194 (38.66%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCD--------SQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W    WSPCS TC       G QTR V C  +   E     ++ D+ C   KP T++ C  F   P W   +   + CS  C   G      +++C+   R  D S  +        S+   +  C  D C   +    WS+CS+SC   T    RS   + + K       N      LP  S  +PC +  C
Sbjct:  653 WEIGKWSPCSLTC-----GVGLQTRDVVCSHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQW--QLCSRTC---GGGIQKRDVLCK--QRMADGSFLELPETFCSASKPTSHQGCKKDDCPSEWLLSEWSECSVSCGEGTQT--RSAICQRVLKTGVSTVVNSTLCPPLPFSSSIRPCMLATC 832          

HSP 5 Score: 56.225 bits (134), Expect = 1.422e-7
Identity = 51/199 (25.63%), Postives = 83/199 (41.71%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP------CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L+ DF++ ++ L      +    + +      W  T+ + PCS  C  G +  +  C    + R+        C    YP+  +P      C L  CP        W+   W++C  +CGG G Q R V+C+    +G   S +  KC    + P    C   DC PK+L  +W  C+ +  C   +R R V C+  +G
Sbjct:  271 LTADFIIKIHDLGPAD--STVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY---DLRSNRVVADQYCHY--YPENVKPKPKLQECNLDPCPAR------WEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTVT--CGQGLRYRVVLCIDHRG 451          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamtsl1 (ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989])

HSP 1 Score: 77.0258 bits (188), Expect = 7.097e-14
Identity = 86/332 (25.90%), Postives = 123/332 (37.05%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTF-------------------------------VWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPP----SSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
            +T CS+ C  G +     CL   N +T E A+ N C   + P +  + C L  CP +   +                                 W    W  C + CGG G Q RDV C    + G FL    + C    +P     C   DCP ++L S+W +CS S  C    + R   C  +   G   + +  +C      PP    SS   C   T   C    + + K +  I     N  I Q R  ++L  +VG  AY+L  T + + CP     +  I W+        H IS   + V   G L I      D+G + C AG
Sbjct:  616 FTKCSESCGGGVQEAVVSCL---NKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLAT---CARPGRPSTKHSPHI-AAARNIYI-QTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAG 925          

HSP 2 Score: 66.2402 bits (160), Expect = 1.140e-10
Identity = 61/228 (26.75%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  L  +P+  + C   + C +W    +   QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC   +    C+D T  C K  + + C+   F   CC  C K
Sbjct: 1532 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAF--SSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTE----CRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1744          

HSP 3 Score: 52.7582 bits (125), Expect = 1.870e-6
Identity = 51/210 (24.29%), Postives = 85/210 (40.48%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP------CFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            L+ DF++ ++ L      +    + +      W  T+ + PCS  C  G +  +  C    + R+        C    YP+  +P      C L  CP +     +           W+   W++C  +CGG G Q R V+C+    +G   S +  KC    + P    C   DC PK+L  +W  C+ +  C   +R R V C+  +G
Sbjct:  271 LTADFIIKIHDLGPAD--STVQFIFYQPIIHRWRETD-FFPCSATCGGGYQLTSAECY---DLRSNRVVADQYCHY--YPENVKPKPKLQECNLDPCPASDGYKQIMPYDLYHPLPRWEATPWTACSSSCGG-GIQSRAVSCVEEDIQGHVTSVEEWKCMYTPKMPVVQPCNIFDC-PKWLAQEWSPCTVT--CGQGLRYRVVLCIDHRG 468          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts14 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 14 [Source:MGI Symbol;Acc:MGI:2179942])

HSP 1 Score: 69.707 bits (169), Expect = 9.421e-12
Identity = 53/189 (28.04%), Postives = 83/189 (43.92%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP-CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            L++ +++  + L    +I  + +L   T T+ W     W+PCSK C  G +   + C +R   R +   + + C   K PK  R  C   SCPQ +     W    W +C ++CG  G Q R V C++  S G   +     C     P     C    CP ++ T  W +CS +  C   I++R V C
Sbjct:  809 LAYKYVIHEDLL---PLIGSNNVLLEETDTYEWA-LKSWSPCSKACGGGIQFTKYGCRRR---RDHHMVHRHLCDHKKRPKPIRRRCNQHSCPQPT-----WVTEEWGACSRSCGKLGLQTRGVQCLLPLSNGTHKAMPAKAC-LGNRPEAKKPCLRVPCPAQWRTGAWSQCSAT--CGEGIQQRQVVC 982          
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Match: Adamts14 (a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 14 [Source:MGI Symbol;Acc:MGI:2179942])

HSP 1 Score: 69.707 bits (169), Expect = 9.428e-12
Identity = 53/189 (28.04%), Postives = 83/189 (43.92%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP-CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            L++ +++  + L    +I  + +L   T T+ W     W+PCSK C  G +   + C +R   R +   + + C   K PK  R  C   SCPQ +     W    W +C ++CG  G Q R V C++  S G   +     C     P     C    CP ++ T  W +CS +  C   I++R V C
Sbjct:  812 LAYKYVIHEDLL---PLIGSNNVLLEETDTYEWA-LKSWSPCSKACGGGIQFTKYGCRRR---RDHHMVHRHLCDHKKRPKPIRRRCNQHSCPQPT-----WVTEEWGACSRSCGKLGLQTRGVQCLLPLSNGTHKAMPAKAC-LGNRPEAKKPCLRVPCPAQWRTGAWSQCSAT--CGEGIQQRQVVC 985          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P90884|MADD4_CAEEL (Protein madd-4 OS=Caenorhabditis elegans OX=6239 GN=madd-4 PE=1 SV=5)

HSP 1 Score: 121.324 bits (303), Expect = 4.974e-27
Identity = 149/638 (23.35%), Postives = 246/638 (38.56%), Query Frame = 1
Query:  139 LSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTK--FEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQ---PSTGFDNWLK----------RHANHNYGMLNEES------NFSFIRPESII----------------------WIKSDWSPC-STTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDV-CVNIGVARTSTNIVCQFNNRT-VDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPH--RSLTKPCRVPKCILGCKDL---TSACVKQSKY--------RCRSSLFNHFCCAFC 1857
            LS   + + W    +WT CS  C  G++     C++ +  ++ +++  +     + P+K+RPC    CP        W    +S C  +CG  G+  R V C    SK     + +   D +  F+ P+   +C    CP  ++T++W +CS S  C    RRR V C      GK +            RP    + C + T    +E+         ++     N    Q    K+L + +G  A +   T + I CP     + KI W+      +        I+V+  G L +    + D+G + C   R     TL+ +    P++  D   K          R       +L E++      N S I  E+++                      W    WS C   TC      AGYQ R ++C+       + +++  C  L   +P   + C   E CP+W  E +   +CS   CV+  +A+   N+ C+F N T VD   CD    P  T  C N  C+  +    W  CS  C       ++ R + C+W  + +PA   C+  + PH  R+      +P C+     L    ++C  QS++         C S      CC+ C
Sbjct:  445 LSEDEAPYQWR-YGDWTQCSASCLGGKQKAALKCIQVSTGKSVQWSQCDA--RRRPPEKSRPCNQHPCPP------FWLTSKYSDCSMSCGS-GTARRSVKCAQTVSKTDGADAHIVLRDDRCHFKKPQETETCNVVACPATWVTAQWTECSRS--CDSGERRRQVWCEIRDSRGKTQ-----------RRPD---VECDANTKPQTVEVCSFGSCSRPEL---LSNRVFEQNAEQKKLTLGIGGVATLYQGTSIKIKCPAKKFDKKKIYWKKNGKKIKNDA----HIKVSANGNLRVFHARMEDAGVYECFTDRLQGNVTLNFKYRDFPASRVDLAPKPQIPSTKNRQRVQVSKEDVLREQASVLHKMNVSLI--EALLTAPNDEKAREQLRKYGNELVARWDIGHWSECRQKTCH----VAGYQARGISCKVTFHGEIRNVDNSICESLASVRPPETRPCHR-EDCPRW--EASQWSECSSQRCVSSMLAQKRRNVTCRFTNGTSVDIQHCDITNRPATTMDCPNQNCKAEWRTSDWGSCSSECG---TGGVQLRLLSCVWISSGRPAGRNCEQMRRPHSARACVADEPLPPCMPTASALYQRDASCQDQSRFCDIIKLFHSCDSLEVRQKCCSTC 1037          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|P82987|ATL3_HUMAN (ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=ADAMTSL3 PE=1 SV=4)

HSP 1 Score: 103.219 bits (256), Expect = 3.240e-21
Identity = 94/344 (27.33%), Postives = 137/344 (39.83%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQ--NSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL-----KRHANHNY-GMLNEESN 1182
               W PCS  C  G +T++  CL    +     A   +C+ D+ P   + C    CP        W +  W  C + CGG G+Q R V C  + + G FL+     C    +     SC   DCPP      W KCS S  C   I+RR   C  +   G+    S  +C  +   P     +  S     C +IK E K +      +I +      Q R  KR+ + +G  AY+L  T + I CP+    +S I+W+      +    + +R+ + + G L I      D G + C AG       L L     G DN L      R     Y GM + E+N
Sbjct:  709 VGSWGPCSATCGVGIQTRDVYCL----HPGETPAPPEECR-DEKPHALQACNQFDCPPG------WHIEEWQQCSRTCGG-GTQNRRVTCRQLLTDGSFLNLSDELCQGP-KASSHKSCARTDCPPHLAVGDWSKCSVS--CGVGIQRRKQVCQRLAAKGRRIPLSEMMCRDLPGLP-----LVRSCQMPECSKIKSEMKTKLGEQGPQILSVQRVYIQTREEKRINLTIGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQ----NSKRLGITKSGSLKIHGLAAPDIGVYRCIAGSAQETVVLKL----IGTDNRLIARPALREPMREYPGMDHSEAN 1024          

HSP 2 Score: 65.855 bits (159), Expect = 1.134e-9
Identity = 58/222 (26.13%), Postives = 92/222 (41.44%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQ-YYKIIEDKFCPPL-KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCNK 1863
            W  S WS CS +C       GY +R+VTC++ +A    +++  + C P  +P+  K C     C +W        +C   C+   V     +  CQ N+     S CD +K P +   C +  C + ++ GPW  C+ +C        +SR + CI   + KP      +Q+    S  + C  P C   C D T  C+       C    +   CC  C +
Sbjct: 1487 WFTSVWSQCSVSC-----GEGYHSRQVTCKRTKANGTVQVVSPRACAPKDRPLGRKPCFGHP-CVQW----EPGNRCPGRCMGRAVRMQQRHTACQHNS---SDSNCDDRKRPTLRRNCTSGACDVCWHTGPWKPCTAACGR----GFQSRKVDCIHTRSCKPVAKRHCVQKKKPISW-RHCLGPSCDRDCTDTTHYCMFVKHLNLCSLDRYKQRCCQSCQE 1690          

HSP 3 Score: 63.1586 bits (152), Expect = 9.075e-9
Identity = 39/106 (36.79%), Postives = 53/106 (50.00%), Query Frame = 1
Query:  370 WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEP-PRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC 684
            W+ GNWS C   CG  G++ +   C+M  + GQ +S  L  CD   +P   F  C   DCP ++ TS W +CS S  C      R V C   K +G V++ SP  C
Sbjct: 1428 WEPGNWSHCSATCGHLGARIQRPQCVM--ANGQEVSEAL--CDHLQKPLAGFEPCNIRDCPARWFTSVWSQCSVS--CGEGYHSRQVTCKRTKANGTVQVVSPRAC 1527          

HSP 4 Score: 53.5286 bits (127), Expect = 7.000e-6
Identity = 45/174 (25.86%), Postives = 69/174 (39.66%), Query Frame = 1
Query:  157 TFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSC-------------PQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
            TF+  P   W+ CS  C  G + +   C     +   E     +          RPC L +C             P++S  T+ W+   ++ C   C G G Q     C+ I ++ Q ++  L  CD    PP    +C    CPP++    W  CS +  C   I+ RDV C+
Sbjct:  567 TFIPEP---WSACSTTCGPGVQVREVKCRVLLTFTQTETELPEEECEGPKLPTERPCLLEACDESPASRELDIPLPEDSETTYDWEYAGFTPCTATCVG-GHQEAIAVCLHIQTQ-QTVNDSL--CDMVHRPPAMSQACNTEPCPPRWHVGSWGPCSAT--CGVGIQTRDVYCL 731          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N6G6|ATL1_HUMAN (ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=ADAMTSL1 PE=1 SV=4)

HSP 1 Score: 82.0333 bits (201), Expect = 1.108e-14
Identity = 83/305 (27.21%), Postives = 121/305 (39.67%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVC---LKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPP----SSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
             +W+PCS  C  G +T++  C   L R    T   A+   C+  K P   + C   +CP        W    W  C + CGG G Q R+V C    + G FL    + C    +P    +C   DCP ++L S W +CS S  C    + R   C  +   G   + +  +C      PP    SS   C   T   C    + + K +    I        Q R  ++L  +VG  AY+L  T + + CP   + +  I W+        H IS   + V   G L I      D+G + C AG
Sbjct:  673 GKWSPCSLTCGVGLQTRDVFCSHLLSREMNETVILAD-ELCRQPK-PSTVQACNRFNCPP------AWYPAQWQPCSRTCGG-GVQKREVLCKQRMADGSFLELPETFCSAS-KPACQQACKKDDCPSEWLLSDWTECSTS--CGEGTQTRSAICRKMLKTGLSTVVNSTLC------PPLPFSSSIRPCMLAT---CARPGRPSTKHSP--HIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCPARRVRKPLITWEKDGQ----HLISSTHVTVAPFGYLKIHRLKPSDAGVYTCSAG 950          

HSP 2 Score: 68.5514 bits (166), Expect = 1.859e-10
Identity = 64/229 (27.95%), Postives = 103/229 (44.98%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSAC--VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  +  +P+  + C   + C +W    +   QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC      + C+D T  C  VKQ K  C+ S F   CC  C K
Sbjct: 1549 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCTQVAKRPVDTQACNQ-QLCVEWAF--SSWGQCNGPCIGPHLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHARTNKAVPEHLCSWGPRPANWQRCNITPCEN----MECRDTTRYCEKVKQLKL-CQLSQFKSRCCGTCGK 1761          

HSP 3 Score: 63.5438 bits (153), Expect = 6.175e-9
Identity = 48/162 (29.63%), Postives = 74/162 (45.68%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQ----FLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDG 654
            +T CS+ C  G +     CL   N +T E A  N C   + P +  + C L  CP        W++G WS C   C G G Q RDV C  + S+       L+ +L +   + +P    +C   +CPP +  ++W  CS +  C   +++R+V C     DG
Sbjct:  616 FTKCSESCGGGVQEAVVSCL---NKQTREPAEENLCVTSRRPPQLLKSCNLDPCPAR------WEIGKWSPCSLTC-GVGLQTRDVFCSHLLSREMNETVILADELCR---QPKPSTVQACNRFNCPPAWYPAQWQPCSRT--CGGGVQKREVLCKQRMADG 762          

HSP 4 Score: 55.4546 bits (132), Expect = 1.916e-6
Identity = 53/194 (27.32%), Postives = 72/194 (37.11%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKI---EAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCD--------SQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKC 1761
            W    WSPCS TC       G QTR V C  +   E     I+ D+ C   KP T++ C  F   P W   +   + CS  C   G       ++C+   R  D S  +        S+      C  D C   +    W++CS SC   T    RS   + + K       N      LP  S  +PC +  C
Sbjct:  670 WEIGKWSPCSLTC-----GVGLQTRDVFCSHLLSREMNETVILADELCRQPKPSTVQACNRFNCPPAWYPAQW--QPCSRTC---GGGVQKREVLCK--QRMADGSFLELPETFCSASKPACQQACKKDDCPSEWLLSDWTECSTSCGEGTQT--RSAICRKMLKTGLSTVVNSTLCPPLPFSSSIRPCMLATC 849          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BLI0|ATL1_MOUSE (ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=Adamtsl1 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 4.965e-13
Identity = 86/332 (25.90%), Postives = 123/332 (37.05%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTF-------------------------------VWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPP----SSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAG 1071
            +T CS+ C  G +     CL   N +T E A+ N C   + P +  + C L  CP +   +                                 W    W  C + CGG G Q RDV C    + G FL    + C    +P     C   DCP ++L S+W +CS S  C    + R   C  +   G   + +  +C      PP    SS   C   T   C    + + K +  I     N  I Q R  ++L  +VG  AY+L  T + + CP     +  I W+        H IS   + V   G L I      D+G + C AG
Sbjct:  616 FTKCSESCGGGVQEAVVSCL---NKQTRELADENLCVTSRRPPQLLKSCNLDPCPASHLLSREMNEVVVLADELCHHPKPSTVQACNRFNCPPAWYPAQWQLCSRTCGG-GIQKRDVLCKQRMADGSFLELPETFCSAS-KPTSHQGCKKDDCPSEWLLSEWSECSVS--CGEGTQTRSAICQRVLKTGVSTVVNSTLC------PPLPFSSSIRPCMLAT---CARPGRPSTKHSPHI-AAARNIYI-QTRRQRKLHFVVGGFAYLLPKTTVVLRCPTRRFRKPLITWEKDGQ----HSISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAG 925          

HSP 2 Score: 66.2402 bits (160), Expect = 7.975e-10
Identity = 61/228 (26.75%), Postives = 101/228 (44.30%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKI-IEDKFCPPL--KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-TVDSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPA-YNLCQLQQLP---HRSLTKPCRVPKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCNK 1863
            W+ + WS C+ +C G     G QTR+VTC+K++A      + +  C  L  +P+  + C   + C +W    +   QC+  C+   +A     + CQ  +  T+ S  C +   P  T  C ++ C + +    W+ C+ +C N      +SR ++C+   TNK    +LC     P    R    PC   +    C+D T  C K  + + C+   F   CC  C K
Sbjct: 1532 WMVTSWSACTRSCGG-----GVQTRRVTCQKLKASGISTPVSNDMCSQLAKRPVDTQACNQ-QLCVEWAF--SSWGQCNGPCIGPRLAVQHRQVFCQTRDGITLPSEQCSALPRPVSTQNCWSEACSVHWRVSLWTLCTATCGNY---GFQSRRVECVHVRTNKAVPEHLCSWGPRPANWQRCNVTPCENTE----CRDTTRYCEKVRQLKLCQLGQFRSRCCGTCGK 1744          
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H324|ATS10_HUMAN (A disintegrin and metalloproteinase with thrombospondin motifs 10 OS=Homo sapiens OX=9606 GN=ADAMTS10 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 3.546e-10
Identity = 55/187 (29.41%), Postives = 74/187 (39.57%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC------VTIKGDGKVKIQSPGVCYRMNER--PPSSWM 720
            WT CS  C  G + Q   C  R    +   A        K PK+ R C    CP +      W VGNWS C ++C   G + R V C    S  +  +   S C  +  PP   +C    CPP++    W +C+ S  C P +R R V C       T+          P    R N R  PP+ W+
Sbjct:  834 WTKCSAQCAGGSQVQAVEC--RNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPD------WVVGNWSLCSRSCDA-GVRSRSVVCQRRVSAAEEKALDDSAC-PQPRPPVLEACHGPTCPPEWAALDWSECTPS--CGPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWV 1008          

HSP 2 Score: 59.3066 bits (142), Expect = 1.226e-7
Identity = 41/159 (25.79%), Postives = 69/159 (43.40%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP-KFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
               W+ CS+ CD G  +++ VC +R +    +  + + C   + P     C   +CP        W   +WS C  +C G G + R V C    S     +   + C    +PP  + C    CPP +++  +W +C  S+ C    R+R V+C +  G
Sbjct:  890 VGNWSLCSRSCDAGVRSRSVVCQRRVSAAEEKALDDSACPQPR-PPVLEACHGPTCPPE------WAALDWSECTPSC-GPGLRHRVVLC---KSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGEC--SAQCGVGQRQRSVRCTSHTG 1035          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A094ZL01 (ADAMTS-like protein 3 OS=Schistosoma haematobium OX=6185 GN=MS3_02878 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 7.538e-109
Identity = 190/580 (32.76%), Postives = 293/580 (50.52%), Query Frame = 1
Query:  163 MWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT------RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK---CDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNN-TYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNK 1863
             W P+  W+ CSK C  G ET+ F+C++  +Y      + ++C+    P         R C LG C +     + W+V NW  C + CGG G   RDV C+     G  + S       C    +P R  SC    C P+F+  KW KC +S  CRP  + R + C++++ +G ++      CY   +    +W  C  ++++ C          +    I TD   I QMR  K + + VGQ A+V+ FTR+++ CP+      +++W + N+    Y G   +RIRV+++G L IR F LID G+W C AG   A  TL    P+ GF +W++R+     GML+++     I  E I W+   WS CST+C       G Q R V CEK+++++Y+I+ D+ C      KP + +KC    +CP W VE  D   C+D C+++G    S N+VC    RTV +  CD    PN+ C N  CQ+ +N   WSQCS SC       +++R + C W H  + A +LC   QL    + + C VP C LGC D++  C K+ +  C+ +++ + CC  C +
Sbjct:   11 FWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDAFYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEESSRKC---------DSKPPMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSC----GQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCG---GVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVEL-CKFTIYRYQCCESCQR 569          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A183JCE1 (Ig-like domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS349 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.013e-108
Identity = 190/580 (32.76%), Postives = 293/580 (50.52%), Query Frame = 1
Query:  163 MWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT------RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK---CDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNN-TYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNK 1863
             W P+  W+ CSK C  G ET+ F+C++  +Y      + ++C+    P         R C LG C +     + W+V NW  C + CGG G   RDV C+     G  + S       C    +P R  SC    C P+F+  KW KC +S  CRP  + R + C++++ +G ++      CY   +    +W  C  ++++ C          +    I TD   I QMR  K + + VGQ A+V+ FTR+++ CP+      +++W + N+    Y G   +RIRV+++G L IR F LID G+W C AG   A  TL    P+ GF +W++R+     GML+++     I  E I W+   WS CST+C       G Q R V CEK+++++Y+I+ D+ C      KP + +KC    +CP W VE  D   C+D C+++G    S N+VC    RTV +  CD    PN+ C N  CQ+ +N   WSQCS SC       +++R + C W H  + A +LC   QL    + + C VP C LGC D++  C K+ +  C+ +++ + CC  C +
Sbjct:   23 FWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEESSRKC---------DSKPPMINTDTLTIVQMRKVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSC----GQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCG---GVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVEL-CKFTIYRYQCCQSCQR 581          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A430QEZ9 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0006420 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 3.646e-106
Identity = 191/588 (32.48%), Postives = 292/588 (49.66%), Query Frame = 1
Query:  163 MWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT------RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK---CDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKIL--------VGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNN-TYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL---KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNK 1863
             W P+  W+ CSK C  G ET+ F+C++  +Y      + ++C+    P         R C LG C +     + W+V NW  C + CGG G   RDV C+     G  + S       C    +P R  SC    C P+F+  KW KC +S  CRP  + R + C++++ +G ++      CY   +    +W  C  ++++ C          +    I TD   I QMR    L  L        VGQ A+V+ FTR+++ CP+      +++W + N+    Y G   +RIRV+++G L IR F LID G+W C AG   A  TL    P+ GF +W++R+     GML+++     I  E I W+   WS CST+C       G Q R V CEK+++++Y+I+ D+ C      KP + +KC    +CP W VE  D   C+D C+++G    S N+VC    RTV +  CD    PN+ C N  CQ+ +N   WSQCS SC       +++R + C W H  + A +LC   QL    + + C VP C LGC D++  C K+ +  C+ +++ + CC  C +
Sbjct:    7 FWMPSESWSSCSKECGDGVETRRFLCVQNDHYNATTLLDESQCEHLPNPSAQNTENNQRACKLGPCGKG----YRWRVSNWGHCSQTCGGLGIMSRDVQCVYSGKDGDLVISDFDASYYCGNYRQPERHASCNRFACKPEFVPEKWGKCIQSDPCRPGRQVRQLSCISVQVNGSLRELPMAACYMTGKTIQPTWRRCFEESSRKC---------DSKPPMINTDTLTIVQMRKVVSLIFLLVKVIDLKVGQQAFVIPFTRVTVRCPVQYFTAQELQWANPNHGILAYTGAISDRIRVDKRGRLHIRSFRLIDEGDWTCIAGSMNATVTLTARTPAAGFHDWVQRNRLWTKGMLSDDPKAIAINHEIIQWVVGPWSTCSTSC----GQTGQQFRVVRCEKVDSRFYQILSDQVCIDKLLPKPPSTRKCLESNKCPTWFVENRDTSVCTDRCLDVGKGSISGNLVCMIGERTVATKYCDKLDKPNMECENPICQLRWNVSNWSQCSRSCG---GVGVQARHLLCTWSHNGELAGSLCYSHQLAIPDVIRSCEVPPCKLGCVDMSKHCSKRVEL-CKFTIYRYQCCESCQR 573          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A4S2LCE5 (Ig-like domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008272 PE=4 SV=1)

HSP 1 Score: 344.739 bits (883), Expect = 8.573e-106
Identity = 185/605 (30.58%), Postives = 304/605 (50.25%), Query Frame = 1
Query:   97 NFLTSVSVITLSGLLSFGTSTFM-------WNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQ---MDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK---CDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSP-GVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQH-GNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPP---LKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFC 1857
            + + ++S+    GLL    ++ M       W   + W+PCS  C +G +   + C+ +  Y         KC+       P   R C LGSC       + W+V NW  C + CGG G+  RDV+C+     G  + ++      C    +P +   C    C P F+  +W KC +S  CRP  + R V C++I+ +G   +Q P   CYR+      +W  C   +   C         ++ +  I TD+  I QMR T+ L + VGQ A+V+ +TR+++ CP+      +I W H  +   +Y G   +RI V+++G L IR F   D+GEW C+AG  +A+  +H   P+ GF +W++R+     GM++++     +    + W++  WS CS +C     + G Q R V CE+++ +YY+I++D+ C      KP++ +KC   ++CP W+V   D   C+D C+ +       NI C+  ++ V+  LCDS + P+++C N KCQ+ +  GPWSQCS  C       +R+R + C W H  +PA  LC   QLP   + + C  P C   C D +  C  +++  C+ +L+ + CCA C
Sbjct:   22 SLINAISLFLAFGLLFVKVTSTMHGVDVPYWQKASYWSPCSTTCGEGVQRIKYQCVSQDMYGILTILEDQKCEGLPQPSEPGDERSCNLGSC-----SGYRWRVSNWGHCSQTCGGFGTMTRDVDCVYTGMDGDIMVNERDASNYCGYYAQPEKHSPCNRIACKPDFVPEQWGKCIQSDPCRPGRQVRQVLCISIQPNG-THVQLPRAACYRLGRPQQPTWRRCFIASTTGC---------EDQQPTIDTDHMTIVQMRKTRNLNLQVGQRAFVIPYTRVTVICPVHYFSVHEIVWTHPSHGQLKYTGRLDDRILVDKRGRLRIRSFRNEDAGEWECRAGNQSAQINMHPRTPAEGFHDWIQRNRLWTKGMMSDDPKNMAVAHAIVQWVEGPWSACSVSC----GDTGQQFRTVRCERVDTRYYEILDDQVCLDKLLPKPLSRRKCLKSKKCPGWVVVGADPSVCTDRCIAVDQGSIRGNITCRIGSQIVEEKLCDSSEKPDMSCPNPKCQVDWQVGPWSQCSKLCG---GVGVRARQLTCTWVHDKQPAGPLCYANQLPSPPVIEECEAPPCKFECVDFSKYCSTRTEL-CKFTLYRYQCCATC 603          
BLAST of Ig-like domain-containing protein vs. TrEMBL
Match: A0A1S8X133 (Thrombospondin type 1 domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03696 PE=4 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 1.390e-104
Identity = 183/605 (30.25%), Postives = 303/605 (50.08%), Query Frame = 1
Query:   97 NFLTSVSVITLSGLLSF-------GTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQ---MDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK---CDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSP-GVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQH-GNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPP---LKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFC 1857
            + + ++S+    GLL         G     W   + W+ CS  C +G +   + C+ +  Y         KC+       P   R C LGSC       + W+V +W  C + CGG G+  RDV+C+     G  + ++      C    +P +   C    C P F+  +W KC +S  CRP  + R V C++I+ +G   +Q P   CYR+      +W  C  ++   C         ++ +  I TD+  I QMR T+ L + VGQ A+V+ +TR+++ CP+      +I W H  +   +Y G   +R+ V+R+G L IR F   D+GEW C+AG  +A+  +H   P+ GF +W++R+     GM++++     +    + W++  WS CS +C     + G Q R V CE+++ +YY+I++D+ C      KP++ +KC   ++CP W+V  +D   C+D C+ +       NI C+  ++ V+  LCDS + P+++C N KCQ+ +  GPWSQCS  C       +R+R + C W H  +PA  LC   QLP   + + C  P C   C D +  C  +++  C+ +L+ + CCA C
Sbjct:   12 SLINAISLFLTFGLLFVKVTSTIHGVDVPYWQKASYWSLCSATCGEGVQRIKYQCVSQDMYGILTILEDQKCEGLPQPSEPGDERSCNLGSC-----RGYRWRVSDWGHCSQTCGGFGTMTRDVDCVYTGMDGDIMVNERDASNYCGIYAQPEKHSPCNRIACKPDFMPEQWGKCIQSDPCRPGRQVRQVLCISIQPNG-THVQLPRAACYRLGRPQQPTWRRCFIESTTGC---------EDQQPTIDTDHMTIVQMRKTRNLNLQVGQRAFVIPYTRVTVICPVHYFSVHEIVWTHPSHGQLKYTGRLDDRVLVDRRGRLRIRSFRNEDAGEWECRAGNQSAQLNMHPRTPAEGFHDWIQRNRLWTKGMMSDDPKNLAVAHAIVQWVEGPWSACSVSC----GDTGQQFRTVRCERVDTRYYEILDDQVCLDKLLPKPLSKRKCLKSKKCPAWVVVGSDPSVCTDRCIAVDQGSIRGNITCRIGSQIVEEKLCDSSEKPDMSCPNPKCQVEWQVGPWSQCSKLCG---GVGVRARQLTCTWVHDKQPAGPLCYANQLPSPPVIEECEAPPCKFECVDFSKYCPTRTEL-CKFTLYRYQCCATC 593          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamtsl3 (ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028701])

HSP 1 Score: 77.7962 bits (190), Expect = 2.473e-14
Identity = 87/343 (25.36%), Postives = 140/343 (40.82%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADC-PPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICH-SKTNQHCLEIKKENKKQNSKIEIKTDNSEIH-QMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIR 1197
            +EW+ CS+ C  G +T+   C++       E    ++C      K +RP  L +C Q+      W+   W  C   C   G+Q+R V C    + G F      +CD   +P     C    C  P     +W KCS +  C   I+RR+  C  +   G++       C  +  +PP     C  +  N+H    K   K+    + +K     I+ Q R  KRL   +G  AY+L  T + I CP+    +++I+W+      +    + + + + + G L +      D GE+ C A + +    L L     G DN L  H       L +E N S  R
Sbjct:  711 SEWSQCSESCGVGLQTRRVRCVRSVGSNLTESVELSEC------KGSRPPELQACNQHHCPP-AWEAEEWQQCSHACV-RGTQWRKVYCRQRLAGGSFRKLPDEECD-GVKPATQRPCTDPLCLQPHLDGGEWSKCSVT--CGKGIQRREPVCRRLSVSGQLVTLDRSACNGL--QPPPLIRSCRMTPCNKH----KYSKKRCPQVLGLK----RIYIQTRQEKRLSFTIGGRAYLLPKTSVVIKCPVRHFPKAQIRWEKDGQDLQ----NSKHLSITKSGALRLYSLETRDIGEYRCWANQASDIFILKL----IGHDNRLLEHPEGKS--LGKERNNSGSR 1022          

HSP 2 Score: 56.225 bits (134), Expect = 1.154e-7
Identity = 53/205 (25.85%), Postives = 91/205 (44.39%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLK-RTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFV-----------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            LS DF++ L +  +V   T+   + +    + W  T+ + PCS  C  G +  +  C++ R N    ++   +  + +K   K + C +  C ++     V           W+   W+SC  +CGG GSQ R V C+    +GQ +  +  KC     P     C   DC PK++  +W +C+ +  C   +R R V C+   G
Sbjct:  313 LSSDFIIKLKY--AVPKDTVMQFMFYQPIRYQWRETD-FFPCSVTCGGGYQLNSADCVEIRYNKTVPDHHCHSYPENNKPKPKLKECNMDPCLESDGFKEVMPYDHFQPLPRWEQNPWTSCSVSCGG-GSQQRSVVCVEEDMQGQVVQVEEWKCTHSPRPITEQPCNTFDC-PKWVAMEWSQCTVT--CGRGLRYRVVLCIDHNG 510          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 74.3294 bits (181), Expect = 3.134e-13
Identity = 54/175 (30.86%), Postives = 79/175 (45.14%), Query Frame = 1
Query:  112 VSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP-CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            V +IT + +L     T+ W   N W+ C+K C  G +   + C ++++ R     + N C+++K PK  R  C +  C Q      VW V  W  C K CG  G Q R V C+     G      +  C  K  P    +CG   CP ++ T  W +CS S  C   I++R V C
Sbjct:  823 VPIITNNNVLLAELDTYEWALKN-WSQCTKPCGGGVQYTKYGCRRKSDSR---LVHRNFCEVNKKPKPIRKRCNINECSQP-----VWVVEEWGPCSKTCGSQGYQTRVVQCVQPLQNGTNRPIHIKYCSGK-RPETRRTCGPNTCPAQWRTGAWSQCSVS--CGDGIQQRQVVC 985          

HSP 2 Score: 55.8398 bits (133), Expect = 1.353e-7
Identity = 61/254 (24.02%), Postives = 104/254 (40.94%), Query Frame = 1
Query: 1177 SNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNN---RTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSL---------FNHFCCAFCNKQ--FS*TPPFM 1890
            +N      ++  W   +WS C+  C G  +   Y  R+ +  ++  + +  +  K  P  K   I +C      P W+VE+     CS  C + G        V    N   R +    C S K P    TC  + C   +  G WSQCS+SC +     I+ R + C  + ++  +   C+ ++    S+   C++P C   C  +++ CV      C+  +         +N  CC  CNK+  F+  PP +
Sbjct:  829 NNVLLAELDTYEWALKNWSQCTKPCGGGVQYTKYGCRRKSDSRLVHRNFCEVNKKPKPIRKRCNINECSQ----PVWVVEEWG--PCSKTCGSQGYQTRVVQCVQPLQNGTNRPIHIKYC-SGKRPETRRTCGPNTCPAQWRTGAWSQCSVSCGD----GIQQRQVVC--RASDSSSVAKCEGEKPECVSI---CKMPSCPGLCFYISAPCVGDKSIFCQMEVLARYCSIPGYNKLCCESCNKKLDFTTAPPGL 1066          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts14 (ADAM metallopeptidase with thrombospondin type 1 motif, 14 [Source:ZFIN;Acc:ZDB-GENE-130530-852])

HSP 1 Score: 73.9442 bits (180), Expect = 3.613e-13
Identity = 54/175 (30.86%), Postives = 79/175 (45.14%), Query Frame = 1
Query:  112 VSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP-CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            V +IT + +L     T+ W   N W+ C+K C  G +   + C ++++ R     + N C+++K PK  R  C +  C Q      VW V  W  C K CG  G Q R V C+     G      +  C  K  P    +CG   CP ++ T  W +CS S  C   I++R V C
Sbjct:  817 VPIITNNNVLLAELDTYEWALKN-WSQCTKPCGGGVQYTKYGCRRKSDSR---LVHRNFCEVNKKPKPIRKRCNINECSQP-----VWVVEEWGPCSKTCGSQGYQTRVVQCVQPLQNGTNRPIHIKYCSGK-RPETRRTCGPNTCPAQWRTGAWSQCSVS--CGDGIQQRQVVC 979          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037051.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000074.1:160336:466926:1 gene:ENSAMXG00000043174.1 transcript:ENSAMXT00000037051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 7.992e-13
Identity = 48/152 (31.58%), Postives = 66/152 (43.42%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVT 639
            WTPCSK C  G +T  + C K    R    +  +K +  K P   R C+L  C Q      +W  G W  C K+CG  G+Q R V C+     G+F S +   C  +  P     C    CP ++    W +CS +  C    + R V C T
Sbjct:  848 WTPCSKTCGGGTQTTRYGCRKNAEMRMVHRSFCDKIR--KPPDFYRDCYLRECVQP-----IWVAGEWGECSKSCGRSGTQTRSVRCVQPLGDGKFKSVRSRYCSDE-RPESRRDCNRMLCPAEWKLGPWSQCSVT--CGNGTQERPVLCHT 989          

HSP 2 Score: 55.4546 bits (132), Expect = 2.011e-7
Identity = 65/246 (26.42%), Postives = 101/246 (41.06%), Query Frame = 1
Query: 1165 LNEESNFSFIRPESII---WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPL-KPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNN---RTVDSSLC-DSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRV-----PKCILGCKDLTSACVKQSKYR-CRSSLFNHFCCAFCN 1860
            L++ +N + + P++ +   W+   W+PCS TC G     G QT +  C K      +++   FC  + KP    +      C + I    +  +CS  C   G    S   V    +   ++V S  C D +      C    C   +  GPWSQCS++C N T    + R + C   HT      LC L   P  +  +PCR+     P+C     D +  C  +  Y+ C    F   CC  C+
Sbjct:  824 LSDGANENNMVPDNAVPYSWVLKRWTPCSKTCGG-----GTQTTRYGCRK--NAEMRMVHRSFCDKIRKPPDFYRDCYLRECVQPIWVAGEWGECSKSCGRSGTQTRSVRCVQPLGDGKFKSVRSRYCSDERPESRRDCNRMLCPAEWKLGPWSQCSVTCGNGT----QERPVLC---HTRDNTIGLC-LDSKP--AALRPCRMDPCPRPRC---NTDRSVFCKMEVLYQYCSLPSFQRICCKSCS 1049          
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Match: adamts6 (ADAM metallopeptidase with thrombospondin type 1 motif 6 [Source:NCBI gene;Acc:103021549])

HSP 1 Score: 70.8626 bits (172), Expect = 3.123e-12
Identity = 53/175 (30.29%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMD-KYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERP 705
            W+ CS  C  G + Q  VC +  +    +   ++ C +D K P+  RPC    CP        W +G+W  C K C G G + R V CI  T   +  + + S C T   P    SC +  CPP+++T  W +C+    C P  + R+V C   K     K   P +C   N+ P
Sbjct:  851 WSECSSTCAGGSQKQEVVCKRLDDNSVVQ---NSYCDLDIKPPENQRPCNTEPCPPE------WFIGDWLDCSKTCDG-GMRTRTVLCIRKTGPAEEENLEDSHCLTH-RPIERESCNNQSCPPQWVTLDWSECTPK--CGPGFKHRNVLC---KSSDLTKTFPPALCSDHNKPP 1009          

HSP 2 Score: 58.151 bits (139), Expect = 2.978e-8
Identity = 47/164 (28.66%), Postives = 71/164 (43.29%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSK------CDTKFEPPRFISCGHADC-PPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
             +W  CSK CD G  T+  +C+++T     E    + C +   P +   C   SCP        W   +WS C   C G G + R+V C          SS L+K      C    +PP  I C    C PP+++  +W +C  S+ C    + R V+C++  G
Sbjct:  908 GDWLDCSKTCDGGMRTRTVLCIRKTGPAEEENLEDSHC-LTHRPIERESCNNQSCPPQ------WVTLDWSECTPKC-GPGFKHRNVLC---------KSSDLTKTFPPALCSDHNKPPVRIRCSLGRCPPPRWIPGEWGQC--SAQCGLGQQMRTVQCLSYTG 1052          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: adamtsl3 (ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8])

HSP 1 Score: 68.5514 bits (166), Expect = 4.352e-12
Identity = 69/313 (22.04%), Postives = 113/313 (36.10%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMD---KYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKC-DTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHL 1101
            T+EW  CS  C  G   ++  C  RT  R  + +   +   D     P    PC    CP        W   +W  C + CG  G Q R + C  + + G         C D++    +    G ++CP +++ S+W + +         + RDV C          + +   C  +  +P +S        N      +K     N   +I               L   VG TAY+   + + + CP+     S+++W+    +        +R  V R G L IR     D G + C AG+     T+ L
Sbjct:  680 TSEWGACSASCGAGLRARSVGC-ARTVAREADGSEERQRATDCTGPRPPDVEPCARSDCPP------AWHARDWQPCSRTCGSSGVQSRSLRCRRLLADGSSRDVDEQLCPDSRPLAQQACGGGQSECPAEWVASEWGQINTHQG--NYTQHRDVSCQFSTAAEATSVANASQCSSL-PKPLASRACTLPPCN------RKGGSSANGGPQILGVRRIYIPSPWENLLAFPVGGTAYLFPKSMVVLKCPVARFQHSRVRWEKDGRSL----AESDRHSVTRWGCLKIRCLQPDDIGVYTCVAGQARESFTIKL 972          

HSP 2 Score: 62.003 bits (149), Expect = 3.948e-10
Identity = 56/203 (27.59%), Postives = 83/203 (40.89%), Query Frame = 1
Query:  178 NEWTPCSKICDKGEETQNFVCLKRTNY-RTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTG---------------------TFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFI-SCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC---VTIKGDGKVKIQSPGVCYRMNERPP 708
            + W+PCS+ C  G  T+   C     + R+       +C+ ++ P   RPC LG C + + G                      F W+ G +S C  +C G G++   V C+   +K    +   S CD    PP+    C    CP ++ TS+W  CS S  C   +R R V C   V  + DG  + Q    C     RPP
Sbjct:  534 DAWSPCSRSCGPGVRTRAVRCRVLLPFSRSVVELPDGECEGER-PASERPCALGPCVEAADGLLTDEEAQALEERGQGGDEALAFDWEYGGFSHCSVSCAG-GNREAIVICV---NKETGEAEDESLCDADARPPQIQRPCHTLPCPSRWETSEWGACSAS--CGAGLRARSVGCARTVAREADGSEERQRATDC--TGPRPP 727          

HSP 3 Score: 60.077 bits (144), Expect = 1.529e-9
Identity = 56/225 (24.89%), Postives = 90/225 (40.00%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFC-PPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTV-DSSLCDSQKLPNIT--CLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNL-CQLQQLPHRSLTKPCRVPKCILG--CKDLTSAC-VKQSKYRCRSSLFNHFCCAFCNK 1863
            W+   WS CS  C      AG + R V C          + D  C    +P   + CK    CP+W V      +C+  CV +G+      ++C  +N T      C S+  P     C  + C + +  GPW+ C+ SC        ++R ++C    T +PA +  C  Q  P  +  + C +  C     C+D +  C + Q    C+   +   CC  C +
Sbjct: 1570 WVTGPWSDCSEAC-----GAGVRVRSVVCRSPAGA--TALPDYSCRGAERPARAEPCKRHG-CPEWAV--GAWAECTGRCVGLGIGTQHRRVLCFLHNGTAAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTH---GFQARRVECAHVRTARPAPDAHCAWQHKP--ATWQRCNITPCATTSECRDSSRYCEMVQKLNLCQLPTYRLRCCQACRE 1779          

HSP 4 Score: 57.3806 bits (137), Expect = 9.775e-9
Identity = 50/205 (24.39%), Postives = 82/205 (40.00%), Query Frame = 1
Query:   79 DFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPK-KTRPCFLGSCPQNSTGTFV--------------WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            DF +    ++S   + L   L +      W  T+ + PCS  C  G +  +  C+   N R       N    +K PK + R C +  CP +     +              W+   W++C  +CGG G Q R V+C+    +G     +  KC     P     C   DC PK++  +W  C+ +  C   ++ R V C+  +G
Sbjct:  276 DFTIKARHVSSAETVVL--FLFYQPIPHQWRETD-FFPCSSSCGGGYQLTSAECVDMRNARIASDHFCNYYPENKKPKPRLRECSMEPCPSSDGFKQIMSYDHYQPLPRPCRWEGSPWTACSSSCGG-GVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQPCNLYDC-PKWMAQEWSSCTVT--CGRGLKYRVVLCIDHRG 473          

HSP 5 Score: 53.5286 bits (127), Expect = 1.704e-7
Identity = 57/208 (27.40%), Postives = 76/208 (36.54%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEP--------------PRFISCGHADCP-----------------PKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSP-GVCYRMNERPPS 711
            WT CS  C  G ++++  C++       E     KC     P  T+PC L  CP+       W    WSSC   C G G ++R V C  I  +GQ        C+TK +P              PR      A  P                   F    W  CS S  C P +R R V+C  +    +  ++ P G C    ERP S
Sbjct:  390 WTACSSSCGGGVQSRSVSCVEEDQQGHLEPVEEWKCMYVLRPAVTQPCNLYDCPK-------WMAQEWSSCTVTC-GRGLKYRVVLC--IDHRGQHTGG----CNTKIKPHVKEECLVTTPCYKPREKLPVEAKVPWFKQAQELIEGPAVSEEAAFAPDAWSPCSRS--CGPGVRTRAVRCRVLLPFSRSVVELPDGECE--GERPAS 579          

HSP 6 Score: 51.9878 bits (123), Expect = 5.234e-7
Identity = 40/163 (24.54%), Postives = 64/163 (39.26%), Query Frame = 1
Query:  166 WNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTY-EYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCG--GDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIK 645
            W  T  W+ CS+ C  G   ++ VC          +Y+    C+  + P +  PC    CP+       W VG W+ C   C   G G+Q R V C +        ++    C +K  P    +C    C  ++ T  W  C+ S       + R V+C  ++
Sbjct: 1569 WWVTGPWSDCSEACGAGVRVRSVVCRSPAGATALPDYS----CRGAERPARAEPCKRHGCPE-------WAVGAWAECTGRCVGLGIGTQHRRVLCFLHNGT----AAPEGDCASKARPGSVQNCSVEACAVQWRTGPWAVCTASCGTH-GFQARRVECAHVR 1715          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009057.1 (pep scaffold:Pmarinus_7.0:GL480935:1501:23785:-1 gene:ENSPMAG00000008191.1 transcript:ENSPMAT00000009057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.435e-10
Identity = 47/163 (28.83%), Postives = 71/163 (43.56%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISC---GHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDG 654
            T  W PCS+ CD G   +  V  +  +         ++C  +  P + RPC      Q      +W  G WS+C ++CGG G + R V C   + +GQ L    ++CD    PP   +C   G    P  +  S W  C  S+ C    + R+V+C+   G G
Sbjct:  195 TGLWGPCSQTCDDGGVQRRLVVCQDPDGEP-----GDRCDQNSRPPEMRPC------QQQQLCALWNFGTWSACSRSCGGSGVRTRLVLC--QSPEGQPLPE--TRCDAATRPPAADACPDEGPCVSPGVWHRSSWSPC--STTCGRGTQYREVRCLADGGRG 340          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008623.1 (pep scaffold:Pmarinus_7.0:GL476601:130594:138220:-1 gene:ENSPMAG00000007813.1 transcript:ENSPMAT00000008623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.923e-9
Identity = 48/165 (29.09%), Postives = 73/165 (44.24%), Query Frame = 1
Query:  145 FGTSTFMWNPTNEWTPCSKICDKGEETQNFVCL-KRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
             G     W  T+    CS  C +G ++++ VCL    N    E  +S++      P + + C  GSC   +     W  G W  C   CG +G+Q RDV C+  T+ G F ++    C    EP     C    C  ++ T+ W  CS+S  C    R R+V+C+
Sbjct:   43 MGACAKSWFLTDWSERCSADCGEGVQSRSVVCLMNHVNSLPLEGCSSDQ------PPERQACNYGSCETKAE----WFTGPWGQCSVGCG-NGTQSRDVICVQRTN-GSFSATDRDACAGLAEPASQQPCHLRACGARWYTTAWSACSKS--CETGFRVREVRCL 193          

HSP 2 Score: 46.595 bits (109), Expect = 8.510e-6
Identity = 33/127 (25.98%), Postives = 56/127 (44.09%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPK 555
            T  W  CS  C  G ++++ +C++RTN  ++   + + C     P   +PC L +C         W    WS+C K+C   G + R+V C+  +       +  S CD + +P     C    C P+
Sbjct:  111 TGPWGQCSVGCGNGTQSRDVICVQRTNG-SFSATDRDACAGLAEPASQQPCHLRACGAR------WYTTAWSACSKSC-ETGFRVREVRCLDDS------IAPSSSCDAELKPSNREDCNTQACIPE 223          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:HGNC Symbol;Acc:HGNC:223])

HSP 1 Score: 59.6918 bits (143), Expect = 2.059e-9
Identity = 50/185 (27.03%), Postives = 73/185 (39.46%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTK-FEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVT---IKGDGKVKIQSPGVCYRM-NERPPSSWMI 723
            W+ CS  C  G   +   C              + C   K P+  R C +  C        VW VGNWS C + CG  G + R V C+     GQ L  +   C ++ + PP  ++C    C P++ T  W +CS   +C    + R V C        DG    + P +  R  N +P   W +
Sbjct: 1153 WSECSVSCGLGAMWRAVRC---------SSGRLDDCDAAKRPEPARRCHVRPC-------AVWSVGNWSQCSEECGDGGVKTRVVQCVDAHKPGQAL--RPFHCHSRGYTPPTSLACNSYPC-PEWSTGNWSQCSR--ECGGGWQHRSVTCPPGHRCNDDGDGSPKPPPIALRPCNPQPCLEWTV 1316          
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Match: ADAMTS7 (ADAM metallopeptidase with thrombospondin type 1 motif 7 [Source:HGNC Symbol;Acc:HGNC:223])

HSP 1 Score: 58.5362 bits (140), Expect = 4.477e-9
Identity = 50/185 (27.03%), Postives = 73/185 (39.46%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTK-FEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVT---IKGDGKVKIQSPGVCYRM-NERPPSSWMI 723
            W+ CS  C  G   +   C              + C   K P+  R C +  C        VW VGNWS C + CG  G + R V C+     GQ L  +   C ++ + PP  ++C    C P++ T  W +CS   +C    + R V C        DG    + P +  R  N +P   W +
Sbjct: 1185 WSECSVSCGLGAMWRAVRC---------SSGRLDDCDAAKRPEPARRCHVRPC-------AVWSVGNWSQCSEECGDGGVKTRVVQCVDAHKPGQAL--RPFHCHSRGYTPPTSLACNSYPC-PEWSTGNWSQCSR--ECGGGWQHRSVTCPPGHRCNDDGDGSPKPPPIALRPCNPQPCLEWTV 1348          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO44376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW19])

HSP 1 Score: 71.2478 bits (173), Expect = 9.473e-13
Identity = 54/165 (32.73%), Postives = 73/165 (44.24%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQ 669
            T+ W  CS  C KG   +   C +  N RT     SN C  D  P  T  C   +CP        W +G+WS C   CGG G Q R ++C          SS L+KCD + +P     C    CP  +    W KCS S  C    RRR+V C+   G+  ++++
Sbjct: 1036 TSAWGACSVTCGKGIRRRPVTCTR--NGRT-----SNACVQDSRPADTEVCTNAACP-------TWIMGSWSKCSLTCGG-GVQTRRIDC----------SSSLTKCDHRKKPVESRRCNTEACPATWREGPWSKCSVS--CGRGQRRRNVYCLPEGGNCDLRVK 1173          

HSP 2 Score: 58.5362 bits (140), Expect = 8.827e-9
Identity = 55/192 (28.65%), Postives = 77/192 (40.10%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCP-PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNIT--CLNDKC--------QISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLP---HRSLTKPC 1746
            W  +DW   S  C   S  +G Q+R V C         I  D  CP   KP   ++C   + CP W  E  +   CS   V+ GV   + ++ C++N  ++  + CD    P++T  C    C        +  +  GPWSQCS SC +      R R + C        A  LC     P    R   KPC
Sbjct:  771 WRAADWEQASNLCSA-SCGSGMQSRVVQCSVGSV----IHPDSACPRAAKPTGTQRCNQ-QPCPAW--ETRNWSGCS---VSCGVGEKTRSVTCRYNGTSISPTRCDRALRPSLTERCTQPPCPTQAFIYPETKWKAGPWSQCSQSCGDQGR---RMRRVTCADSRGVAVAERLCDAPNRPATYERCNVKPC 948          

HSP 3 Score: 58.5362 bits (140), Expect = 9.450e-9
Identity = 43/154 (27.92%), Postives = 61/154 (39.61%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
            + EW  CS  C  G   ++ VC           +   KC   + P  +  C +G C         WQ G WS C   CG  G+Q R V C              S CD + +P     CG +   PK++   W +CS +  C   I  R+V+C+
Sbjct: 1240 SQEWGECSVTCGVGRRLRSVVC-----------SIHGKCDKQRQPSSSTLCNMGPC-------ATWQTGTWSQCSVTCG-KGTQVRTVTCS---------DKDTSACDLRTKPQSSTVCGTSQECPKWIIGNWSQCSRT--CGIGITSREVQCI 1363          

HSP 4 Score: 53.9138 bits (128), Expect = 2.339e-7
Identity = 47/159 (29.56%), Postives = 68/159 (42.77%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFV-----WQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCV 636
            T  W+ CS  C  GE+T++  C  R N  +    +  +C     P  T  C    CP   T  F+     W+ G WS C ++CG  G + R V C    S+G  ++ +L  CD    P  +  C    C   +    W  CS+S  C   ++ R VKC 
Sbjct:  832 TRNWSGCSVSCGVGEKTRSVTC--RYNGTSI---SPTRCDRALRPSLTERCTQPPCP---TQAFIYPETKWKAGPWSQCSQSCGDQGRRMRRVTC--ADSRGVAVAERL--CDAPNRPATYERCNVKPC-TSWKHGAWGLCSKS--CGKGVQSRIVKCA 975          

HSP 5 Score: 51.6026 bits (122), Expect = 1.239e-6
Identity = 42/150 (28.00%), Postives = 61/150 (40.67%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKC 633
            W+ CS  C +G+  +N  CL               C +   P + +PC   +CP+       W VG WS C   C G+G   R V C          S+  ++C    +P     C   DC P +L+ +W +CS +  C    R R V C
Sbjct: 1143 WSKCSVSCGRGQRRRNVYCL----------PEGGNCDLRVKPSEIQPCAKKACPE-------WTVGRWSECSVTC-GEGVVRRVVTC----------SAGGNRCQDDTKPEVVKLCELPDC-PSWLSQEWGECSVT--CGVGRRLRSVVC 1261          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM43])

HSP 1 Score: 65.4698 bits (158), Expect = 5.289e-11
Identity = 67/274 (24.45%), Postives = 106/274 (38.69%), Query Frame = 1
Query:  166 WNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT---RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYR-MNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHG 975
            W+ T  W PCSK C KG + ++ VC ++    TYE     +C+ D  P+ +   RPC    CP        W   +WS C   CG DG   R ++C  +   G             +EP   I C HA  P     S    C++  +C  ++         I  +GK  +  P  CYR  +       M+ + +      EIKK  +    K++ K     +  ++   +L + +      L   RL  F    ++    I     NN + + G
Sbjct:  855 WHETG-WRPCSKTCGKGSQQRHVVCRRKVAIATYETRPDEECKEDDKPQLSQLMRPCNELDCPAE------WVPSSWSECSATCGPDGVTVRTLSCKRLNQNG------------VYEPVHKIQCKHAVQP-----STQEACNQDVNCPMAL---------IAANGKKFV--PIGCYRDYSGYHAIPRMVANLRNKIDWYEIKKTVENCAEKVQKKNSTYTVFGIQVEYKLGLYLRVMRSQL--KRLRGFADRSVLTSELINTLKSNNLFRFRG 1091          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO33987 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQN5])

HSP 1 Score: 63.1586 bits (152), Expect = 3.023e-10
Identity = 41/178 (23.03%), Postives = 74/178 (41.57%), Query Frame = 1
Query:  193 CSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMIC 726
            CSK C  G +     C++  +       +S  C  D  P    PC   +CP        W++  W  C + CGG G++ R+V C+   ++   ++   S C+   +P    +C   DC P +    W +C+ +   + +  R+ V+C     +G + +     C   + + P  W  C
Sbjct: 1154 CSKTCAGGTQPHKVTCIREDDG---SQISSIHCNQDTRPPGYGPCNTQACPAK------WEIHPWGPCSRRCGG-GNRSREVLCVQQVTQQSNVTVDESFCNATKKPTTSSTCNVVDCGPSWEIGDWSQCTGNPGQQGNTSRK-VECRNRFANGSISVLDDETCLEFSTKIPDRWKSC 1320          

HSP 2 Score: 59.6918 bits (143), Expect = 3.926e-9
Identity = 112/481 (23.28%), Postives = 175/481 (36.38%), Query Frame = 1
Query:  277 NSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTI-----KGDGKVKIQSPGV----CYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHT----KRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPE--SIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTC--EKIEAQYYKII--EDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVC-----QFNNRTVDSSLCDSQKLPNI--TCLNDKCQISYNYGPWSQCSLSCSNTTNAS 1641
            +S  C  D  P    PC   +CP        W++  W  C + CGG G++ R+V C+   ++   ++   S C+   +P    +C   DC P +    W + +      P + R     + I     +    V   +P +    CY +   P +S+++ H+     C  I                    + +RHT         L+  T YV+  T        P +   K+     ++     G     +RV   G +   E  +I+  E +   G   A+  L                AN  Y +    + ++  +P   S+IW       CS TC G     G Q  KVTC  E   +Q   I   +D   P   P   + C +     KW  E +    CS  C   G    S  ++C     Q +N TVD S C++ K P    TC    C  S+  G WSQC+ +     N S
Sbjct:  873 SSIHCNQDTRPPGYAPCNTQACPAK------WEIHPWGPCSRRCGG-GNRSREVLCVQQFTQQSIVTVDESFCNATKKPTTSSTCNMVDCGPSWEIGDWSQAAMP--VTPYLLRHTCYAIPITLYLLRHTYYVMPVTPYLLRHTCYVI---PVTSYLLRHA-----CYAIPVTP----------------YLLRHTCYVMPVTPYLLRHTCYVMPVT--------PYLLHLKLASAAASDDPFVFGEFPLTLRVKVAGTIASYENPVINYAEKMFIQGPTNAELVLLF---------IYANEANVGYTI----TYYAPGQPNVTSLIWKNVKSGICSKTCAG-----GTQPHKVTCIREDDGSQISSIHCNQDTRPPGYGPCNTQACPA-----KW--EIHPWGPCSRRC---GGGNRSREVLCVQQVTQQSNVTVDESFCNATKKPTTSSTCNVVDCGPSWEIGDWSQCTGNPGQQGNTS 1284          

HSP 3 Score: 52.373 bits (124), Expect = 6.156e-7
Identity = 35/131 (26.72%), Postives = 59/131 (45.04%), Query Frame = 1
Query:  184 WTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCD--------TKFEPPRFISCGHADCPP 552
            W PCS+ C  G  ++  +C+++   ++    + + C   K P  +  C +  C  +      W++G+WS C  N G  G+  R V C     + +F +  +S  D        TK  P R+ SC  A+ PP
Sbjct: 1209 WGPCSRRCGGGNRSREVLCVQQVTQQSNVTVDESFCNATKKPTTSSTCNVVDCGPS------WEIGDWSQCTGNPGQQGNTSRKVEC-----RNRFANGSISVLDDETCLEFSTKI-PDRWKSCLIAETPP 1327          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO36363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU7])

HSP 1 Score: 62.3882 bits (150), Expect = 4.127e-10
Identity = 63/252 (25.00%), Postives = 100/252 (39.68%), Query Frame = 1
Query:  127 LSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKC-DTKFEPPRFIS----CGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNE---RPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILV 858
            +SG+L    S + W  +N WT CS  C  GE ++   C++  +     +A+ + C     P     C   +CP        W V  W +C K C G GSQ R V C   T+     +     C D+    P        C    CPP+++   W +CS +  C   +  R ++C  ++  G   + SP +     +   +PP+S   C+S      L    EN   N+   I     +  Q+ H +  K   
Sbjct:  389 VSGVLGSNVS-YQWATSN-WTSCSTTCAGGERSRVLYCVRSDD---NTFASHSACDAALRPASVEACNTQTCPPE------WHVTEWDTCSKTC-GRGSQSRAVFCRKKTTSSSHETIDDQICLDSGLTRPNVTEVSRYCNEIPCPPEWVPLAWSECSTT--CSTGVTTRQLECRRLEASG---VMSPPILPENCDHAIKPPTS-EPCNSDNPCTLLADLTENLDLNNTAAIV---QQCTQLAHAQGFKYFA 619          
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Match: EDO45205 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF7])

HSP 1 Score: 62.7734 bits (151), Expect = 4.242e-10
Identity = 50/188 (26.60%), Postives = 78/188 (41.49%), Query Frame = 1
Query:  151 TSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQM-DKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPS 711
            T   +W   + W+ CSK C  G + +   C  R + +TY       CQ  +K P + RPC  G C         W +  W  C K CG  G+Q R + C     +G++      +C  +        C    C P++    W KCS++  C      R++ C  +  +G+    +P  C R   RPP+
Sbjct:  830 TPDQVWWKVSTWSACSKNCAGGLQNRTVEC-NRADDKTY--VRDEICQKKEKTPDRIRPCNTGPCSPE------WHLSQWRPCSKTCG-KGTQIRILQCRRQIFEGRYEEMPGWRCGKRHSELLKRDCNKRGCLPEWNPLSWGKCSKT--CAGGFVTRELSCNQLNAEGRYIPVTPNRC-RDAVRPPT 1004          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts14 (A disintegrin and metalloproteinase with thrombospondin motifs 14 [Source:NCBI gene;Acc:101172200])

HSP 1 Score: 68.5514 bits (166), Expect = 2.058e-11
Identity = 55/191 (28.80%), Postives = 85/191 (44.50%), Query Frame = 1
Query:   70 LSWDFMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRP-CFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVT 639
            L++ +++  + L    +IT + +L     T+ W     W+ CSK C  G +   + C ++++ R     + N C+  K PK  R  C +  C Q       W + +WS C K+CG  G Q R V C+     G         C T     R + C H  CP ++ T  W +CS S  C   I++R V C T
Sbjct:  813 LTYKYIIHEDLLP---LITNNNVLLSELDTYEW-ALKSWSQCSKPCGGGIQYTKYGCRRKSDGR---LVHRNFCESSKKPKPIRKRCNMLECSQPK-----WVMEDWSPCSKSCGKLGYQTRVVQCMQALHNGTSRPIHSKHCPTNRPETRRV-CNHTACPAQWRTGAWSQCSVS--CGEGIQQRQVVCKT 988          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:NCBI gene;Acc:101162868])

HSP 1 Score: 67.781 bits (164), Expect = 3.254e-11
Identity = 50/174 (28.74%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  193 CSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKK-TRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPS 711
            C+  C  G  + N  C K    +     N++ C     P     PC    CP +      W VG W  C ++CGG G Q R V C+  T++    +   S C  +  P R  +C    CPP + T  W +CS    C   +++R V CV+ K D + +      C  + ++PPS
Sbjct:  967 CTVTCAGGRMSTNASCYKDMRVQV----NTSYCNPKMKPATGVMPCNTQPCPHS------WSVGEWGVCSRSCGG-GEQTRQVQCVQRTNQNNVDARADSGC-AQPAPVRRQTCNTHSCPPVWSTGPWSQCSHK--CGNGLKKRTVLCVSPKADAQTRTLPDSKCAGL-QKPPS 1125          

HSP 2 Score: 62.7734 bits (151), Expect = 1.059e-9
Identity = 48/167 (28.74%), Postives = 70/167 (41.92%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP----KFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVK 663
              EW  CS+ C  GE+T+   C++RTN    +    + C     P + + C   SCP       VW  G WS C   C G+G + R V C+   +  Q  +   SKC    +PP    C    C      ++  S W +C  S+ C    + R +KC      GK +
Sbjct: 1019 VGEWGVCSRSCGGGEQTRQVQCVQRTNQNNVDARADSGCAQPA-PVRRQTCNTHSCPP------VWSTGPWSQCSHKC-GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQEC--SAKCGQGYQARFIKCAEKDTAGKYR 1175          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts16 (ADAM metallopeptidase with thrombospondin type 1 motif 16 [Source:NCBI gene;Acc:101162868])

HSP 1 Score: 67.3958 bits (163), Expect = 3.713e-11
Identity = 50/174 (28.74%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  193 CSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKK-TRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPS 711
            C+  C  G  + N  C K    +     N++ C     P     PC    CP +      W VG W  C ++CGG G Q R V C+  T++    +   S C  +  P R  +C    CPP + T  W +CS    C   +++R V CV+ K D + +      C  + ++PPS
Sbjct:  943 CTVTCAGGRMSTNASCYKDMRVQV----NTSYCNPKMKPATGVMPCNTQPCPHS------WSVGEWGVCSRSCGG-GEQTRQVQCVQRTNQNNVDARADSGC-AQPAPVRRQTCNTHSCPPVWSTGPWSQCSHK--CGNGLKKRTVLCVSPKADAQTRTLPDSKCAGL-QKPPS 1101          

HSP 2 Score: 62.7734 bits (151), Expect = 1.091e-9
Identity = 48/167 (28.74%), Postives = 70/167 (41.92%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP----KFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVK 663
              EW  CS+ C  GE+T+   C++RTN    +    + C     P + + C   SCP       VW  G WS C   C G+G + R V C+   +  Q  +   SKC    +PP    C    C      ++  S W +C  S+ C    + R +KC      GK +
Sbjct:  995 VGEWGVCSRSCGGGEQTRQVQCVQRTNQNNVDARADSGCAQPA-PVRRQTCNTHSCPP------VWSTGPWSQCSHKC-GNGLKKRTVLCVSPKADAQTRTLPDSKCAGLQKPPSQEPCFIKRCQKQRKVQWFVSTWQEC--SAKCGQGYQARFIKCAEKDTAGKYR 1151          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts9 (ADAM metallopeptidase with thrombospondin type 1 motif 9 [Source:NCBI gene;Acc:101171570])

HSP 1 Score: 64.6994 bits (156), Expect = 2.718e-10
Identity = 55/182 (30.22%), Postives = 83/182 (45.60%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQ-MDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFL--TSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNE-RPP 708
            T+ W+ CS  C +G +++   C+  +     E      CQ +   P K R C  G CP+       W+ G+W  C  +CG DG Q R+V+C     +    S   + C  +  PP   SC  ADCP ++     +W  CS+S  C    R+R ++CV +      +I      Y +NE RPP
Sbjct: 1449 TDPWSSCSASCGRGFKSRKVSCVTGSGRAVPE----ENCQHLSPKPSKQRRCRGGRCPK-------WKTGSWGECSASCG-DGVQQREVSCHDEGHR----SPLETGCTQRSRPPSSQSCRVADCPSRYRWKEGEWQTCSKS--CGTGRRQRSLQCVDLNQQEVHEI------YCVNEIRPP 1606          

HSP 2 Score: 60.4622 bits (145), Expect = 5.924e-9
Identity = 52/160 (32.50%), Postives = 66/160 (41.25%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCP--PKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKG 648
            T  W  CS  C  G + +  VC     Y       +N C+    P + R C  G CPQ       W  G+W  C K CGG G + R V C     + +F  + LS C+   +PP    C    CP  P + T  W  CS S  C    + R V CVT  G
Sbjct: 1336 TGPWGACSSTCAGGFQRRVVVCQDENGY------PANSCEDSSRPNEQRSCESGPCPQ-------WAYGSWGECTKPCGG-GIKTRLVVCQRPNGE-RF--NDLS-CEIHDKPPDQEQCNTQPCPSSPHWSTDPWSSCSAS--CGRGFKSRKVSCVTGSG 1475          

HSP 3 Score: 54.6842 bits (130), Expect = 4.026e-7
Identity = 43/153 (28.10%), Postives = 62/153 (40.52%), Query Frame = 1
Query: 1213 WIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNI-TCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCI 1668
            W  S WS CS +C G +++ G   RK              +D  C     +TI+ C  F  CP+W        + S+  V  G         CQF    +D   C S K  ++  C   +C  S+  GPW QC+ SC        + R +KC+
Sbjct: 1012 WEYSPWSECSKSCGGGTRHRGAICRKAA--------ESGGDDSKCSQRDKLTIQPCNEF-LCPQW-----KTGEWSECLVTCGKGYKHRQAWCQFGEDRLDDRFCGSPKPESVQMCQQQEC-ASWQVGPWGQCTTSC----GPGYQMRAVKCV 1145          

HSP 4 Score: 53.1434 bits (126), Expect = 9.914e-7
Identity = 44/184 (23.91%), Postives = 69/184 (37.50%), Query Frame = 1
Query:  175 TNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMIC 726
            T  W  CS  C  G + +   C    +    E      C     P  ++ C +  CP      + W+ G W +C K+CG  G + R + C+ +  +          C  +  PP   SC    C   ++T +W +CS +  C    R+R V C  +  +      S          PP S+M C
Sbjct: 1506 TGSWGECSASCGDGVQQREVSCHDEGHRSPLETG----CTQRSRPPSSQSCRVADCPSR----YRWKEGEWQTCSKSCG-TGRRQRSLQCVDLNQQ----EVHEIYCVNEIRPPNMESCNTHACELIWITGEWTECSAT--CGRGYRQRLVYCSEVHLENNNYEYSHQSLSNCPGSPPESYMPC 1674          
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Match: adamts18 (ADAM metallopeptidase with thrombospondin type 1 motif 18 [Source:NCBI gene;Acc:101167025])

HSP 1 Score: 62.7734 bits (151), Expect = 1.178e-9
Identity = 43/155 (27.74%), Postives = 70/155 (45.16%), Query Frame = 1
Query:  181 EWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPP----KFLTSKWHKCSESSDCRPSIRRRDVKC 633
            +W PCS+ C  G++T+   CL++  Y+  E    + C     P + +PC   +CP        W  G+WS C K+C G G + R V C       + +    S C     P    +C    CP     +++ + W +CS S  C    +RR+++C
Sbjct:  936 DWGPCSRSCGGGQQTRTLRCLRKVTYQREEVVALSLCPAIS-PAQIQPCNTQACPPE------WSTGSWSQCSKSC-GRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRS--CGSGNQRRELRC 1080          

HSP 2 Score: 59.3066 bits (142), Expect = 1.365e-8
Identity = 51/201 (25.37%), Postives = 81/201 (40.30%), Query Frame = 1
Query: 1060 CKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTC-EKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNR-----TVDSSLCDSQKLPNI--TCLNDKC----QISYNYGPWSQCSLSCSN 1626
            C  GR + KA    +Q +    +    H+    G     S+    +P    W  +DW PCS +C G     G QTR + C  K+  Q  +++    CP + P  I+ C +    P+W        QCS  C   G      ++ C+  +       V  S+C     P    TC+  +C    ++ +   PW +CS SC +
Sbjct:  886 CAGGRISTKAICLQDQKTQVNSSMCNPHSRPTLG-----SHLCNTQPCPAYWAAADWGPCSRSCGG-----GQQTRTLRCLRKVTYQREEVVALSLCPAISPAQIQPCNTQACPPEW--STGSWSQCSKSC---GRGLRKRSVFCRSTDPGIKAVVVPDSMCKQHHRPKAQETCVLRRCPRNEKLQWMLTPWEECSRSCGS 1071          

HSP 3 Score: 53.9138 bits (128), Expect = 6.027e-7
Identity = 45/172 (26.16%), Postives = 70/172 (40.70%), Query Frame = 1
Query:  193 CSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPK-KTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERP 705
            CS  C  G  +   +CL+    +     NS+ C     P   +  C    CP        W   +W  C ++CGG G Q R + C+   +  +     LS C     P +   C    CPP++ T  W +CS+S  C   +R+R V C +     K  +    +C + + RP
Sbjct:  882 CSAPCAGGRISTKAICLQDQKTQV----NSSMCNPHSRPTLGSHLCNTQPCPA------YWAAADWGPCSRSCGG-GQQTRTLRCLRKVTYQREEVVALSLCPA-ISPAQIQPCNTQACPPEWSTGSWSQCSKS--CGRGLRKRSVFCRSTDPGIKAVVVPDSMC-KQHHRP 1038          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000068292.1 (SMESG000068292.1)

HSP 1 Score: 1224.54 bits (3167), Expect = 0.000e+0
Identity = 592/596 (99.33%), Postives = 593/596 (99.50%), Query Frame = 1
Query:   85 MLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNKQFS 1872
            MLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLG CPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCD KFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIG+ARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLT ACVKQSKYRCRSSLFNHFCCAFCNKQFS
Sbjct:    1 MLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGRCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDNKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGLARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTPACVKQSKYRCRSSLFNHFCCAFCNKQFS 596          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000002617.1 (SMESG000002617.1)

HSP 1 Score: 365.155 bits (936), Expect = 1.510e-117
Identity = 207/592 (34.97%), Postives = 317/592 (53.55%), Query Frame = 1
Query:  118 VITLSGLLSFGTST---FMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYP--KKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCR-PSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESN--FSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCP---PLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCN 1860
             + L  LL F   T   F W  +  W+ CSK C  G +     C+++T   TYE  + +KC+  + P  K  + CFLG CP N T  F+W+VG W+SC  +CGG+G + RDV CI+    G ++++K   C +++EP +   CG+ DCPP+F T+ W KC++  +C+ P IRRR + C+    +G  K    G CY +  +PP++W  C            K+ KK+     I     +IH MR +K+LK+ VGQTA+VL  TR+ I CP+       ++W   N TY +   ++ERI V+RKG L+I++F   D G+WICKAG  TA+  +  + PS GF ++L R       ++  ++N    +I+P    W+   WS CS +C       GYQTR V CE IE +Y+  ++   C     +KP  I++C  F++CP W + +  + +C++ C+++G +     + C++ N+ +  + CD    P  TC N  C + +    WS CS SC    N  I++RT+ C W++ N  A +LC   ++    L K C  P C LGC DL+  C    K  C    + HFCC  CN
Sbjct:   11 ALILGSLLGFCGPTRGKFEWQNSQLWSSCSKACGIGVQENLLACVQKTLIGTYEKVSYDKCRRIRKPREKTMKTCFLGVCPTNETSEFIWKVGEWTSCSTSCGGEGVRTRDVQCILSLYSGGYMNAKHYDCKSEYEPVKNEKCGYFDCPPEFFTTSWLKCTKMRNCQSPGIRRRQINCMVTTKNGTSKSVPKGNCY-IRSKPPATWESCFKDPEYQSKCQFKDKKKKRKPPIISISKLKIHHMRSSKKLKLNVGQTAFVLPHTRIEIKCPVINFPSENLQWLKDNITYAFIRRAKERIHVSRKGYLIIKKFSPKDEGKWICKAGTITAEIEILTQNPSDGFSHYLSRIIYFKEDIVEGKNNSAIKYIKPLFYQWVVGPWSICSKSC----GIGGYQTRYVGCELIERRYFIEVDGGKCLKKNSMKPDNIRECVLFQKCPTWWIGEPYSHKCTETCLDVGKSFKDLKLKCKYENKVLLPNNCDLSTQPIETCHNPNCTLFWKTEKWSTCSSSCG---NPGIKARTVSCRWRNDNSQAGSLCSKAKIRMPLLIKKCSAPPCNLGCMDLSKHC--GLKKLCSVDHYQHFCCKTCN 592          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000079770.1 (SMESG000079770.1)

HSP 1 Score: 359.762 bits (922), Expect = 2.199e-114
Identity = 211/604 (34.93%), Postives = 314/604 (51.99%), Query Frame = 1
Query:   70 LSWD-FMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKT-RPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTN-QHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPP---LKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNK 1863
            +SW+ F ++   L S +    + +    T TF W   +EW  CS  C  G   +  +C+K++ Y T E  +   C+       T + C LG+C  N    +VW+ G WS C + CG +G + RDV C+     G  ++S    C+    P    SC   DCP   +  +W KC ++  C    +RR + C++I  +GK K      C     +PP SW  C+   N + CL+    + +    IEIK +   + QMR TK L I VGQ AYV  +TR+ I CP+       I W+HGN  Y YHG S++ IRV++KG L IR+F   D G W C AG   A A + +  P+ GF +W  R    N  MLNE+      R E I WIK  WS CS TC       G+Q+R+V CE+ E Q+Y I++D  C      KP+T + C+   +CPKW +   + + C++ C+ IG  +   N+ C    + +++S CD ++  N+ C N+KCQ+ +    WS+CS SC       I +R + CIWK+T  PA +LC  Q++P   + K CR PKC L C DL ++C   +K +C  S++ + CC  C++
Sbjct:    3 ISWNVFGIVFLVLISETFKVNAKIKESQTQTF-WLEVDEWNSCSTTCGPGTRQKKVICIKKSFY-TEEMVSDELCKTVPVISPTIKECNLGNCYDN----YVWKPGKWSECSQTCGSNGRKTRDVECVYDEGSGNLVNSDSKYCEPSLRPEASSSCNIIDCPLTLVPGEWGKCKKNHKCSAGTQRRPMTCISILKNGKPKSMPRHAC-SSTIKPPVSWRKCYDHMNTKECLK----DLRIPPIIEIKKNT--LVQMRKTKLLNIDVGQLAYVYLYTRIMINCPVTYFVPRDIVWKHGNTIYNYHGKSKDSIRVDKKGRLRIRKFESKDQGTWTCIAGPKNASAIIKVRNPAVGFQDWKLRTTLWNKEMLNEDPEVGMTRNEVIQWIKKGWSQCSVTCGVE----GFQSREVHCEQSEKQHYNILDDSVCEKKGQKKPLTRRTCQMATQCPKWKMTGINPDNCTNKCIRIGFGKIEGNLHCIHQGQIIEASACDKKEKYNMECPNEKCQVGWKTSNWSKCSKSCGGI---GIMARYLICIWKNTEDPAGSLCYSQKIPLPEVIKSCRAPKCNLKCVDLYASCKPHAK-KCIQSIYRYTCCKSCSR 585          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000042318.1 (SMESG000042318.1)

HSP 1 Score: 348.206 bits (892), Expect = 3.992e-111
Identity = 189/587 (32.20%), Postives = 299/587 (50.94%), Query Frame = 1
Query:  118 VITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTN-QHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFCPPLKPI--TIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNKQF 1869
             I  S L  F  + ++W  + EW+PCS  C +G++T+   C  + N    + +     ++       R C+   CP+     + W+  +WS C  +CG  G +FRDV C    S+   +      C    +P +   C   DCPP+F+T KW KC +   C P  ++R + C  I   G++K      CY     PP+ W  C+   N   CL+          K+E    N+  +QMR  K +++ +GQ AY+L ++R+ I CP+    +  I W H N+T++Y+G   +RIRV+R G + IR+    D GEW C A R    A + +  PS+GF +W  R+     GML+E+SN    R E + WI SDWS CS TC G+    G Q R+V CEK+E ++Y +++D  C  + P    ++ C +   CP W VE+ D  +C++ CV+I ++     + C + N+ V   LC+ +K P ITC N+ C + +    WS+CS SC        ++R++ C+WK T K A +LC   + P   + + C    C + C DL++ C  + K RC  +L+ + CC  C   +
Sbjct:   13 AIIQSSLNEFTENIYLWQDSGEWSPCSVTCGEGKQTKEKFCAIKVNSTVIKTSKHRCSRLKASHTLIRFCYQTECPEK----YRWKTSSWSQCSHSCGNLGFRFRDVECSHNISETNSIGVAEFFCAKFIKPMQRSLCNRVDCPPEFVTGKWGKCVKGQGCHPGNQKRKLNCSQILQSGEIKQMPLFRCYTKKRPPPAQWRKCYDFINIPKCLK-----GIPPRKVEFTMSNNNFYQMRRAKIVQLQIGQIAYLLPYSRIIITCPVENFPQHNIIWTHKNDTFKYNGRVSKRIRVDRIGQIRIRKLLFQDQGEWNCIADRSQKSAIIKIRNPSSGFRDWAVRNNLWKTGMLSEDSNKPINRQELVQWITSDWSVCSVTCSGD----GLQYREVHCEKVEPRFYLVLDDNDCEKVTPAPNKMRNCYTAIECPLWKVERIDKSKCTNECVDIRLSSVLVELKCIYMNQDVPLHLCEQKKKPEITCQNEACHLDWRLNSWSKCSKSCD---GVGFQARSIACVWKSTRKSAGSLCYENKFPLPKVVRECETKPCNMKCIDLSTKCSSEPK-RCHQNLYKYLCCYTCQTYY 582          
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Match: SMESG000073134.1 (SMESG000073134.1)

HSP 1 Score: 325.479 bits (833), Expect = 2.488e-102
Identity = 192/601 (31.95%), Postives = 300/601 (49.92%), Query Frame = 1
Query:   82 FMLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNFVCLKRTNYRTYEYANSNKCQ-MDKYPKKTRPCFLGSCPQNSTGTFVWQVGNWSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCGHADCPPKFLTSKWHK-CSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVCYRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRHTKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISRERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWLKRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQTRKVTCEKIEAQYYKIIEDKFC---PPLKPITIKKCKSFERCPKWIVEKNDNEQCSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISYNYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSLTKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNKQF 1869
             +++LNF  ++ +     + +           + W+ CS  C +G + +   C K+T Y   E    +KC+ + K    TR C  G C       +VW+  +WS C   CG +G Q R+V C    S GQ +  ++  CD   +P     C   +CPP FL  +W K C + SDC P  +RRD+ C+++   GKV       CY     PP+SW  C        ++ KK  KK     EI ++   + QMR  ++L + VGQ +YV   TRL++ CP+     S + W H    Y Y G S+ RIRV RKG L+I+ F + D GEW C AG  +    +  + PS G+ +W  R++  N  M NE      ++   + W+  DWS CS +CE    N G+Q+R V CE ++ ++Y  + D  C      KP   ++C     CP+W  +  +  QC+D C+    ART  ++ C F N++V    CDS + P   C N +C++ +    W++CS +C  +    I++R + C+W+++  PA NLC L  L    + K C  PKC L C D+  +C ++ +Y CR  +++  CC  C + F
Sbjct:    8 LIIILNF--AICLFDGQSIGNRPIGKVFLEEIDIWSKCSTTCGEGVQEKFQACFKKTVY-LIENIPMDKCEHIPKIKVTTRVCNYGDCENG----YVWKFTDWSKCSHTCGYEGIQLREVECYH--SSGQVVDQEM--CDENKKPKSLRGCNRYNCPPNFLAKEWKKKCVKISDCSPGQQRRDLSCLSLLNTGKVVDLPRAACYAKGLVPPASWRQCFDH-----IDPKKCFKKSEFLPEIISEKRTLVQMRRVEKLNLQVGQISYVFPGTRLTLNCPVKNFLSSNLIWAHKKIEYFYKGKSKNRIRVTRKGKLIIKSFLIQDQGEWRCLAGNISDSIVIKSKSPSDGYKDWAIRNSISNKDMPNELVQLDMMQENHVRWVIGDWSQCSVSCE----NTGFQSRMVRCESLQKRFYYQLSDDECVQRVAPKPFAKRECPRNFPCPQWNFKNVNLNQCTDHCIGYEKARTIGDLKCIFQNQSVGLEKCDSTRKPVYECYNAECRVEWKISEWTKCSRTCGKS---GIQARYLICVWENSKLPAGNLCYLINLEVPQVLKSCNPPKCNLKCVDMHPSCKRKKEY-CRMGIYSFSCCKTCQEYF 584          
The following BLAST results are available for this feature:
BLAST of Ig-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADAMTSL36.746e-2227.33ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL37.469e-2227.33ADAMTS like 3 [Source:HGNC Symbol;Acc:HGNC:14633][more]
ADAMTSL12.306e-1527.21ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTSL11.756e-1127.95ADAMTS like 1 [Source:HGNC Symbol;Acc:HGNC:14632][more]
ADAMTS106.384e-1129.41ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-41.076e-2822.68pep chromosome:WBcel235:I:8931035:8937718:-1 gene:... [more]
madd-42.950e-2823.35pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
madd-43.910e-2823.35pep chromosome:WBcel235:I:8931035:8942287:-1 gene:... [more]
mig-61.109e-1029.59Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
mig-61.109e-1029.59Papilin [Source:UniProtKB/Swiss-Prot;Acc:O76840][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nolo4.402e-1424.61gene:FBgn0051619 transcript:FBtr0339131[more]
nolo5.458e-1424.61gene:FBgn0051619 transcript:FBtr0085902[more]
nolo5.558e-1424.61gene:FBgn0051619 transcript:FBtr0307497[more]
nolo5.558e-1424.61gene:FBgn0051619 transcript:FBtr0110959[more]
nolo5.647e-1424.61gene:FBgn0051619 transcript:FBtr0301000[more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl34.780e-1626.16ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
adamts189.534e-1330.57ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts142.182e-1228.72ADAM metallopeptidase with thrombospondin type 1 m... [more]
LO018340.11.082e-1032.47ADAMTS-like 4 [Source:NCBI gene;Acc:100333903][more]
ADAMTS71.129e-929.26ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vash12.318e-2427.91vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
vash12.941e-2428.31vasohibin 1 [Source:Xenbase;Acc:XB-GENE-956494][more]
ADAMTSL17.484e-1626.35ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL17.866e-1626.35ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
ADAMTSL18.268e-1626.35ADAMTS like 1 [Source:NCBI gene;Acc:100494603][more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adamtsl31.344e-1925.44ADAMTS-like 3 [Source:MGI Symbol;Acc:MGI:3028499][more]
Adamtsl17.502e-1728.20ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamtsl17.097e-1425.90ADAMTS-like 1 [Source:MGI Symbol;Acc:MGI:1924989][more]
Adamts149.421e-1228.04a disintegrin-like and metallopeptidase (reprolysi... [more]
Adamts149.428e-1228.04a disintegrin-like and metallopeptidase (reprolysi... [more]
back to top
BLAST of Ig-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P90884|MADD4_CAEEL4.974e-2723.35Protein madd-4 OS=Caenorhabditis elegans OX=6239 G... [more]
sp|P82987|ATL3_HUMAN3.240e-2127.33ADAMTS-like protein 3 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8N6G6|ATL1_HUMAN1.108e-1427.21ADAMTS-like protein 1 OS=Homo sapiens OX=9606 GN=A... [more]
sp|Q8BLI0|ATL1_MOUSE4.965e-1325.90ADAMTS-like protein 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9H324|ATS10_HUMAN3.546e-1029.41A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Ig-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZL017.538e-10932.76ADAMTS-like protein 3 OS=Schistosoma haematobium O... [more]
A0A183JCE11.013e-10832.76Ig-like domain-containing protein OS=Schistosoma c... [more]
A0A430QEZ93.646e-10632.48Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A4S2LCE58.573e-10630.58Ig-like domain-containing protein OS=Opisthorchis ... [more]
A0A1S8X1331.390e-10430.25Thrombospondin type 1 domain protein (Fragment) OS... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl32.473e-1425.36ADAMTS-like protein 3 [Source:NCBI gene;Acc:103028... [more]
adamts143.134e-1330.86ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts143.613e-1330.86ADAM metallopeptidase with thrombospondin type 1 m... [more]
ENSAMXT00000037051.17.992e-1331.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
adamts63.123e-1230.29ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamtsl34.352e-1222.04ADAMTS-like 3 [Source:ZFIN;Acc:ZDB-GENE-121030-8][more]
ENSPMAT00000009057.12.435e-1028.83pep scaffold:Pmarinus_7.0:GL480935:1501:23785:-1 g... [more]
ENSPMAT00000008623.11.923e-929.09pep scaffold:Pmarinus_7.0:GL476601:130594:138220:-... [more]
ADAMTS72.059e-927.03ADAM metallopeptidase with thrombospondin type 1 m... [more]
ADAMTS74.477e-927.03ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443769.473e-1332.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352225.289e-1124.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339873.023e-1023.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363634.127e-1025.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452054.242e-1026.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adamts142.058e-1128.80A disintegrin and metalloproteinase with thrombosp... [more]
adamts163.254e-1128.74ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts163.713e-1128.74ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts92.718e-1030.22ADAM metallopeptidase with thrombospondin type 1 m... [more]
adamts181.178e-927.74ADAM metallopeptidase with thrombospondin type 1 m... [more]
back to top
BLAST of Ig-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068292.10.000e+099.33SMESG000068292.1[more]
SMESG000002617.11.510e-11734.97SMESG000002617.1[more]
SMESG000079770.12.199e-11434.93SMESG000079770.1[more]
SMESG000042318.13.992e-11132.20SMESG000042318.1[more]
SMESG000073134.12.488e-10231.95SMESG000073134.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010755 ID=SMED30010755|Name=Ig-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2074bp
GGATGCAATCATTGTCAAATGCAACCACAGAGCATTTCTTTTATCAATTG
AATAAATTAAAACAAAATTTTATCTTGGGATTTCATGTTACTTTTAAATT
TTTTAACTTCGGTATCAGTGATCACTCTTTCGGGATTATTATCATTTGGC
ACGAGTACTTTTATGTGGAACCCCACTAATGAGTGGACACCTTGCTCAAA
AATATGCGATAAAGGGGAGGAAACACAAAATTTTGTTTGTTTGAAAAGGA
CCAATTATCGAACTTATGAATATGCAAATTCCAATAAATGTCAGATGGAC
AAATATCCTAAAAAGACAAGGCCGTGCTTTTTAGGCAGTTGTCCACAAAA
TTCAACTGGTACATTTGTATGGCAAGTTGGTAATTGGAGTTCATGTCAAA
AAAACTGTGGTGGGGATGGCTCACAGTTCAGGGATGTCAATTGTATCATG
ATAACGTCAAAGGGTCAATTTTTATCTAGCAAATTATCAAAATGTGATAC
CAAGTTTGAACCCCCAAGATTTATATCTTGCGGACATGCTGACTGCCCCC
CAAAATTCTTAACCAGCAAGTGGCATAAATGTTCGGAATCATCGGATTGT
CGCCCATCAATTCGCCGAAGAGATGTGAAATGTGTGACCATAAAAGGAGA
TGGAAAAGTAAAAATACAATCACCTGGTGTCTGCTACCGAATGAATGAAA
GGCCACCTAGCAGCTGGATGATCTGTCATTCGAAAACCAATCAACATTGT
CTAGAGATTAAAAAAGAGAATAAAAAGCAAAATTCAAAAATCGAAATAAA
AACAGACAACTCTGAAATACATCAAATGAGACATACTAAGCGATTGAAAA
TTCTTGTAGGACAAACAGCATACGTTCTTGGGTTTACAAGATTGTCAATA
TTTTGTCCAATGCCCATTATGCATAGAAGCAAAATTAAATGGCAACACGG
GAATAACACTTACGAATATCATGGCATATCTAGAGAAAGAATACGAGTGA
ATCGAAAGGGGGTTTTAGTCATCAGGGAGTTTTATTTGATAGATTCTGGT
GAATGGATTTGTAAAGCAGGAAGATACACAGCAAAAGCTACTCTTCATTT
AGAACAACCGTCAACAGGATTTGACAACTGGCTGAAGCGACATGCGAATC
ACAATTATGGTATGCTCAATGAAGAATCTAACTTCTCATTTATTCGGCCG
GAATCAATCATTTGGATTAAATCTGACTGGAGTCCTTGTTCTACGACTTG
CGAAGGGAATTCTAAAAATGCCGGTTATCAAACCCGAAAAGTCACATGCG
AAAAAATTGAAGCTCAATATTACAAAATCATTGAAGACAAATTTTGTCCT
CCTCTGAAACCGATTACAATTAAAAAATGCAAGTCGTTTGAAAGATGTCC
AAAATGGATTGTTGAAAAAAATGATAATGAACAATGTTCAGATGTCTGTG
TTAATATCGGGGTGGCGAGAACTTCTACAAATATTGTCTGCCAATTCAAC
AACAGAACTGTCGATTCTTCGCTGTGCGATTCACAGAAATTACCTAACAT
CACATGCCTCAATGATAAGTGTCAGATTTCTTACAATTACGGGCCTTGGT
CTCAGTGTTCCCTGAGCTGCAGCAACACGACGAATGCCAGCATACGCAGC
CGTACCATGAAATGTATATGGAAGCACACGAACAAGCCAGCTTACAATCT
ATGCCAGCTACAACAACTTCCACATCGGTCTCTGACGAAGCCCTGTAGAG
TGCCAAAATGTATTTTGGGATGCAAGGATTTGACATCGGCCTGCGTAAAA
CAGTCAAAATATCGATGTAGAAGCAGTTTATTTAATCATTTTTGCTGTGC
ATTTTGCAACAAACAATTTTCATAAACGCCCCCTTTCATGGTGAATTATT
AACAGATCATATTCTGTCATTTATATTCTGGTGCAAGGTTACTCAGCTTT
TTTGTCAATGGTTTCAACTATTTTCGCTATAATAATTATCAATAAAACAA
TACAATTACTTCTAATATTACATAGACAATGAGAGTGAAATTATTTCACA
TGAATTAAAAATTAACCATTTACT
back to top

protein sequence of SMED30010755-orf-1

>SMED30010755-orf-1 ID=SMED30010755-orf-1|Name=SMED30010755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=597bp
MLLLNFLTSVSVITLSGLLSFGTSTFMWNPTNEWTPCSKICDKGEETQNF
VCLKRTNYRTYEYANSNKCQMDKYPKKTRPCFLGSCPQNSTGTFVWQVGN
WSSCQKNCGGDGSQFRDVNCIMITSKGQFLSSKLSKCDTKFEPPRFISCG
HADCPPKFLTSKWHKCSESSDCRPSIRRRDVKCVTIKGDGKVKIQSPGVC
YRMNERPPSSWMICHSKTNQHCLEIKKENKKQNSKIEIKTDNSEIHQMRH
TKRLKILVGQTAYVLGFTRLSIFCPMPIMHRSKIKWQHGNNTYEYHGISR
ERIRVNRKGVLVIREFYLIDSGEWICKAGRYTAKATLHLEQPSTGFDNWL
KRHANHNYGMLNEESNFSFIRPESIIWIKSDWSPCSTTCEGNSKNAGYQT
RKVTCEKIEAQYYKIIEDKFCPPLKPITIKKCKSFERCPKWIVEKNDNEQ
CSDVCVNIGVARTSTNIVCQFNNRTVDSSLCDSQKLPNITCLNDKCQISY
NYGPWSQCSLSCSNTTNASIRSRTMKCIWKHTNKPAYNLCQLQQLPHRSL
TKPCRVPKCILGCKDLTSACVKQSKYRCRSSLFNHFCCAFCNKQFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR000884TSP1_rpt
IPR013783Ig-like_fold
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 28..87
e-value: 0.03
score: 22.8
coord: 499..560
e-value: 0.31
score: 13.8
coord: 95..155
e-value: 0.12
score: 17.4
coord: 376..439
e-value: 0.61
score: 11.2
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 25..87
score: 8.745
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 92..155
score: 8.445
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 496..560
score: 8.446
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 373..439
score: 8.62
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 225..342
e-value: 1.9E-5
score: 26.5
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 93..155
e-value: 1.0E-6
score: 31.0
coord: 375..439
e-value: 7.9E-8
score: 34.6
coord: 26..87
e-value: 1.2E-7
score: 34.0
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 93..154
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 375..433
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 27..86
NoneNo IPR availablePANTHERPTHR13723ADAMTS A DISINTEGRIN AND METALLOPROTEASE WITH THROMBOSPONDIN MOTIFS PROTEASEcoord: 31..231
coord: 277..594
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.604