FERM and pleckstrin domain containing protein

Overview
NameFERM and pleckstrin domain containing protein
Smed IDSMED30010740
Length (bp)4786
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FERM and pleckstrin domain containing protein (SMED30010740) t-SNE clustered cells

Violin plots show distribution of expression levels for FERM and pleckstrin domain containing protein (SMED30010740) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FERM and pleckstrin domain containing protein (SMED30010740) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FERM and pleckstrin domain containing protein (SMED30010740) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010740

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010740SMESG000038155.1 SmedASXL_018154SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30010740SMESG000038155.1 dd_Smed_v4_14700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010740SMESG000038155.1 dd_Smed_v4_14700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010740SMESG000038155.1 dd_Smed_v4_14700_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010740SMESG000038155.1 dd_Smed_v6_14700_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010740SMESG000038155.1 OX_Smed_1.0.01233ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Match: FARP1 (FERM, ARH/RhoGEF and pleckstrin domain protein 1 [Source:HGNC Symbol;Acc:HGNC:3591])

HSP 1 Score: 386.726 bits (992), Expect = 2.228e-113
Identity = 218/550 (39.64%), Postives = 315/550 (57.27%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+  TERTY + L++I  WF+  V+  +       +PE L   IF   +P+H+ HT  LKE+E R+ +                        E  SN + + +       R+ D+ L+N+  +     +       L +L+  IK++  L++  R FE+QKVCY+PL  + L P HR++ Y+Q  ERL +H   +H D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KSSS       +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD+ PLA+LPL+GY +  PS  + I+KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  537 PTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDA------MPEALKSLIFPNFEPLHKFHTNFLKEIEQRLAL-----------------------WEGRSNAQIRDYQ------RIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1033          

HSP 2 Score: 291.967 bits (746), Expect = 6.142e-81
Identity = 151/330 (45.76%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            K + +++ +LDD+ + F V  RA G+ L + V   L L+E DYF LE+ + + ++ WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H   +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER
Sbjct:   38 KLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQ-QDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Match: FARP1 (FERM, ARH/RhoGEF and pleckstrin domain protein 1 [Source:HGNC Symbol;Acc:HGNC:3591])

HSP 1 Score: 381.719 bits (979), Expect = 2.318e-111
Identity = 221/569 (38.84%), Postives = 320/569 (56.24%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESH-------------------RNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+  TERTY + L++I  WF+  V+  +       +PE L   IF   +P+H+ HT  LKE+E R+ +                        E  SN + + +       R+ D+ L+N+  +     +       L +L+  IK++  L++  R FE+QKVCY+PL  + L P HR++ Y+Q  ERL +H   +H D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L      +  S S I   H                   + FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KSSS       +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD+ PLA+LPL+GY +  PS  + I+KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  537 PTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDA------MPEALKSLIFPNFEPLHKFHTNFLKEIEQRLAL-----------------------WEGRSNAQIRDYQ------RIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPG--RPGSFSLIRTPHLGQARRIPCAPERRPLLLVKEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1064          

HSP 2 Score: 291.967 bits (746), Expect = 8.277e-81
Identity = 151/330 (45.76%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            K + +++ +LDD+ + F V  RA G+ L + V   L L+E DYF LE+ + + ++ WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H   +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER
Sbjct:   38 KLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQ-QDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Match: FARP1 (FERM, ARH/RhoGEF and pleckstrin domain protein 1 [Source:HGNC Symbol;Acc:HGNC:3591])

HSP 1 Score: 381.719 bits (979), Expect = 2.318e-111
Identity = 221/569 (38.84%), Postives = 320/569 (56.24%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESH-------------------RNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+  TERTY + L++I  WF+  V+  +       +PE L   IF   +P+H+ HT  LKE+E R+ +                        E  SN + + +       R+ D+ L+N+  +     +       L +L+  IK++  L++  R FE+QKVCY+PL  + L P HR++ Y+Q  ERL +H   +H D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L      +  S S I   H                   + FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KSSS       +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD+ PLA+LPL+GY +  PS  + I+KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  537 PTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDA------MPEALKSLIFPNFEPLHKFHTNFLKEIEQRLAL-----------------------WEGRSNAQIRDYQ------RIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPG--RPGSFSLIRTPHLGQARRIPCAPERRPLLLVKEFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1064          

HSP 2 Score: 291.967 bits (746), Expect = 8.277e-81
Identity = 151/330 (45.76%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            K + +++ +LDD+ + F V  RA G+ L + V   L L+E DYF LE+ + + ++ WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H   +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER
Sbjct:   38 KLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQ-QDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Match: FARP2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:HGNC Symbol;Acc:HGNC:16460])

HSP 1 Score: 377.096 bits (967), Expect = 6.350e-110
Identity = 213/554 (38.45%), Postives = 311/554 (56.14%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKS----SSSLTGNGIVD----SKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKS 4394
            P D+++ I+KEIL TERTY + L++I +WFR AV   +       +P  L   +F  +DPI+E H   L+E+E R+ +    ++ P  + T                             R+ DI L+N+  +  +  YF+  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R+L YR    RL  H    H D  DC   L  + ++   L     + EN  KL ELQRD+VG ++L                  R FIREG L KL KKG QQRMFF+FSD L+YT+K       F++ G  PL  +++EES+      H FT+Y+  +  +VAA+++ ++++W+ D++ AI AAKS    + +L G  +      S   +  +  + D  +  +S L        Q R+NT++HVCW+RN S++  +   A EN+LSGYLLRKFKNS+GWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I KD+VFKLQFK+HVYFFR +S+YT++RW E +  A+ SA +  S
Sbjct:  532 PADEAYFIVKEILATERTYLKDLEVITVWFRSAVVKEDA------MPATLMTLLFSNIDPIYEFHRGFLREVEQRLAL----WEGPSKAHTKGSHQ------------------------RIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAVYKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVTTTLQHILIRLENLQKLTELQRDLVGIENL--------------IAPGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSL----EGHGQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEVIQGASSSAGRAPS 1033          

HSP 2 Score: 306.605 bits (784), Expect = 8.597e-86
Identity = 149/338 (44.08%), Postives = 222/338 (65.68%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS 1193
            K++ +RV LLD++++ F +  +  GQ L  QV  +L L+E DYF +E+ N +    WL+ +K +++Q  + K  + +  +KF+ P P  L++EYTRYLFALQ+KRD+ +  L C   T ALL + + QSEIGD+  DE  D  +L  +       +  L K++E H+  VGQ+P+E+D+ +L+ ARK+E YGI+ H A D E   ++LAVSH G+++ Q   KIN F+W+KVRKLSFKRKRF IKLH E +G ++D +EF+  SR+ECKNFWK C+E+H FFR    +   K ++   S+GSS+RY+GRTQKQL +  +++  KR  +ER  S +  S
Sbjct:   42 KHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDY--DETLDREHLK-VNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLD-QPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGMKRIPYERRHSKTHTS 375          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Match: FARP2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:HGNC Symbol;Acc:HGNC:16460])

HSP 1 Score: 308.531 bits (789), Expect = 5.860e-90
Identity = 149/338 (44.08%), Postives = 222/338 (65.68%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS 1193
            K++ +RV LLD++++ F +  +  GQ L  QV  +L L+E DYF +E+ N +    WL+ +K +++Q  + K  + +  +KF+ P P  L++EYTRYLFALQ+KRD+ +  L C   T ALL + + QSEIGD+  DE  D  +L  +       +  L K++E H+  VGQ+P+E+D+ +L+ ARK+E YGI+ H A D E   ++LAVSH G+++ Q   KIN F+W+KVRKLSFKRKRF IKLH E +G ++D +EF+  SR+ECKNFWK C+E+H FFR    +   K ++   S+GSS+RY+GRTQKQL +  +++  KR  +ER  S +  S
Sbjct:   42 KHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDY--DETLDREHLK-VNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRLLD-QPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGMKRIPYERRHSKTHTS 375          

HSP 2 Score: 66.6254 bits (161), Expect = 2.876e-10
Identity = 31/78 (39.74%), Postives = 48/78 (61.54%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMV 3002
            P D+++ I+KEIL TERTY + L++I +WFR AV   +       +P  L   +F  +DPI+E H   L+E+E R+ +
Sbjct:  532 PADEAYFIVKEILATERTYLKDLEVITVWFRSAVVKEDA------MPATLMTLLFSNIDPIYEFHRGFLREVEQRLAL 603          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Match: frm-3 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EDC0])

HSP 1 Score: 334.724 bits (857), Expect = 1.923e-95
Identity = 159/333 (47.75%), Postives = 215/333 (64.56%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQ-RKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSL 1175
            + + ++V +LDD+V  FH+  +AIGQ L ++V   L LLE DYF L +I+  G  CWLD  K +++Q T    +  F F +KFY P P  LE+EYTRYLF +QIKRD+  G L C+ NT +LL A++ QSE GDF  ++Y D TYLS  R       EF  KVM+ HR  +G +P E+D  +L+ AR+ + YG+KLH A+D +     L+V H GI + +       FSWA++RKLSFKRK+  +KLH + Y Y K+ VEF F +R+ECKNFWK+C+EHHAFFRC   ++  K     +SKGSS+RY GRTQKQL + VRE   +R  F R L
Sbjct:   23 RLVCIKVRMLDDTVAVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDINGNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDATYLSHTRFVPNQTLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKKETRFFISKGSSFRYHGRTQKQLIDYVREHHKRREPFTRPL 355          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Match: frm-3 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EDC0])

HSP 1 Score: 329.331 bits (843), Expect = 1.055e-93
Identity = 159/333 (47.75%), Postives = 215/333 (64.56%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQ-RKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSL 1175
            + + ++V +LDD+V  FH+  +AIGQ L ++V   L LLE DYF L +I+  G  CWLD  K +++Q T    +  F F +KFY P P  LE+EYTRYLF +QIKRD+  G L C+ NT +LL A++ QSE GDF  ++Y D TYLS  R       EF  KVM+ HR  +G +P E+D  +L+ AR+ + YG+KLH A+D +     L+V H GI + +       FSWA++RKLSFKRK+  +KLH + Y Y K+ VEF F +R+ECKNFWK+C+EHHAFFRC   ++  K     +SKGSS+RY GRTQKQL + VRE   +R  F R L
Sbjct:   35 RLVCIKVRMLDDTVAVFHLGHKAIGQTLLDEVCRHLNLLECDYFGLSFIDINGNHCWLDREKTILRQITNGSTDAKFYFVVKFYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTASLLSAYLVQSECGDFSSEDYPDATYLSHTRFVPNQTLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHAAKDIDGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVEFSFETRDECKNFWKKCVEHHAFFRCVQAEEPKKETRFFISKGSSFRYHGRTQKQLIDYVREHHKRREPFTRPL 367          

HSP 2 Score: 150.214 bits (378), Expect = 3.936e-36
Identity = 113/450 (25.11%), Postives = 214/450 (47.56%), Query Frame = 3
Query: 3096 RKFHNEP--SPVYRVSDIFLQNLC-IIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLR-HIGE--NHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRD--IVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNK---LNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQ-------RDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQI-RKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            R+  NEP  S    V+ + L  +  + PLY+   ++    + +LDQ  ++    +  + KFE  K CY  +    L   +R++ ++    R++   + E  N  ++    + + ++ +  +      +  E    +L+++RD  +VG  +  N                R  +R G++ +  ++    R+  + SD++++ ++   L+GN   F VH +F L  +MI+E +   ++ V  G    +   N+          R  W+EDI+ AI  A  +        +D    +++    +D    + +K++L E   + + S   + +CW+R CS    ++ +   N + GYL RK +NS+GWQ LWVV     L+F++N+ +  PLA L L+ Y +  P+  D+I   +  FKL + +H YFFR DS Y ++RW + +  A  S + L
Sbjct:  642 RESSNEPEDSKAAMVAPVLLATVHNLTPLYQSLVQNFPIYVSALDQLYRSKIPFRTIMSKFESSKECYTQVNWILLKILNRLINWQPVLARVIEIQLSECGNDTETTAFGVAMDKIIEFAKKTKATRQSLEEYIHVLQVERDTGLVGILTHPN----------------RKILRVGFVLRSARRAPCCRIMVLCSDRILFGHRGVNLDGNF--FTVHAEFKLKGMMIDEGD---TYKVMDGENNVITLHNADISIVFAAPDRASWIEDITEAIKNAARAK-------IDLPSLVMEKKEEND---IDMTKVLLPEESPVSKMS--PLQICWYRKCSFGRKDVNKMITNTMCGYLKRKLRNSSGWQDLWVVMCCHTLYFYRNHNEREPLAHLSLMDYGVGLPTVADKIDNHENCFKLFYGSHTYFFRTDSYYFFERWVDSIFQAAISRDSL 1058          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 208.764 bits (530), Expect = 1.574e-54
Identity = 124/339 (36.58%), Postives = 188/339 (55.46%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYD-DYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQ-LQECVRETSYKRPQFERSLSMS 1184
            I   VT LD +  HF +   ++G  L  +V   L+++E DYF L +I  +  S     WLD  K + KQ      ++F F +KFY   PN L DE+TR+ F  Q+++++ +G L CN  + ALL +++ Q+E+GDF E  +    T L          ++F  +V E H+  +GQ+P  A+ N LD AR++E YG+ ++   D  +LP+++ V   GI +    IK+N ++W ++RKLSFK+K+F + L A   G  + I+ F   S   CK  WK CIE H FFR +   +  +R  KV + GS +RY+GRT+ Q L+E     S     F RSLS S
Sbjct:   29 IRCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEIIEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQMICPPYHLF-FRVKFYVRDPNRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLALLASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATLPDDFSDRVAELHQLHIGQTPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKKQFQV-LVANEDGVSETIMIFNIMSAKICKLLWKCCIEQHTFFRLKTPPKTPQR--KVFNFGSKFRYSGRTEYQTLEENEHRKSAGHRNFHRSLSKS 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 208.764 bits (530), Expect = 1.574e-54
Identity = 124/339 (36.58%), Postives = 188/339 (55.46%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYD-DYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQ-LQECVRETSYKRPQFERSLSMS 1184
            I   VT LD +  HF +   ++G  L  +V   L+++E DYF L +I  +  S     WLD  K + KQ      ++F F +KFY   PN L DE+TR+ F  Q+++++ +G L CN  + ALL +++ Q+E+GDF E  +    T L          ++F  +V E H+  +GQ+P  A+ N LD AR++E YG+ ++   D  +LP+++ V   GI +    IK+N ++W ++RKLSFK+K+F + L A   G  + I+ F   S   CK  WK CIE H FFR +   +  +R  KV + GS +RY+GRT+ Q L+E     S     F RSLS S
Sbjct:   29 IRCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEIIEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQMICPPYHLF-FRVKFYVRDPNRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLALLASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATLPDDFSDRVAELHQLHIGQTPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKKQFQV-LVANEDGVSETIMIFNIMSAKICKLLWKCCIEQHTFFRLKTPPKTPQR--KVFNFGSKFRYSGRTEYQTLEENEHRKSAGHRNFHRSLSKS 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Match: ptp-1 (Tyrosine-protein phosphatase 1 [Source:UniProtKB/Swiss-Prot;Acc:P28191])

HSP 1 Score: 208.764 bits (530), Expect = 1.574e-54
Identity = 124/339 (36.58%), Postives = 188/339 (55.46%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYD-DYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQ-LQECVRETSYKRPQFERSLSMS 1184
            I   VT LD +  HF +   ++G  L  +V   L+++E DYF L +I  +  S     WLD  K + KQ      ++F F +KFY   PN L DE+TR+ F  Q+++++ +G L CN  + ALL +++ Q+E+GDF E  +    T L          ++F  +V E H+  +GQ+P  A+ N LD AR++E YG+ ++   D  +LP+++ V   GI +    IK+N ++W ++RKLSFK+K+F + L A   G  + I+ F   S   CK  WK CIE H FFR +   +  +R  KV + GS +RY+GRT+ Q L+E     S     F RSLS S
Sbjct:   29 IRCTVTFLDSTSYHFEIEKNSLGIVLLEKVFNYLEIIEKDYFGLVFIAVDNSSAQQKKWLDPSKNLRKQMICPPYHLF-FRVKFYVRDPNRLRDEFTRFQFYQQVRQNLEEGRLPCNEGSLALLASYVVQAEVGDFEEKTHGMSRTCLCYKIQFATLPDDFSDRVAELHQLHIGQTPDVAEQNFLDHARRLEMYGMDVYDGVDANHLPIEIGVGAVGIKVFHEGIKMNEYAWVRIRKLSFKKKQFQV-LVANEDGVSETIMIFNIMSAKICKLLWKCCIEQHTFFRLKTPPKTPQR--KVFNFGSKFRYSGRTEYQTLEENEHRKSAGHRNFHRSLSKS 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Match: Cdep (gene:FBgn0265082 transcript:FBtr0336810)

HSP 1 Score: 382.104 bits (980), Expect = 1.847e-119
Identity = 184/345 (53.33%), Postives = 241/345 (69.86%), Query Frame = 3
Query:  150 TSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQC-TQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            T    R    K + VR+ +LDDS+  F V  +A+G+ L+ QV  +L LLE+DYF LEY   + VS     WLD  K + +Q      + + +F IKFY P P  LE+EYTRYLF LQIKRD+  G LQCN NT AL+ ++I Q+  GDF+ ++Y D+TYLSS R     +     K+ME H+  VGQSP+EAD NLL+TAR+ E YG+K+HPA+D E +PL LAV+H GI + QN  +IN FSWAK+RK+SFKRKRF +KLH EGYGY+KD VEF F  RNECKNFWK+C+E+H FFRC AV+   +R+++VLS+GSS+RY+G+TQKQ+ E VRE   KR  F+R
Sbjct:   57 TPSTPRHRGGKKLTVRIQMLDDSITMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEY---QEVSTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPNQDATMQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKIRKISFKRKRFLVKLHPEGYGYYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQR 398          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Match: Cdep (gene:FBgn0265082 transcript:FBtr0336809)

HSP 1 Score: 384.03 bits (985), Expect = 1.089e-111
Identity = 186/349 (53.30%), Postives = 243/349 (69.63%), Query Frame = 3
Query:  150 TSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQC-TQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM 1181
            T    R    K + VR+ +LDDS+  F V  +A+G+ L+ QV  +L LLE+DYF LEY   + VS     WLD  K + +Q      + + +F IKFY P P  LE+EYTRYLF LQIKRD+  G LQCN NT AL+ ++I Q+  GDF+ ++Y D+TYLSS R     +     K+ME H+  VGQSP+EAD NLL+TAR+ E YG+K+HPA+D E +PL LAV+H GI + QN  +IN FSWAK+RK+SFKRKRF +KLH EGYGY+KD VEF F  RNECKNFWK+C+E+H FFRC AV+   +R+++VLS+GSS+RY+G+TQKQ+ E VRE   KR  F+RS S 
Sbjct:   57 TPSTPRHRGGKKLTVRIQMLDDSITMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEY---QEVSTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPNQDATMQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKIRKISFKRKRFLVKLHPEGYGYYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQRSQSF 402          

HSP 2 Score: 306.605 bits (784), Expect = 1.816e-85
Identity = 188/556 (33.81%), Postives = 292/556 (52.52%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKS---------------SSSLTGNGIVDSKKFLIDD-------NGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVAT 4370
            P + S+ + KE+LMTERTYK+ LD++   FR+ ++ G+V  +     +PL    F LLD + + H   L+++E+R MV++                             R  H      +R+ D+ ++++  +P+Y +Y ++   IL  ++   + +   +   ++FE QKVCY+P+    L P +R+L Y+   ERL  + GE H+D  D   +   L    +G+      + N  +L ELQRDI  F+ L               + HR  IR+G L K  K+G QQRMFF+FSD L+Y +K   +   F++ G  P+  L+ E +E  ++F+++ G     V+A +  ++  WL ++S+A    K+               SSS  G  +                  G    Q+ +       +      RSNT++HVCWHR  ++   + L A E++LSGYLLRKFKNS+GWQKLWVVFT  CL+F+K+YQD+  LA+LPL+GY +  P  +D ++K+FVFKL FKNHVYFFR +S +TY+RW E L   T
Sbjct:  654 PTEPSYFLAKELLMTERTYKKDLDVLNTTFRQVLSLGDVEQL-----QPL----FELLDSLAQHHNLFLRDIEHR-MVQWEG---------------------------RGGHE----AHRIGDVMMKHMAALPIYDEYVQTHLDILHCMNDMYEGDERFRQVYKEFEQQKVCYLPIGELLLKPLNRLLHYQLILERLCDYYGEEHIDYADAMAVHHLLVRSTKGIRSQLPDSANFVELCELQRDI-NFEQL--------------VQPHRRLIRQGCLLKHSKRGLQQRMFFLFSDLLLYGSKSPLD-QSFRILGHVPVRSLLTENAE-HNTFSIFGGQCAITVSAGTTAEKTLWLAELSKAAADIKNRPPNMQLQLTTLKNCSSSEEGLDLFGLSNGNNSSLNSSVNGGGPLTTQQQKLQLQQQQQNRTQPSRSNTALHVCWHRGATVGLGDHLIAAEHQLSGYLLRKFKNSSGWQKLWVVFTSFCLYFYKSYQDEFALASLPLLGYTVGPPGHQDAVQKEFVFKLSFKNHVYFFRAESAHTYNRWLEVLRSTT 1151          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Match: Cdep (gene:FBgn0265082 transcript:FBtr0336812)

HSP 1 Score: 394.43 bits (1012), Expect = 1.902e-111
Identity = 184/338 (54.44%), Postives = 241/338 (71.30%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQCT-QRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLS 1178
            K + VR+ +LDDS+  F V  +A+G+ L+ QV  +L LLE+DYF LEY   + VS     WLD  K + +Q      + + +F IKFY P P  LE+EYTRYLF LQIKRD+  G LQCN NT AL+ ++I Q+  GDF+ ++Y D+TYLSS R     +     K+ME H+  VGQSP+EAD NLL+TAR+ E YG+K+HPA+D E +PL LAV+H GI + QN  +IN FSWAK+RK+SFKRKRF +KLH EGYGY+KD VEF F  RNECKNFWK+C+E+H FFRC AV+   +R+++VLS+GSS+RY+G+TQKQ+ E VRE   KR  F+RS S
Sbjct:   67 KKLTVRIQMLDDSITMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEY---QEVSTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPNQDATMQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKIRKISFKRKRFLVKLHPEGYGYYKDTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQRSQS 401          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Match: Cdep (gene:FBgn0265082 transcript:FBtr0336811)

HSP 1 Score: 370.548 bits (950), Expect = 5.095e-107
Identity = 183/349 (52.44%), Postives = 239/349 (68.48%), Query Frame = 3
Query:  150 TSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC----WLDHLKQVVKQC-TQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM 1181
            T    R    K + VR+ +LDDS+  F V  +A+G+ L+ QV  +L LLE+DYF LEY   + VS     WLD  K + +Q      + + +F IKFY P P  LE+EYTRYLF LQIKRD+  G LQCN NT AL+ ++I Q+  GDF+ ++Y D+TYLSS R     +     K+ME H+  VGQSP+EAD NLL+TAR+ E YG+K+HPA+D E +PL LAV+H GI + QN  +IN FSWAK+RK+SFKRKRF +KLH EGY    D VEF F  RNECKNFWK+C+E+H FFRC AV+   +R+++VLS+GSS+RY+G+TQKQ+ E VRE   KR  F+RS S 
Sbjct:   57 TPSTPRHRGGKKLTVRIQMLDDSITMFQVQAKALGRVLFEQVCRQLNLLEADYFGLEY---QEVSTHTKYWLDLEKPMNRQVGLSLIDPVLRFCIKFYTPDPAQLEEEYTRYLFCLQIKRDLATGSLQCNDNTAALMASYIVQASCGDFVPEDYPDHTYLSSYRFVPNQDATMQRKIMENHKKHVGQSPAEADLNLLETARRCELYGMKMHPAKDVEGVPLNLAVAHMGITVFQNITRINTFSWAKIRKISFKRKRFLVKLHPEGY----DTVEFFFEGRNECKNFWKKCVENHGFFRCTAVQNTPRRKTRVLSRGSSFRYSGKTQKQIIEFVRENYVKRQNFQRSQSF 398          

HSP 2 Score: 306.22 bits (783), Expect = 2.103e-85
Identity = 188/556 (33.81%), Postives = 292/556 (52.52%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKS---------------SSSLTGNGIVDSKKFLIDD-------NGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVAT 4370
            P + S+ + KE+LMTERTYK+ LD++   FR+ ++ G+V  +     +PL    F LLD + + H   L+++E+R MV++                             R  H      +R+ D+ ++++  +P+Y +Y ++   IL  ++   + +   +   ++FE QKVCY+P+    L P +R+L Y+   ERL  + GE H+D  D   +   L    +G+      + N  +L ELQRDI  F+ L               + HR  IR+G L K  K+G QQRMFF+FSD L+Y +K   +   F++ G  P+  L+ E +E  ++F+++ G     V+A +  ++  WL ++S+A    K+               SSS  G  +                  G    Q+ +       +      RSNT++HVCWHR  ++   + L A E++LSGYLLRKFKNS+GWQKLWVVFT  CL+F+K+YQD+  LA+LPL+GY +  P  +D ++K+FVFKL FKNHVYFFR +S +TY+RW E L   T
Sbjct:  650 PTEPSYFLAKELLMTERTYKKDLDVLNTTFRQVLSLGDVEQL-----QPL----FELLDSLAQHHNLFLRDIEHR-MVQWEG---------------------------RGGHE----AHRIGDVMMKHMAALPIYDEYVQTHLDILHCMNDMYEGDERFRQVYKEFEQQKVCYLPIGELLLKPLNRLLHYQLILERLCDYYGEEHIDYADAMAVHHLLVRSTKGIRSQLPDSANFVELCELQRDI-NFEQL--------------VQPHRRLIRQGCLLKHSKRGLQQRMFFLFSDLLLYGSKSPLD-QSFRILGHVPVRSLLTENAE-HNTFSIFGGQCAITVSAGTTAEKTLWLAELSKAAADIKNRPPNMQLQLTTLKNCSSSEEGLDLFGLSNGNNSSLNSSVNGGGPLTTQQQKLQLQQQQQNRTQPSRSNTALHVCWHRGATVGLGDHLIAAEHQLSGYLLRKFKNSSGWQKLWVVFTSFCLYFYKSYQDEFALASLPLLGYTVGPPGHQDAVQKEFVFKLSFKNHVYFFRAESAHTYNRWLEVLRSTT 1147          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0301279)

HSP 1 Score: 249.98 bits (637), Expect = 1.222e-69
Identity = 130/377 (34.48%), Postives = 213/377 (56.50%), Query Frame = 3
Query:  192 VRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSK-GSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPV 1319
             RVTLLD S+    +  +AIG+ + N + A L L+E DYF L Y        WLD L++ V +  +   +   F +KFY P P+ L+++ TRY   LQ++ DI +G L C   T ALL +++ QSE+GD+  +E     YL   ++      E   KVM+ H+T  GQSP+EA+ + L+ A+K+  YG+ LHPA+D E + + L V   G+++++++++IN F+W K+ K+S+KR  FYIK+    +  ++  + F   +    K  WK C+EHH FFR    +  SK  SK+    GS+YRY GRTQ +      + +   P+F R+LS +R+++  +S  +  L  +      +S   ++ + N+ G+  S+ P+
Sbjct:   34 ARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPTDPRTWLD-LEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPNQTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSK--SKMFPVFGSTYRYKGRTQAESTNTPVDRT--PPKFNRTLSGARLTS--RSMDALALAEKEKVARKSSTLDHRGDRNADGDAHSRSPI 403          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Match: farp2 (FERM, RhoGEF and pleckstrin domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2993])

HSP 1 Score: 418.313 bits (1074), Expect = 1.017e-124
Identity = 223/552 (40.40%), Postives = 318/552 (57.61%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEK--------SKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEIL TERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKE++ R+ +                        E  SN   K         R+ D+ L+N+C +  +  Y +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DCK  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PLH +++EESE      H FT+YS  R  +VAA+S+ + ++W+ED++ AI  +K       + ++         N +SD+   E+        S+  LD+  Q   R+NT++HVCWHRN S++ ++   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +  ++
Sbjct:  530 PTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKEIDQRLAL-----------------------WEGRSNAHVK-----GDYQRIGDVMLRNMCSLKEFTGYLQKHDEVLTELEKATKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPQHRDYDDCKEALKEVAEIATQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSAQRTIVVAASSKVEMNKWIEDLNMAIEMSKKCQE--KSDVLLDPSLCDRSNRSSDEVSLEQESEDDMNSSRCSLDK--QSHHRANTTMHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPGESDSIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASATGRM 1029          

HSP 2 Score: 309.686 bits (792), Expect = 4.148e-87
Identity = 157/351 (44.73%), Postives = 225/351 (64.10%), Query Frame = 3
Query:  177 SKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTK--QANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSV 1223
            +K + +RV  LD++ + + +  +A GQ L + V  ++ L+ESDYF LE+ N +    WLD  K +VKQ  +    +F+  +KF+ P P  L++E+TRYLF+LQIKRD+  G L C  NT ALL + + QSEIGD     YDD      L++ K     E    K+ME HR   GQ+P+E+D+ +L+ ARK+E +G++ HPA D E   + LAV+H G+ + Q   KIN F+W+K+RKLSFKRKRF IKLH E +G  +D +EF+  SR++CK FWK C+EHH+FFR     Q  K ++   S+GSS+RY+GRTQKQL E VR++  +R  ++R  S  R+S   +S AS V
Sbjct:   48 NKGLQIRVQGLDEAQEFYELESKADGQLLLSDVFRRINLIESDYFGLEFQNLQMNWVWLDPSKLIVKQVRRPMNTLFRLSVKFFPPDPGQLQEEFTRYLFSLQIKRDLLDGRLSCTENTAALLASHLVQSEIGD-----YDDLADREFLKMNKLLPCQEHVQEKIMELHRRHTGQTPAESDFQVLEIARKLEMFGVRFHPAADREGTKINLAVAHMGLQVFQGHTKINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQDTLEFLMGSRDQCKIFWKNCVEHHSFFRLLDQPQ-PKSKAIFFSRGSSFRYSGRTQKQLVEYVRDSGLRRTPYQRRNSKIRMST--RSLASDV 390          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Match: farp1 (FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) [Source:ZFIN;Acc:ZDB-GENE-070424-163])

HSP 1 Score: 365.54 bits (937), Expect = 2.863e-106
Identity = 214/540 (39.63%), Postives = 309/540 (57.22%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERY-QIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVAT 4370
            P DK++ I KE+L TERTY + L++I + F+KAV        +  +P+ L   IF   +P+++ H   LK++E R+            ++   RSN         ++++  +        RV D+ L+N+  + L   + +     LL L+Q+ +++  L+   R FE+QKVCY+PL  +FL P HR+L Y+Q  ERL +H    H D +D +  L  + +LV  L     K EN  KLLEL++D+VG  SL+                 R FIR G L KL  KG QQRMFF+FSD ++YT++      QFKVHGQ PL+ + I ESE      +SFT++   +  +VAA+S  + ++W+EDI  AI LA KS+   T             ++ ++DQ+  +           Q   R NT+VHVCWHR+ S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT   LFF+K +QD+ PLA+LPL+GY I  PS  + I KD+VFKL FK+HVY+FR +S+YT++RW E +  AT
Sbjct:  517 PTDKAYFIAKELLTTERTYLKDLEVITVSFQKAVLK------DEAMPDSLRNLIFANFEPVYKFHETFLKDVEQRL------------AQWEGRSN---------AHIKGDYQ-------RVGDVMLKNIQGLKLLSSHLQKHSESLLELEQSCRSSRRLEVLCRDFELQKVCYLPLNIFFLRPLHRLLHYKQILERLCKHYPPTHDDFRDSRAALADVSELVLQLHTTLMKMENFQKLLELKKDLVGIDSLAAPG--------------REFIRLGCLSKLSGKGLQQRMFFLFSDVVMYTSRGLTASNQFKVHGQLPLYGMTIRESEDEWGVPYSFTLFGQRQSVVVAASSASEMEKWIEDIRMAIELADKSNGPTTEILSSSFSDSKSPEDCSADQESEDDLSSSRSSLERQTPHRGNTTVHVCWHRSTSVSMVDFSVALENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKTHQDEYPLASLPLLGYSITIPSESENIHKDYVFKLHFKSHVYYFRSESEYTFERWMEVIRSAT 1008          

HSP 2 Score: 297.745 bits (761), Expect = 4.035e-83
Identity = 150/330 (45.45%), Postives = 220/330 (66.67%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            + I +RV +LDD+ + F VS RA G+ L++ V + L L+E DYF LE+ ++  +  WLD LK ++KQ  + K  I +F +KF+ P    L +E TRYLFALQIK D+  G L CN ++ ALL+A I QSEIGDF  DE     +L + +   +  +  + K++  HR  VGQ+P+E+DY LL+ AR++E YG++LHPA+D E   L LAV+H G+++ Q   KIN F+W+KVRKLSFKRKRF IKL  +     +D +EF+  SR+ CK FWK C+E+HAFFR    +   K +  + ++GSS+R++GRTQ+Q+ + V++T +K+  FER
Sbjct:   39 RQISIRVQMLDDTQEVFEVSQRAPGKALFDLVCSHLNLVEGDYFGLEFQDQRKMIVWLDLLKPILKQIRRPKNIILRFVVKFFPPDHTQLLEELTRYLFALQIKHDLACGRLTCNESSAALLVAHIVQSEIGDF--DEVQCKQHLLNNKYIPE-QDTLMDKIIGYHRKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTRLSLAVAHSGVLVFQGHTKINAFNWSKVRKLSFKRKRFLIKLRPDLNSNCQDTLEFMMGSRDCCKVFWKICVEYHAFFRLFE-EPKPKPKPVLFTRGSSFRFSGRTQRQVIDYVKDTEFKKVPFER 364          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Match: farp1 (FERM, RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived) [Source:ZFIN;Acc:ZDB-GENE-070424-163])

HSP 1 Score: 301.982 bits (772), Expect = 3.514e-86
Identity = 150/330 (45.45%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            + I +RV +LDD+ + F VS RA G+ L++ V + L L+E DYF LE+ ++  +  WLD LK ++KQ  + K  I +F +KF+ P    L +E TRYLFALQIK D+  G L CN ++ ALL+A I QSEIGDF E +   +  L++  + +Q  +  + K++  HR  VGQ+P+E+DY LL+ AR++E YG++LHPA+D E   L LAV+H G+++ Q   KIN F+W+KVRKLSFKRKRF IKL  +     +D +EF+  SR+ CK FWK C+E+HAFFR     +  K +  + ++GSS+R++GRTQ+Q+ + V++T +K+  FER
Sbjct:   39 RQISIRVQMLDDTQEVFEVSQRAPGKALFDLVCSHLNLVEGDYFGLEFQDQRKMIVWLDLLKPILKQIRRPKNIILRFVVKFFPPDHTQLLEELTRYLFALQIKHDLACGRLTCNESSAALLVAHIVQSEIGDFDEVQCKQH-LLNNKYIPEQ--DTLMDKIIGYHRKHVGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGTRLSLAVAHSGVLVFQGHTKINAFNWSKVRKLSFKRKRFLIKLRPDLNSNCQDTLEFMMGSRDCCKVFWKICVEYHAFFRLFEEPK-PKPKPVLFTRGSSFRFSGRTQRQVIDYVKDTEFKKVPFER 364          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Match: FRMD7 (si:ch211-243g6.3 [Source:ZFIN;Acc:ZDB-GENE-121214-124])

HSP 1 Score: 267.7 bits (683), Expect = 7.320e-80
Identity = 144/320 (45.00%), Postives = 204/320 (63.75%), Query Frame = 3
Query:  153 SPLKRA----NLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFL-MKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRY 1097
            +P+ RA    N ++ + +RV  LDDS + F V  + +G   +N+V   L+LLE +YF LE+ +  G   WL+ LK V KQ     +  F F +KF+ P P  L+   TRYLFALQIK+D+  G L CN N+ ALL++ I Q+EIGD+ +DE D + +L + +     N+E+L  K++  H+   G +P E+D +LL+ ARK++ YGI+ HPA D E + + LAV+H G+++ Q   KIN FSWAK+RKLSFKRK F IKLH E     +D VEF   SR+ CK FWK C+E+HAFFR    +  S ++S + SKGSS+RY
Sbjct:   10 TPVNRAAARKNKNEKLRLRVIFLDDSERVFEVERKIMGSDFFNKVCGHLKLLEKEYFGLEFRHHNGSFVWLELLKPVAKQIKNTSDVAFHFIVKFFPPDPGQLQKGLTRYLFALQIKQDLSNGSLTCNDNSAALLVSHILQAEIGDY-DDELDAH-HLENKQYV--PNQEYLDHKIIRFHKKNRGHTPGESDVHLLEVARKMDMYGIRPHPAHDGEGMRINLAVTHMGVLVFQGNTKINTFSWAKIRKLSFKRKHFLIKLHTETGPSRRDTVEFSMASRDVCKAFWKMCVEYHAFFRLTE-EPKSHQKSILSSKGSSFRY 324          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Match: frmd7 (FERM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-060825-67])

HSP 1 Score: 274.248 bits (700), Expect = 2.181e-78
Identity = 140/304 (46.05%), Postives = 202/304 (66.45%), Query Frame = 3
Query:  243 RAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFL-MKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYK 1151
            R +G+  +N V   L+L+E +YF LE+ +  G   WL+ LK + KQ  +R + IF+F +KF+ P P  L+ E TRYLFALQIK+D+  G L C+ N+ ALL++++ Q+EIGDF+E+   D  +L + R     N++ L  K+M  H+   GQSP+EAD+ LL+ +RK++ YGI+ H A D EN+ + LAV+H G+++ Q   KIN FSWA VRKLSFKRK F IKLH       KD VEF   +R+ CK FWK C+E+H FFR  + +  SK++S + S+GS +RY+GRTQKQL +  +++  K
Sbjct:    2 RVLGKDFFNSVCGHLKLVEKEYFGLEFRHHCGSYVWLELLKPLAKQIKRRNDLIFRFIVKFFPPDPGELQREVTRYLFALQIKQDLSNGSLTCSDNSAALLVSYLLQAEIGDFIEEL--DKQHLENKRYI--PNQDVLHKKIMRFHKRHRGQSPAEADHQLLEVSRKLDMYGIRPHAATDGENMRINLAVTHCGVLVFQGNTKINTFSWANVRKLSFKRKHFLIKLHTTIVASCKDTVEFTMANRDVCKAFWKMCVEYHTFFR-LSQEPKSKQKSLLYSRGSCFRYSGRTQKQLLDFTKKSEEK 300          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Match: muc6 (mucin 6, oligomeric mucus/gel-forming [Source:Xenbase;Acc:XB-GENE-987881])

HSP 1 Score: 387.111 bits (993), Expect = 1.579e-113
Identity = 220/550 (40.00%), Postives = 312/550 (56.73%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+  TE TY + L++I  WF+ AV   +       +PE L   IF   DP+H+ HT  LKE++ R                       L   E  SN   K  N+     ++ D+ L+N+  +     + +     L+ L++ IK +  L+   R+FE +KVCY+PL  +FL P HR++ Y+Q  ERL +H   NH+D +D +  L ++ +LV  L     K EN  KL EL++D+ G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT++   +  QFKVHGQ PL ++ IEESE      H  T+ S N+  +VAA+++ + ++W EDI  AI LA KSS     L  +   D K     + G +DQ+  +    S+  L+   Q   R NT+VHVCWHRN S++  +   A EN+ SG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +++YT+DRW E +  AT SA++
Sbjct:  532 PTDKAYFIAKEVSTTECTYLKDLEVITKWFQNAVGKDDA------MPESLRNLIFPNFDPLHKFHTSFLKEIDQR-----------------------LSFWEGRSNSHMKADNQ-----KIGDVMLKNIQGMKQLTTHLQKHYEALIELEKAIKGSRKLESLCREFEQEKVCYLPLNTFFLQPLHRLMHYKQIMERLCKHYPPNHVDFRDSRAALAEITELVAQLHGTMIKMENFQKLQELRKDLTGMDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVMIYTSRGLTSSNQFKVHGQLPLFNMTIEESEDEWGVPHCLTLRSQNQAIIVAASARPEMEKWSEDIQMAIDLAEKSSGPVPELLASSPPDGK---TPEEGPTDQESEDDLSASRTSLER--QSPHRGNTTVHVCWHRNTSVSMIDFSFAVENQFSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAENEYTFDRWMEVIRSATDSASR 1028          

HSP 2 Score: 310.842 bits (795), Expect = 2.395e-87
Identity = 151/325 (46.46%), Postives = 219/325 (67.38%), Query Frame = 3
Query:  195 RVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            +V +LD++++   V +RA G+ L + V + L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN ++ ALL++ I QSEIGDF  DE  D  +L   +   Q  E    K+ME HR   GQ+P+E+D+ LL+ AR++E YG++LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + VRE  +K+ QFER
Sbjct:   43 KVQMLDETLETVEVPIRAPGKALLDAVCSHLNLVEGDYFGLEFQDHRKIMVWLDLLKPIVKQIRRPKNVVLKFVVKFFPPDHTQLQEELTRYLFALQVKQDLVQGKLTCNESSAALLISHIVQSEIGDF--DEAGDQDHLQKNKYMPQ-QEPLEEKIMELHRNHFGQTPAESDFQLLEIARRLEMYGVRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFMMASRDFCKSFWKICVEYHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Match: muc6 (mucin 6, oligomeric mucus/gel-forming [Source:Xenbase;Acc:XB-GENE-987881])

HSP 1 Score: 362.459 bits (929), Expect = 7.159e-106
Identity = 208/522 (39.85%), Postives = 294/522 (56.32%), Query Frame = 3
Query: 2853 WFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            WF+ AV   +       +PE L   IF   DP+H+ HT  LKE++ R                       L   E  SN   K  N+     ++ D+ L+N+  +     + +     L+ L++ IK +  L+   R+FE +KVCY+PL  +FL P HR++ Y+Q  ERL +H   NH+D +D +  L ++ +LV  L     K EN  KL EL++D+ G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT++   +  QFKVHGQ PL ++ IEESE      H  T+ S N+  +VAA+++ + ++W EDI  AI LA KSS     L  +   D K     + G +DQ+  +    S+  L+   Q   R NT+VHVCWHRN S++  +   A EN+ SG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +++YT+DRW E +  AT SA++
Sbjct:  455 WFQNAVGKDDA------MPESLRNLIFPNFDPLHKFHTSFLKEIDQR-----------------------LSFWEGRSNSHMKADNQ-----KIGDVMLKNIQGMKQLTTHLQKHYEALIELEKAIKGSRKLESLCREFEQEKVCYLPLNTFFLQPLHRLMHYKQIMERLCKHYPPNHVDFRDSRAALAEITELVAQLHGTMIKMENFQKLQELRKDLTGMDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVMIYTSRGLTSSNQFKVHGQLPLFNMTIEESEDEWGVPHCLTLRSQNQAIIVAASARPEMEKWSEDIQMAIDLAEKSSGPVPELLASSPPDGK---TPEEGPTDQESEDDLSASRTSLER--QSPHRGNTTVHVCWHRNTSVSMIDFSFAVENQFSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAENEYTFDRWMEVIRSATDSASR 923          

HSP 2 Score: 248.825 bits (634), Expect = 2.327e-67
Identity = 145/362 (40.06%), Postives = 213/362 (58.84%), Query Frame = 3
Query:  195 RVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-----SRVSNIPKSPASSVLPTRHTRLASNSYA 1265
            +V +LD++++   V +RA G+ L + V + L L+E DYF LE+          DH K                 +K Y             Y+  +  K+D+ QG L CN ++ ALL++ I QSEIGDF  DE  D  +L   +   Q  E    K+ME HR   GQ+P+E+D+ LL+ AR++E YG++LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + VRE  +K+ QFER  S      S+ S+ P+ P   V P + ++L++ SYA
Sbjct:   43 KVQMLDETLETVEVPIRAPGKALLDAVCSHLNLVEGDYFGLEF---------QDHRKI----------------MKIYV------------YIMLVMFKQDLVQGKLTCNESSAALLISHIVQSEIGDF--DEAGDQDHLQKNKYMPQ-QEPLEEKIMELHRNHFGQTPAESDFQLLEIARRLEMYGVRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFMMASRDFCKSFWKICVEYHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREGGHKKVQFERKHSKICSIRSQSSHHPE-PLLEV-PKQVSKLSTISYA 361          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Match: muc6 (mucin 6, oligomeric mucus/gel-forming [Source:Xenbase;Acc:XB-GENE-987881])

HSP 1 Score: 363.229 bits (931), Expect = 1.246e-105
Identity = 208/522 (39.85%), Postives = 294/522 (56.32%), Query Frame = 3
Query: 2853 WFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            WF+ AV   +       +PE L   IF   DP+H+ HT  LKE++ R                       L   E  SN   K  N+     ++ D+ L+N+  +     + +     L+ L++ IK +  L+   R+FE +KVCY+PL  +FL P HR++ Y+Q  ERL +H   NH+D +D +  L ++ +LV  L     K EN  KL EL++D+ G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT++   +  QFKVHGQ PL ++ IEESE      H  T+ S N+  +VAA+++ + ++W EDI  AI LA KSS     L  +   D K     + G +DQ+  +    S+  L+   Q   R NT+VHVCWHRN S++  +   A EN+ SG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +++YT+DRW E +  AT SA++
Sbjct:  505 WFQNAVGKDDA------MPESLRNLIFPNFDPLHKFHTSFLKEIDQR-----------------------LSFWEGRSNSHMKADNQ-----KIGDVMLKNIQGMKQLTTHLQKHYEALIELEKAIKGSRKLESLCREFEQEKVCYLPLNTFFLQPLHRLMHYKQIMERLCKHYPPNHVDFRDSRAALAEITELVAQLHGTMIKMENFQKLQELRKDLTGMDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVMIYTSRGLTSSNQFKVHGQLPLFNMTIEESEDEWGVPHCLTLRSQNQAIIVAASARPEMEKWSEDIQMAIDLAEKSSGPVPELLASSPPDGK---TPEEGPTDQESEDDLSASRTSLER--QSPHRGNTTVHVCWHRNTSVSMIDFSFAVENQFSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAENEYTFDRWMEVIRSATDSASR 973          

HSP 2 Score: 304.294 bits (778), Expect = 1.591e-85
Identity = 155/361 (42.94%), Postives = 228/361 (63.16%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-------SRVSNIP---KSPASSVLPT 1232
            K    +V +LD++++   V +RA G+ L + V + L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN ++ ALL++ I QSEIGDF  DE  D  +L   +   Q  E    K+ME HR   GQ+P+E+D+ LL+ AR++E YG++LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + VRE  +K+  F   +          RV ++P   +SP+    P 
Sbjct:   38 KIYPFKVQMLDETLETVEVPIRAPGKALLDAVCSHLNLVEGDYFGLEFQDHRKIMVWLDLLKPIVKQIRRPKNVVLKFVVKFFPPDHTQLQEELTRYLFALQVKQDLVQGKLTCNESSAALLISHIVQSEIGDF--DEAGDQDHLQKNKYMPQ-QEPLEEKIMELHRNHFGQTPAESDFQLLEIARRLEMYGVRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFMMASRDFCKSFWKICVEYHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREGGHKKLSFTYEIQTLQQVREDKRVIDVPVQHRSPSPKKSPV 394          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Match: muc6 (mucin 6, oligomeric mucus/gel-forming [Source:Xenbase;Acc:XB-GENE-987881])

HSP 1 Score: 360.918 bits (925), Expect = 1.713e-105
Identity = 208/522 (39.85%), Postives = 294/522 (56.32%), Query Frame = 3
Query: 2853 WFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            WF+ AV   +       +PE L   IF   DP+H+ HT  LKE++ R                       L   E  SN   K  N+     ++ D+ L+N+  +     + +     L+ L++ IK +  L+   R+FE +KVCY+PL  +FL P HR++ Y+Q  ERL +H   NH+D +D +  L ++ +LV  L     K EN  KL EL++D+ G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT++   +  QFKVHGQ PL ++ IEESE      H  T+ S N+  +VAA+++ + ++W EDI  AI LA KSS     L  +   D K     + G +DQ+  +    S+  L+   Q   R NT+VHVCWHRN S++  +   A EN+ SG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +++YT+DRW E +  AT SA++
Sbjct:  437 WFQNAVGKDDA------MPESLRNLIFPNFDPLHKFHTSFLKEIDQR-----------------------LSFWEGRSNSHMKADNQ-----KIGDVMLKNIQGMKQLTTHLQKHYEALIELEKAIKGSRKLESLCREFEQEKVCYLPLNTFFLQPLHRLMHYKQIMERLCKHYPPNHVDFRDSRAALAEITELVAQLHGTMIKMENFQKLQELRKDLTGMDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVMIYTSRGLTSSNQFKVHGQLPLFNMTIEESEDEWGVPHCLTLRSQNQAIIVAASARPEMEKWSEDIQMAIDLAEKSSGPVPELLASSPPDGK---TPEEGPTDQESEDDLSASRTSLER--QSPHRGNTTVHVCWHRNTSVSMIDFSFAVENQFSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAENEYTFDRWMEVIRSATDSASR 905          

HSP 2 Score: 297.745 bits (761), Expect = 9.713e-84
Identity = 157/345 (45.51%), Postives = 226/345 (65.51%), Query Frame = 3
Query:  246 AIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-----SRVSNIPKSPASSVLPTRHTRLASNSYA 1265
            A G+ L + V + L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN ++ ALL++ I QSEIGDF  DE  D  +L   +   Q  E    K+ME HR   GQ+P+E+D+ LL+ AR++E YG++LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + VRE  +K+ QFER  S      S+ S+ P+ P   V P + ++L++ SYA
Sbjct:    5 APGKALLDAVCSHLNLVEGDYFGLEFQDHRKIMVWLDLLKPIVKQIRRPKNVVLKFVVKFFPPDHTQLQEELTRYLFALQVKQDLVQGKLTCNESSAALLISHIVQSEIGDF--DEAGDQDHLQKNKYMPQ-QEPLEEKIMELHRNHFGQTPAESDFQLLEIARRLEMYGVRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFMMASRDFCKSFWKICVEYHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREGGHKKVQFERKHSKICSIRSQSSHHPE-PLLEV-PKQVSKLSTISYA 343          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Match: muc6 (mucin 6, oligomeric mucus/gel-forming [Source:Xenbase;Acc:XB-GENE-987881])

HSP 1 Score: 362.844 bits (930), Expect = 1.843e-105
Identity = 208/522 (39.85%), Postives = 294/522 (56.32%), Query Frame = 3
Query: 2853 WFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            WF+ AV   +       +PE L   IF   DP+H+ HT  LKE++ R                       L   E  SN   K  N+     ++ D+ L+N+  +     + +     L+ L++ IK +  L+   R+FE +KVCY+PL  +FL P HR++ Y+Q  ERL +H   NH+D +D +  L ++ +LV  L     K EN  KL EL++D+ G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT++   +  QFKVHGQ PL ++ IEESE      H  T+ S N+  +VAA+++ + ++W EDI  AI LA KSS     L  +   D K     + G +DQ+  +    S+  L+   Q   R NT+VHVCWHRN S++  +   A EN+ SG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +++YT+DRW E +  AT SA++
Sbjct:  517 WFQNAVGKDDA------MPESLRNLIFPNFDPLHKFHTSFLKEIDQR-----------------------LSFWEGRSNSHMKADNQ-----KIGDVMLKNIQGMKQLTTHLQKHYEALIELEKAIKGSRKLESLCREFEQEKVCYLPLNTFFLQPLHRLMHYKQIMERLCKHYPPNHVDFRDSRAALAEITELVAQLHGTMIKMENFQKLQELRKDLTGMDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVMIYTSRGLTSSNQFKVHGQLPLFNMTIEESEDEWGVPHCLTLRSQNQAIIVAASARPEMEKWSEDIQMAIDLAEKSSGPVPELLASSPPDGK---TPEEGPTDQESEDDLSASRTSLER--QSPHRGNTTVHVCWHRNTSVSMIDFSFAVENQFSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAENEYTFDRWMEVIRSATDSASR 985          

HSP 2 Score: 309.686 bits (792), Expect = 3.071e-87
Identity = 151/326 (46.32%), Postives = 219/326 (67.18%), Query Frame = 3
Query:  195 RVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERS 1172
            +V +LD++++   V +RA G+ L + V + L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN ++ ALL++ I QSEIGDF  DE  D  +L   +   Q  E    K+ME HR   GQ+P+E+D+ LL+ AR++E YG++LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + VRE  +K+ QFE S
Sbjct:   43 KVQMLDETLETVEVPIRAPGKALLDAVCSHLNLVEGDYFGLEFQDHRKIMVWLDLLKPIVKQIRRPKNVVLKFVVKFFPPDHTQLQEELTRYLFALQVKQDLVQGKLTCNESSAALLISHIVQSEIGDF--DEAGDQDHLQKNKYMPQ-QEPLEEKIMELHRNHFGQTPAESDFQLLEIARRLEMYGVRLHPAKDREGTKINLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFMMASRDFCKSFWKICVEYHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVREGGHKKVQFESS 364          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Match: Farp2 (FERM, RhoGEF and pleckstrin domain protein 2 [Source:MGI Symbol;Acc:MGI:2385126])

HSP 1 Score: 388.267 bits (996), Expect = 8.064e-114
Identity = 213/553 (38.52%), Postives = 314/553 (56.78%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDN------GNSDQQKTEKSKLILDERYQI----QQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P D+++ I KEIL TERTY + L++I +WFR      +V+     +P  L   +F  +DP++E H   L E+E R+ +    ++ P      S ++L  D                    R+ DI L+N+  +  +  YF+  + +L  L++  K+   L+   ++FE+QKVCY+PL  + L P  R++ YR    RL  H    H D  DC   L  + ++   L  +  + EN  KL ELQRD+VG ++L                  R FIREG L KL KKG QQRMFF+FSD L+YT+K       F++ G  PL  +++EESE      H FT+Y+  +  +VAA+++ ++++W++D++ AI AAK+        I DS   L+          +SD+   E+S+     R  +    Q R+NT++HVCW+RN S++  +   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I KD+VFKLQFK+HVYFFR +S+YT++RW + +  A+ S  +
Sbjct:  535 PEDEAYFIAKEILATERTYLKDLEVITVWFR------SVLIKEEAMPAALMALLFSNIDPVYEFHRGFLHEVEQRLAL----WEGP------SSAHLKGDHQ------------------RIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKHCKKLEAVYKEFELQKVCYLPLNTFLLKPVQRLVHYRLLLSRLCAHYSPGHRDYADCHEALKAITEVTTELQQSLTRLENLQKLTELQRDLVGVENL--------------IAPGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKSVTGASHFRIRGFLPLRGMLVEESENEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMQDLNAAIQAAKT--------IGDSPPVLLGGPVYTRTPRSSDEVSLEESEDGRGNRGSLEGNSQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSLPREADSIHKDYVFKLQFKSHVYFFRAESKYTFERWMDVIKRASSSPGR 1031          

HSP 2 Score: 313.923 bits (803), Expect = 2.886e-88
Identity = 156/352 (44.32%), Postives = 228/352 (64.77%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPKSPAS 1217
            K++ +RV LLD +V+ F +  +  GQ L  QV   L L+E DYF LE+ N +    WL+ +K +++Q  + K  + +  +KF+ P P  L++EYTRYLFALQ+KRD+ +  L C  NT ALL++ + QSEIGD+  DE  D  +L +        E+ L K+++ H+   GQ+P+E+D+ +L+ ARK+E YGI+ H A D E   + LAVSH G+++ Q   KIN F+W+KVRKLSFKRKRF IKLH E +G ++D +EF+  SR+ECKNFWK C+E+H FFR  + +   K ++   S+GSS+RY+GRTQKQL + V++   KR  +ER  S +R S      ++PK   S
Sbjct:   42 KHMRIRVKLLDSTVELFDIEPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKPIIRQVRKPKNAVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALLISHLLQSEIGDY--DETLDREHLKANEYLPN-QEKSLEKILDFHQRHTGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRL-SDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYVKDGGMKRIPYERRHSKTRTSLHALTVDLPKQSVS 389          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Match: Farp1 (FERM, RhoGEF (Arhgef) and pleckstrin domain protein 1 (chondrocyte-derived) [Source:MGI Symbol;Acc:MGI:2446173])

HSP 1 Score: 384.03 bits (985), Expect = 1.688e-112
Identity = 216/550 (39.27%), Postives = 310/550 (56.36%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKS---SSSLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK+++I KE+  TERTY + L++I  WF+  V+          +PE L   IF   +P+H+ HT  LKE+E R                     L L    S +++   +        R+ D+ L+N+  +     +       L +L+ +IK +  L+   R FE+QKVCY+PL  + L P HR++ Y+   ERL +H   NH D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KS   +  L  +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHR+ S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  539 PTDKAYYIAKEVSTTERTYLKDLEVIASWFQSTVSK------EDSMPEALKSLIFPNFEPLHKFHTNFLKEIEQR---------------------LALWEGRSNAHVRGDYQ-------RIGDVMLKNIQGMKHLAAHLWKHSEALEALETSIKGSRRLEHFCRDFELQKVCYLPLNTFLLRPLHRLMHYKHVLERLCKHHPPNHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEEEWGVPHCLTLRGQRQSIIVAASSRSEMEKWMEDIQMAIDLAEKSNGPTPELLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRSTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1036          

HSP 2 Score: 291.197 bits (744), Expect = 6.682e-81
Identity = 163/367 (44.41%), Postives = 237/367 (64.58%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-----SRVSNIPKSPASSVLPTRHTRLASNSYA 1265
            K + V++ +LDD+ + F V  RA G+ L++ V   L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    ++ME H + VGQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+   R+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER  S      S VS  P +P S V P +  + AS ++ 
Sbjct:   38 KLMTVKIQMLDDTQEAFEVPQRAPGKVLFDAVCNHLNLVEGDYFGLEFPDHRKIVVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYVPQ-QDALEDRIMEFHHSHVGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSYQDTLEFLMAGRDFCKSFWKICVEHHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSTRSLVSQ-PTAPNSEV-PKQSPQSASLTFG 398          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Match: Farp2 (FERM, RhoGEF and pleckstrin domain protein 2 [Source:MGI Symbol;Acc:MGI:2385126])

HSP 1 Score: 318.161 bits (814), Expect = 7.821e-92
Identity = 153/338 (45.27%), Postives = 223/338 (65.98%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS 1193
            K++ +RV LLD +V+ F +  +  GQ L  QV   L L+E DYF LE+ N +    WL+ +K +++Q  + K  + +  +KF+ P P  L++EYTRYLFALQ+KRD+ +  L C  NT ALL++ + QSEIGD+  DE  D  +L +        E+ L K+++ H+   GQ+P+E+D+ +L+ ARK+E YGI+ H A D E   + LAVSH G+++ Q   KIN F+W+KVRKLSFKRKRF IKLH E +G ++D +EF+  SR+ECKNFWK C+E+H FFR  + +   K ++   S+GSS+RY+GRTQKQL + V++   KR  +ER  S +R S
Sbjct:   42 KHMRIRVKLLDSTVELFDIEPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKPIIRQVRKPKNAVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALLISHLLQSEIGDY--DETLDREHLKANEYLPN-QEKSLEKILDFHQRHTGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRL-SDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYVKDGGMKRIPYERRHSKTRTS 375          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Match: Frmd7 (FERM domain containing 7 [Source:MGI Symbol;Acc:MGI:2686379])

HSP 1 Score: 282.722 bits (722), Expect = 1.565e-80
Identity = 147/328 (44.82%), Postives = 211/328 (64.33%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            + ++V  LDDS + F V  ++ G+ L+N     L L E +YF LE+ +  G + WL+ LK + KQ    KE +F+F +KF+   P  L +E TRYLF LQIK+D+  G L C+ N TAL+++ I QSE+GDF E+    +  + +  L  QA+ E   K+M+ H+  +G+SP+E+D  LLD ARK++ YGI+  PA D E + + LAV+H G+++ +   KIN F+WAK+RKLSFKRK F IKLHA      KD +EF   SR+ CK FWK C+E+HAFFR  + +  SK ++ + SKGSS+RY+GRTQ+QL E  ++   K   FER
Sbjct:    2 LHLKVQFLDDSQKIFVVDQKSSGKALFNLSCGHLNLAEKEYFGLEFCSHSGNNVWLELLKPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTALMVSHILQSELGDFHEETVRKH-LVQTQYLPSQASLE--SKIMQFHQQHIGRSPAESDILLLDIARKLDMYGIRPQPASDGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLIKLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRL-SEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGKKGRLKSLPFER 325          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 245.358 bits (625), Expect = 3.820e-67
Identity = 135/348 (38.79%), Postives = 194/348 (55.75%), Query Frame = 3
Query:  156 PLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLS----MSR 1187
            PLK     K +  +VTLLD S     V  R+ GQ L+++V   L LLE DYF L Y + E    WLD  K++ KQ  +   + F F +KFY P P  L ++ TRY   LQ++ DI  G L C+  T ALL ++  QSE+GD+  DE  +  Y+S  R      +E   KV+E H++  G +P+EA+ + L+ A+K+  YG+ LH A+D E + + L V   G++I+++R++IN F+W KV K+S+KR  FYIK+    +  F+  + F   +    K  WK C+EHH FFR    +   K   K L+ GS +RY+GRTQ Q +          P FERS S    MSR
Sbjct:  108 PLKIVKRPKSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQI-RSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDECGN-DYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPK---KFLTLGSKFRYSGRTQAQTRRASALIDRPAPYFERSSSKRYTMSR 450          
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Match: sp|Q91VS8|FARP2_MOUSE (FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2)

HSP 1 Score: 388.267 bits (996), Expect = 5.641e-113
Identity = 213/553 (38.52%), Postives = 314/553 (56.78%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDN------GNSDQQKTEKSKLILDERYQI----QQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P D+++ I KEIL TERTY + L++I +WFR      +V+     +P  L   +F  +DP++E H   L E+E R+ +    ++ P      S ++L  D                    R+ DI L+N+  +  +  YF+  + +L  L++  K+   L+   ++FE+QKVCY+PL  + L P  R++ YR    RL  H    H D  DC   L  + ++   L  +  + EN  KL ELQRD+VG ++L                  R FIREG L KL KKG QQRMFF+FSD L+YT+K       F++ G  PL  +++EESE      H FT+Y+  +  +VAA+++ ++++W++D++ AI AAK+        I DS   L+          +SD+   E+S+     R  +    Q R+NT++HVCW+RN S++  +   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I KD+VFKLQFK+HVYFFR +S+YT++RW + +  A+ S  +
Sbjct:  535 PEDEAYFIAKEILATERTYLKDLEVITVWFR------SVLIKEEAMPAALMALLFSNIDPVYEFHRGFLHEVEQRLAL----WEGP------SSAHLKGDHQ------------------RIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKHCKKLEAVYKEFELQKVCYLPLNTFLLKPVQRLVHYRLLLSRLCAHYSPGHRDYADCHEALKAITEVTTELQQSLTRLENLQKLTELQRDLVGVENL--------------IAPGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKSVTGASHFRIRGFLPLRGMLVEESENEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMQDLNAAIQAAKT--------IGDSPPVLLGGPVYTRTPRSSDEVSLEESEDGRGNRGSLEGNSQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSLPREADSIHKDYVFKLQFKSHVYFFRAESKYTFERWMDVIKRASSSPGR 1031          

HSP 2 Score: 313.923 bits (803), Expect = 2.019e-87
Identity = 156/352 (44.32%), Postives = 228/352 (64.77%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPKSPAS 1217
            K++ +RV LLD +V+ F +  +  GQ L  QV   L L+E DYF LE+ N +    WL+ +K +++Q  + K  + +  +KF+ P P  L++EYTRYLFALQ+KRD+ +  L C  NT ALL++ + QSEIGD+  DE  D  +L +        E+ L K+++ H+   GQ+P+E+D+ +L+ ARK+E YGI+ H A D E   + LAVSH G+++ Q   KIN F+W+KVRKLSFKRKRF IKLH E +G ++D +EF+  SR+ECKNFWK C+E+H FFR  + +   K ++   S+GSS+RY+GRTQKQL + V++   KR  +ER  S +R S      ++PK   S
Sbjct:   42 KHMRIRVKLLDSTVELFDIEPKCDGQVLLTQVWKHLNLIECDYFGLEFKNVQSYWIWLEPMKPIIRQVRKPKNAVLRLAVKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCTANTAALLISHLLQSEIGDY--DETLDREHLKANEYLPN-QEKSLEKILDFHQRHTGQTPAESDFQVLEIARKLEMYGIRFHMASDREGTKINLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLLGSRDECKNFWKICVEYHTFFRL-SDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYVKDGGMKRIPYERRHSKTRTSLHALTVDLPKQSVS 389          
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Match: sp|Q9Y4F1|FARP1_HUMAN (FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.070e-112
Identity = 218/550 (39.64%), Postives = 315/550 (57.27%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKSSS---SLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+  TERTY + L++I  WF+  V+  +       +PE L   IF   +P+H+ HT  LKE+E R+ +                        E  SN + + +       R+ D+ L+N+  +     +       L +L+  IK++  L++  R FE+QKVCY+PL  + L P HR++ Y+Q  ERL +H   +H D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KSSS       +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD+ PLA+LPL+GY +  PS  + I+KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  537 PTDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDA------MPEALKSLIFPNFEPLHKFHTNFLKEIEQRLAL-----------------------WEGRSNAQIRDYQ------RIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1033          

HSP 2 Score: 291.967 bits (746), Expect = 2.949e-80
Identity = 151/330 (45.76%), Postives = 222/330 (67.27%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            K + +++ +LDD+ + F V  RA G+ L + V   L L+E DYF LE+ + + ++ WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H   +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER
Sbjct:   38 KLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQ-QDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Match: sp|F1LYQ8|FARP1_RAT (FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Farp1 PE=1 SV=2)

HSP 1 Score: 386.341 bits (991), Expect = 1.815e-112
Identity = 220/560 (39.29%), Postives = 315/560 (56.25%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKS---SSSLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKSTPSAQIH 4415
            P DK+++I KE+  TERTY + L++I  WF+  V+  +       +PE L   IF   +P+H+ HT  LKE+E R                     L L    S +++   +        R+ D+ L+N+  +     +       L +L+ +IK +  L+   R FE+QKVCY+PL  + L P HR++ Y+Q  ERL +H   NH D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++WLEDI  AI LA KS   +  L  +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHR+ S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++  S    + H
Sbjct:  540 PTDKAYYIAKEVSTTERTYLKDLEVIASWFQSTVSKED------SMPEALKSLIFPNFEPLHKFHTNFLKEIEQR---------------------LALWEGRSNAHIRGDYQ-------RIGDVMLKNIQGMKHLAAHLWKHSEALEALETSIKGSRRLEHFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPNHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEEEWGVPHCLTLRGQRQSIIVAASSRSEMEKWLEDIQMAIDLAEKSNGPTPELLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRSTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRAHSLSHKESH 1047          

HSP 2 Score: 310.071 bits (793), Expect = 2.956e-86
Identity = 166/376 (44.15%), Postives = 242/376 (64.36%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-----SRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSA 1292
            K + V++ +LDD+ + F V  RA G+ L++ V   L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H + +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+   R+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER  S      S VS  P +P S V P +  + AS ++    +ES SA
Sbjct:   38 KLMTVKIQMLDDTQEAFEVPQRAPGKVLFDAVCNHLNLVEGDYFGLEFPDHRKIVVWLDLLKPIVKQIRRPKHVLVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYVPQ-QDALEDKIVEFHHSHIGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSYQDTLEFLMAGRDFCKSFWKICVEHHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSTRSLVSQ-PTAPNSEV-PKQSPQSASLTFGE-GTESPSA 406          
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Match: sp|F8VPU2|FARP1_MOUSE (FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Farp1 PE=1 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.181e-111
Identity = 216/550 (39.27%), Postives = 310/550 (56.36%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKS---SSSLTGNGIVDSKKFLIDDNGNSDQQKTE---KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK+++I KE+  TERTY + L++I  WF+  V+          +PE L   IF   +P+H+ HT  LKE+E R                     L L    S +++   +        R+ D+ L+N+  +     +       L +L+ +IK +  L+   R FE+QKVCY+PL  + L P HR++ Y+   ERL +H   NH D +DC+  L ++ ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + IEESE      H  T+    +  +VAA+S+ + ++W+EDI  AI LA KS   +  L  +   D+K    D+   +DQ+  +    S+  L+   Q   R NT VHVCWHR+ S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD  PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA++
Sbjct:  539 PTDKAYYIAKEVSTTERTYLKDLEVIASWFQSTVSK------EDSMPEALKSLIFPNFEPLHKFHTNFLKEIEQR---------------------LALWEGRSNAHVRGDYQ-------RIGDVMLKNIQGMKHLAAHLWKHSEALEALETSIKGSRRLEHFCRDFELQKVCYLPLNTFLLRPLHRLMHYKHVLERLCKHHPPNHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVTPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEEEWGVPHCLTLRGQRQSIIVAASSRSEMEKWMEDIQMAIDLAEKSNGPTPELLASSPPDNKS--PDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRSTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDSHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASR 1036          

HSP 2 Score: 291.197 bits (744), Expect = 4.674e-80
Identity = 163/367 (44.41%), Postives = 237/367 (64.58%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM-----SRVSNIPKSPASSVLPTRHTRLASNSYA 1265
            K + V++ +LDD+ + F V  RA G+ L++ V   L L+E DYF LE+ +   +  WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    ++ME H + VGQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+   R+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER  S      S VS  P +P S V P +  + AS ++ 
Sbjct:   38 KLMTVKIQMLDDTQEAFEVPQRAPGKVLFDAVCNHLNLVEGDYFGLEFPDHRKIVVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYVPQ-QDALEDRIMEFHHSHVGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSYQDTLEFLMAGRDFCKSFWKICVEHHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFERKHSKIHSTRSLVSQ-PTAPNSEV-PKQSPQSASLTFG 398          
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Match: sp|Q5RAB8|FARP1_PONAB (FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Pongo abelii OX=9601 GN=FARP1 PE=2 SV=1)

HSP 1 Score: 382.874 bits (982), Expect = 3.128e-111
Identity = 216/553 (39.06%), Postives = 314/553 (56.78%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQ-----QKTE----KSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KE+  TERTY + L++I  WF+ AV+  +       +PE L   IF   +P+H+ HT  LKE+E R+ +                        E  SN + + +       R+ D+ L+N+  +     +       L +L+  IK++  L++  R FE+QKVCY+PL  + L P HR + Y+Q  ERL +H   +H D +DC+  L  + ++V  L     K EN  KL EL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D L+YT++      QFKVHGQ PL+ + I+ESE      H  T+    +  +VAA+S+ + ++W+EDI  AI  A+ +SSL    +  S      DN + D+     Q++E     S+  L+   Q   R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT  CLFF+K++QD+ PLA+LPL+GY +  P+  + I KD+VFKL FK+HVY+FR +S+YT++RW E +  AT SA+++
Sbjct:  537 PTDKAYFIAKEVSTTERTYLKDLEVITSWFQSAVSKEDA------MPEALKSLIFPNFEPLHKFHTNFLKEIEQRLAL-----------------------WEGRSNAQIRDYQ------RIGDVMLKNIQGMKHLAVHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRHMHYKQVLERLCKHHPPSHADFRDCRAALAGITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPG--------------REFIRLGSLSKLSGKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIKESEDEWGVPHCLTLRGQRQSIIVAASSRSEMEKWVEDIQMAIDLAEKNSSLAPEFLASSPP----DNKSPDEATAADQESEDDLSASRTSLER--QAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLGYSLTIPTESENIHKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRV 1034          

HSP 2 Score: 288.5 bits (737), Expect = 3.797e-79
Identity = 151/330 (45.76%), Postives = 221/330 (66.97%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            K + +++ +LDD+ + F V  RA G+ L + V   L L+E DYF LE  + + ++ WLD LK +VKQ  + K  + +F +KF+ P    L++E TRYLFALQ+K+D+ QG L CN  + ALL++ I QSEIGDF  DE  D  +L+  +   Q  +    K++E H   +GQ+P+E+D+ LL+ AR++E YGI+LHPA+D E   + LAV++ GI++ Q   KIN F+WAKVRKLSFKRKRF IKL  +    ++D +EF+  SR+ CK+FWK C+EHHAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V+E  +K+ QFER
Sbjct:   38 KLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVCNHLNLVEGDYFGLECPDHKKITVWLDLLKPLVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDF--DEALDREHLAKNKYIPQ-QDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRL-FEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQFER 363          
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Match: A0A3R7FMD9 (Putative ferm (Fragment) OS=Clonorchis sinensis OX=79923 GN=Farp2 PE=4 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 7.526e-173
Identity = 268/564 (47.52%), Postives = 372/564 (65.96%), Query Frame = 3
Query: 2775 DKSFHIIKEILMTERTYKRSLDIICIWFRKAVA------SGNVVDVN-SRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSS-----------------TIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILD-ERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            D ++ +I +++MTERTY R L ++C+ FR ++            D + +RLP  L+  +F LLDPI+ +H ++L   E RV   +N  +   +   S+R   G+         E++     S VY + D+FL +L +IP Y+++  +AE ++L +++ +++NP L+  +R+FE QK+CY+P Y + L P HR+LQYR   ERL+R+  E H D+ DC+++  +L DL+Q  W++YK+ ENT KLLE+QRD+ G     +   + + +S+                  +  S R FIREGWLQKL KKGYQ RMFF+FSDQLVY  +     LQFKVHGQFPLHDLM+EE+EP +SFTV+SGNRCFLVAA S WQRDRWLEDISRAILAAK+  S       +    L     N+D + TE +    D E  Q+ QR+ TSVHVCWHR  +++  +ILRANE E SGYLLRKFKNSNGWQ+LWVVFTQ CLFF+K+Y+DD PLA+LPL+GY I  PS  DQI++D V K+QFKNHVYFFRG++ ++++RWFE L+ A G++ + K
Sbjct:  243 DTAYQLICDLVMTERTYGRDLSVVCVCFRHSLTCLDDELGSPCTDAHEARLPNDLATELFDLLDPIYVEHQKLLASFEARV-SSWNGRK--ISDDLSNRPLTGIHPLPLSPVAEQQ-----SSVYCIGDLFLAHLGMIPFYQRFMANAERVMLLIEEALRSNPELEQQLRQFEAQKICYLPFYVFLLKPMHRLLQYRVTLERLMRYYSETHPDAPDCRVVHARLLDLIQSQWESYKRLENTYKLLEIQRDLTGLSCFPSALSDSVETSAKPQQTVVTEDLPGPAAGPLIRSGRQFIREGWLQKLSKKGYQPRMFFLFSDQLVYAGRTAAAYLQFKVHGQFPLHDLMVEEAEPAYSFTVFSGNRCFLVAAPSDWQRDRWLEDISRAILAAKTKPSQAAEKSAEPIGIL-----NTDMKNTELTSASSDSELSQLLQRATTSVHVCWHRCFTVSMQDILRANEYETSGYLLRKFKNSNGWQRLWVVFTQNCLFFYKSYRDDCPLASLPLLGYTITTPSAGDQIKRDNVIKMQFKNHVYFFRGETHHSFERWFEYLSNAAGTSRRPK 793          
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Match: A0A074ZL75 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13660 PE=4 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 1.048e-168
Identity = 271/565 (47.96%), Postives = 375/565 (66.37%), Query Frame = 3
Query: 2775 DKSFHIIKEILMTERTYKRSLDIICIWFRKAVAS------GNVVDVN-SRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSK-TSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSS-----------------TIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILD-ERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            D ++ +I +++MTERTY R L ++C+ FR ++            DV+ +RLP  L+  +F LLDPI+ +H ++L + E RV    N++     S   S+R + G+         E++     S  Y + D+FL +L +IP Y+++  +AE ++L +++ +++NP L+  +R+FE QK+CY+P Y + L P HR+LQYR   ERL+R+  E H D+ DC+++  +L DL+Q  W++YK+ ENT KLLE+QRD+ G  S  +   + + +S+                  +  S R FIREGWLQKL KKGYQ RMFF+FSDQLVY  +     LQFKVHGQFPLHDLM+EE+EP +SFTV+SGNRCFLVAA S WQRDRWLEDISRAILAAK+  S      V+    L     N+D + TE +    D E  Q+ QR+ TSVHVCWHR  +++  +ILRANE E SGYLLRKFKNSNGWQ+LWVVFTQ CLFF+K Y+DD PLA+LPL+GY I  PS  DQI++D V K+QFKNHVYFFRG++ ++++RWFE L+ A G++ + K
Sbjct:  913 DTAYQLICDLVMTERTYGRDLSVVCVCFRHSLTCLDDELMSPCTDVHQARLPNDLATELFDLLDPIYVEHQKLLADFEARV----NSWNGRKISDDLSNRPSTGIHPLPLSPVAEQQ-----SSTYCIGDLFLSHLSMIPFYQRFMTNAERVMLLIEEALRSNPELEQQLRQFEAQKICYLPFYVFLLKPMHRLLQYRVTLERLMRYYSETHPDAPDCRVVHARLLDLIQSQWESYKRLENTYKLLEIQRDLTGLSSFPSALPDNVETSTKPQQTVATEDFSGPAAGPLIRSGRQFIREGWLQKLSKKGYQPRMFFLFSDQLVYAGRTAAAYLQFKVHGQFPLHDLMVEEAEPAYSFTVFSGNRCFLVAAPSDWQRDRWLEDISRAILAAKTKPSQAAEKSVEPMGIL-----NTDFKNTELTSASSDSELSQLLQRATTSVHVCWHRCFTVSMQDILRANEYETSGYLLRKFKNSNGWQRLWVVFTQNCLFFYKTYRDDCPLASLPLLGYTITTPSAGDQIKRDNVIKMQFKNHVYFFRGETHHSFERWFEYLSNAAGTSRRPK 1463          

HSP 2 Score: 285.419 bits (729), Expect = 3.148e-74
Identity = 132/207 (63.77%), Postives = 159/207 (76.81%), Query Frame = 3
Query:  570 IGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRV 1190
            IGDFLED Y D+TYLS L+L       FL KV ECHR L+GQSP+EAD+NLLDT RKVE YG+++HPA+D+  L L LAV+H GI+++Q   KI+ FSWA++RK+SFKRKRF IKLH E Y       EF+F+SR+ECK+FWKQCIEHHAFFRCQAV+Q   RR +++SKGSS+RYTGRTQKQL E VRE   K P FERS S  RV
Sbjct:    2 IGDFLEDIYVDHTYLSGLQLLPTTTVAFLKKVAECHRNLIGQSPAEADFNLLDTVRKVELYGLRMHPAKDNAGLKLNLAVAHSGILVYQASSKISSFSWARIRKVSFKRKRFLIKLHPETY----HAAEFVFDSRDECKSFWKQCIEHHAFFRCQAVRQSIPRRGRMVSKGSSFRYTGRTQKQLIEYVRENYVKMPHFERSASAGRV 204          
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Match: G7Y7U6 (FERM RhoGEF and pleckstrin domain-containing protein 2 OS=Clonorchis sinensis OX=79923 GN=CLF_102399 PE=4 SV=1)

HSP 1 Score: 556.214 bits (1432), Expect = 2.990e-168
Identity = 268/564 (47.52%), Postives = 372/564 (65.96%), Query Frame = 3
Query: 2775 DKSFHIIKEILMTERTYKRSLDIICIWFRKAVA------SGNVVDVN-SRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSS-----------------TIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILD-ERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            D ++ +I +++MTERTY R L ++C+ FR ++            D + +RLP  L+  +F LLDPI+ +H ++L   E RV   +N  +   +   S+R   G+         E++     S VY + D+FL +L +IP Y+++  +AE ++L +++ +++NP L+  +R+FE QK+CY+P Y + L P HR+LQYR   ERL+R+  E H D+ DC+++  +L DL+Q  W++YK+ ENT KLLE+QRD+ G     +   + + +S+                  +  S R FIREGWLQKL KKGYQ RMFF+FSDQLVY  +     LQFKVHGQFPLHDLM+EE+EP +SFTV+SGNRCFLVAA S WQRDRWLEDISRAILAAK+  S       +    L     N+D + TE +    D E  Q+ QR+ TSVHVCWHR  +++  +ILRANE E SGYLLRKFKNSNGWQ+LWVVFTQ CLFF+K+Y+DD PLA+LPL+GY I  PS  DQI++D V K+QFKNHVYFFRG++ ++++RWFE L+ A G++ + K
Sbjct:  858 DTAYQLICDLVMTERTYGRDLSVVCVCFRHSLTCLDDELGSPCTDAHEARLPNDLATELFDLLDPIYVEHQKLLASFEARVS-SWNGRK--ISDDLSNRPLTGIHPLPLSPVAEQQ-----SSVYCIGDLFLAHLSMIPFYQRFMANAERVMLLIEEALRSNPELEQQLRQFEAQKICYLPFYVFLLKPMHRLLQYRVTLERLMRYYSETHPDAPDCRVVHARLLDLIQSQWESYKRLENTYKLLEIQRDLTGLSCFPSALSDSVETSAKPQQTVVTEDLPGPAAGPLIRSGRQFIREGWLQKLSKKGYQPRMFFLFSDQLVYAGRTAAAYLQFKVHGQFPLHDLMVEEAEPAYSFTVFSGNRCFLVAAPSDWQRDRWLEDISRAILAAKTKPSQAAEKSAEPIGIL-----NTDMKNTELTSASSDSELSQLLQRATTSVHVCWHRCFTVSMQDILRANEYETSGYLLRKFKNSNGWQRLWVVFTQNCLFFYKSYRDDCPLASLPLLGYTITTPSAGDQIKRDNVIKMQFKNHVYFFRGETHHSFERWFEYLSNAAGTSRRPK 1408          

HSP 2 Score: 197.208 bits (500), Expect = 7.893e-47
Identity = 91/147 (61.90%), Postives = 111/147 (75.51%), Query Frame = 3
Query:  762 LHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIP 1202
            +HPA+D+  L L LAV+H GI+++Q   KI+ FSWA++RK+SFKRKRF IKLH E Y       EF+F+SR+ECK+FWKQCIEHHAFFRCQAV+Q   RR +++SKGSS+RYTGRTQKQL E VRE   K P FERS S  RV   P
Sbjct:    1 MHPAKDNAGLKLNLAVAHSGILVYQASSKISSFSWARIRKVSFKRKRFLIKLHPETY----HAAEFVFDSRDECKSFWKQCIEHHAFFRCQAVRQSIPRRGRMVSKGSSFRYTGRTQKQLIEYVRENYVKMPHFERSASAGRVLGGP 143          
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Match: A0A4V3SFK4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004083 PE=4 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 9.089e-168
Identity = 272/566 (48.06%), Postives = 375/566 (66.25%), Query Frame = 3
Query: 2772 MDKSFHIIKEILMTERTYKRSLDIICIWFRKAV-------ASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSR--SNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSS-----------------TIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            +D ++ +I +++MTERTY R L ++C+ FR ++        S       +RLP  L+  +F LLDPI+ +H ++L   E RV        S +  +  S   SN+ L T      L      +PS +Y + D+FL +L +IP Y+++  +AE I+L +++ +++NP L+  +R+FE QK+CY+P Y + L P HR+LQYR   ERL+R+  E H D+ DC+++  +L DL+Q  W++YK+ ENT KLLE+QRD++G  S  +   + + +S+                  +  S R FIREGWLQKL KKGYQ RMFF+FSDQLVY  +     LQFKVHGQFPLHDLM+EE+EP +SFTV+SGNRCFLVAA S WQRDRWLEDISRAILAAK+  S   +  V+    L     N+D + TE +     E  Q+ QR+ TSVHVCWHR  +++  +ILRANE E SGYLLRKFKNSNGWQ+LWVVFTQ CLFF+K+Y+DD PLA+LPL+GY I  PS  DQI++D V K+QFKNHVYFFRG++ ++++RWFE L+ A G++ + K
Sbjct: 1072 LDTAYQLICDLVMTERTYGRDLSVVCVCFRHSLTCLDDELVSPCTEAHEARLPNDLATELFDLLDPIYVEHQKLLASFEARV--------SSWNGRKVSDDLSNM-LSTGIHPLPLTPLAEQQPS-IYCIGDLFLAHLSMIPFYQRFMANAERIMLLIEEVLRSNPELEQQLRQFEAQKICYLPFYVFLLKPMHRLLQYRVTLERLMRYYSETHPDAPDCRVVHARLLDLIQSQWESYKRLENTYKLLEIQRDLMGLSSFPSALPDSVETSTKPQQTVATEDLPGPAAGPLIRSGRQFIREGWLQKLSKKGYQPRMFFLFSDQLVYAGRTAAAYLQFKVHGQFPLHDLMVEEAEPAYSFTVFSGNRCFLVAAPSDWQRDRWLEDISRAILAAKTKPSQAADKSVEPIGIL-----NTDMKNTELTSASDSELSQLLQRATTSVHVCWHRCFTVSMQDILRANEYETSGYLLRKFKNSNGWQRLWVVFTQNCLFFYKSYRDDCPLASLPLLGYTITTPSAGDQIKRDNVIKMQFKNHVYFFRGETHHSFERWFEYLSNAAGTSRRPK 1622          

HSP 2 Score: 442.195 bits (1136), Expect = 1.234e-125
Identity = 206/341 (60.41%), Postives = 254/341 (74.49%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIP 1202
            K I   V LLD + Q FH+  RA+GQ LY+ VI  LQL+E DYFDLEY+NK+G + WLDHLK + KQ T  KEY++ F +KFY P+PN+LEDE+TRYLFALQ+++D+  G L C+ +T ALL AFI Q  IGDFLED Y D+TYLS L+L       FL KV ECH  L+GQSP+EAD+NLLDT RKVE YG+++HPA+D+  L L LAV+H GI+++Q   KI+ FSWA++RK+SFKRKRF IKLH E Y       EF+F+SR+ECK+FWKQCIEHHAFFRCQAV+Q   RR +++SKGSS+RYTGRTQKQL E VRE   K P FERS S  RV   P
Sbjct:   22 KQIEACVILLDSTSQSFHLLPRALGQELYDLVIDHLQLVEYDYFDLEYVNKDGHTFWLDHLKPLHKQITAHKEYLYTFAVKFYTPHPNLLEDEFTRYLFALQVRKDLQTGRLTCSESTAALLAAFIVQGRIGDFLEDIYVDHTYLSGLQLLPTTTVAFLKKVAECHHNLIGQSPAEADFNLLDTVRKVELYGLRMHPAKDNAGLKLNLAVAHSGILVYQASSKISSFSWARIRKVSFKRKRFLIKLHPETY----HAAEFVFDSRDECKSFWKQCIEHHAFFRCQAVRQSIPRRGRMVSKGSSFRYTGRTQKQLIEYVRENYVKMPHFERSASAGRVLGAP 358          
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Match: A0A4E0RHY7 (Farp1 protein OS=Fasciola hepatica OX=6192 GN=D915_002862 PE=4 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 2.438e-165
Identity = 272/568 (47.89%), Postives = 378/568 (66.55%), Query Frame = 3
Query: 2775 DKSFHIIKEILMTERTYKRSLDIICIWFRKAVAS------GNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTT-ESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLS----------NGAHEKLNSSST------IFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKS--SSSLTGNG---IVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKS 4394
            D ++ +I +++MTERTY + L +IC  FR   ++         V  +S LPE  S ++F LLDP++ +H ++L  LE R+     ++      KTS  S++ +    E+  + E         VYRV D+F++N+ ++PLY+ Y    E ++L ++  I+ NP+L + +R FE QK CY+P Y + L P HR+LQYR   ERL+RH GE H D+ +C++   +L DL+Q  W++YK+ EN  KLLE+QRD+VG ++            NG     N+S++      +    R FIREGWLQKL KKGYQ R+FF+FSDQLVY ++     LQFKVHGQF LHDLMIEE+EP HSFTV+SGNRCFLVAA S WQRDRWLEDISRAILAAK+  +SS+  +    ++DSK  +++ +  +D               QI QR  TSVHVCWHR+ + +  +ILRANE + SGYLLRKFKNSNGWQ+LWVVFTQ CLFF+K+Y+DD PLA+LPL+GY+I  P  +DQIR+D V K+QFKNHVYFFRG++ +++++WFE L+ ATG++ +LK+
Sbjct: 1058 DGAYQLICDLVMTERTYGKDLSVICERFRSPPSAPPEEIAALSVPPSSHLPEDTSLKLFTLLDPVYGEHQKLLVNLEARL----TSWVEKRNKKTSDESSVSIPPNGEAAESTET--------VYRVGDLFVENMRMLPLYQNYLNDVEHLILDIEAAIRVNPILDEVMRNFEAQKFCYLPFYVFLLKPMHRLLQYRVTLERLMRHYGETHPDAPNCRIAHARLLDLIQSQWESYKRVENIHKLLEIQRDLVGLRAFPQISDAVDKTPNGDISITNTSASSTPWGPLLRLGRQFIREGWLQKLSKKGYQPRIFFLFSDQLVYASRTATACLQFKVHGQFQLHDLMIEEAEPAHSFTVFSGNRCFLVAAPSDWQRDRWLEDISRAILAAKTKPTSSMDADASFNMMDSKLSVLETSEATDTS-------------QILQRVTTSVHVCWHRSFTYSMQDILRANEYQTSGYLLRKFKNSNGWQRLWVVFTQNCLFFYKSYRDDCPLASLPLLGYIITTPGADDQIRRDNVIKMQFKNHVYFFRGETHHSFEKWFEYLSCATGTSRRLKT 1600          

HSP 2 Score: 444.121 bits (1141), Expect = 1.728e-126
Identity = 208/345 (60.29%), Postives = 253/345 (73.33%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPA 1214
            KY+   V  LD + + F +  RA+GQ LY+ V+  LQL+E DYFDLEY+NK G + WLDH+K + KQCT  KEY + F +KFY P+PN+LEDE+TRYLFALQIK+D+Y G L C+ +T ALL AFI Q+ IGDFLED Y D++YL  ++L      EFL KV+ECHR LVGQSP+EAD NLLDT RKVE YGI  HPA+D   L L LAV+H GI+I+Q   K+N FSWA++RKLSFKRKRF +KLH E Y       E++F SR+ECK+FWKQCIEHHAFFRCQAVK+   RR +++SKGSS+RYTGRTQKQL E VRE   K P FERS S  RV N    PA
Sbjct:   15 KYLEADVHFLDSTKKSFTLPTRALGQELYDMVVEHLQLVEYDYFDLEYMNKHGSTFWLDHMKPIQKQCTSNKEYQYTFSVKFYTPHPNLLEDEFTRYLFALQIKKDLYLGRLPCSESTAALLAAFIVQARIGDFLEDVYVDHSYLHGMQLFPSTTVEFLRKVVECHRNLVGQSPAEADCNLLDTVRKVEHYGIHTHPAKDSAGLKLGLAVAHLGIIIYQGNAKVNSFSWARIRKLSFKRKRFIVKLHPETY----HAEEYVFESRDECKSFWKQCIEHHAFFRCQAVKKPQHRRGRMVSKGSSFRYTGRTQKQLIEYVRENYVKMPPFERSSSTGRVFNTQLPPA 355          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:103028790])

HSP 1 Score: 423.32 bits (1087), Expect = 1.337e-126
Identity = 228/553 (41.23%), Postives = 323/553 (58.41%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLID-DNGNSDQQKTEK--------SKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEILMTERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKE++ R+ +                        E  SN   K         R+ D+ L+N+C +  +  Y +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DC+  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PLH +++EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI  +K S     + ++D    L D  N +SD+   E+        S+  LD+  Q   R+NT++HVCWHRN S++ ++   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +A ++
Sbjct:  541 PTDKAYFIAKEILMTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKEIDQRLAL-----------------------WEGRSNAHVK-----GDYQRIGDVMLRNMCALKEFTSYLQKHDEVLTELEKATKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPEHKDHHDCREALKEVAEIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMIVEESENEWSVPHCFTIYSAQRTIVVAASSKLEMTKWIEDLNMAIDMSKKSQE-KSDLLLDPS--LCDRSNRSSDEVSLEQESEDDVNSSRCSLDK--QSHHRANTTMHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPGEADSIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASTAGRV 1040          

HSP 2 Score: 308.916 bits (790), Expect = 8.760e-87
Identity = 153/348 (43.97%), Postives = 227/348 (65.23%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPK 1205
            K + +RV  LDD+ + F +  +A GQ +   V  ++ L+ESDYF LE+ N +    WL+  K +VKQ  +    +F+  +KF+ P P  L++E+TRYLF+LQ+KRD+ +G L C  NT ALL + + QSEIGD+  DE  D  +L   +L     E    K+ME HR  +GQ+P+E+D+ +L+ ARK+E YGI+ HPA D E   + L+V+H G+++ Q   KIN F+W+K+RKLSFKRKRF IKLH + +G  +D +EF+  SR++CK FWK C+EHH+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VR++  +R  ++R  S  R+S      +IPK
Sbjct:   48 KGLQIRVQGLDDAQEFFDLESKADGQTVLTDVYRRINLIESDYFGLEFQNLQMNWVWLEPTKLIVKQVRRPVNTLFRLSVKFFPPDPGQLQEEFTRYLFSLQMKRDLMEGRLYCTENTAALLASHLVQSEIGDY--DEVADREFLKLNKLLPH-QEHLQDKIMELHRRHLGQTPAESDFQVLEIARKLEMYGIRFHPAADREGTKINLSVAHMGLLVFQGNTKINTFNWSKIRKLSFKRKRFLIKLHPDVHGPHRDTLEFLMASRDQCKIFWKSCVEHHSFFRLLDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRDSGLRRTSYQRRNSKIRMSTRSLATDIPK 391          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:103028790])

HSP 1 Score: 417.157 bits (1071), Expect = 2.766e-124
Identity = 227/556 (40.83%), Postives = 317/556 (57.01%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLM-------IEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLI---LDERYQIQQ--RSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEILMTERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKE++ R+ +                        E  SN   K   +     R+ D+ L+N+C +  +  Y +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DC+  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PLH ++       +EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI  +K S           K  L+ D    D+     S  +   L  RY + Q  R NT  HVCW+RN +L+ T+ LR N+N+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +A ++
Sbjct:  541 PTDKAYFIAKEILMTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKEIDQRLAL-----------------------WEGRSNAHVKGDYQ-----RIGDVMLRNMCALKEFTSYLQKHDEVLTELEKATKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPEHKDHHDCREALKEVAEIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMILIVLDAPVEESENEWSVPHCFTIYSAQRTIVVAASSKLEMTKWIEDLNMAIDMSKKS---------QEKSDLLLDPSLCDRSNMFSSPAVSPELPPRYLLGQGQRPNTITHVCWYRNQNLSLTDYLRMNQNQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPGEADSIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASTAGRV 1039          

HSP 2 Score: 308.916 bits (790), Expect = 7.945e-87
Identity = 153/348 (43.97%), Postives = 227/348 (65.23%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPK 1205
            K + +RV  LDD+ + F +  +A GQ +   V  ++ L+ESDYF LE+ N +    WL+  K +VKQ  +    +F+  +KF+ P P  L++E+TRYLF+LQ+KRD+ +G L C  NT ALL + + QSEIGD+  DE  D  +L   +L     E    K+ME HR  +GQ+P+E+D+ +L+ ARK+E YGI+ HPA D E   + L+V+H G+++ Q   KIN F+W+K+RKLSFKRKRF IKLH + +G  +D +EF+  SR++CK FWK C+EHH+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VR++  +R  ++R  S  R+S      +IPK
Sbjct:   48 KGLQIRVQGLDDAQEFFDLESKADGQTVLTDVYRRINLIESDYFGLEFQNLQMNWVWLEPTKLIVKQVRRPVNTLFRLSVKFFPPDPGQLQEEFTRYLFSLQMKRDLMEGRLYCTENTAALLASHLVQSEIGDY--DEVADREFLKLNKLLPH-QEHLQDKIMELHRRHLGQTPAESDFQVLEIARKLEMYGIRFHPAADREGTKINLSVAHMGLLVFQGNTKINTFNWSKIRKLSFKRKRFLIKLHPDVHGPHRDTLEFLMASRDQCKIFWKSCVEHHSFFRLLDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRDSGLRRTSYQRRNSKIRMSTRSLATDIPK 391          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:103028790])

HSP 1 Score: 416.387 bits (1069), Expect = 5.440e-124
Identity = 228/560 (40.71%), Postives = 323/560 (57.68%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLM-------IEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLID-DNGNSDQQKTEK--------SKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEILMTERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKE++ R+ +                        E  SN   K         R+ D+ L+N+C +  +  Y +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DC+  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PLH ++       +EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI  +K S     + ++D    L D  N +SD+   E+        S+  LD+  Q   R+NT++HVCWHRN S++ ++   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +A ++
Sbjct:  541 PTDKAYFIAKEILMTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKEIDQRLAL-----------------------WEGRSNAHVK-----GDYQRIGDVMLRNMCALKEFTSYLQKHDEVLTELEKATKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPEHKDHHDCREALKEVAEIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMILIVLDAPVEESENEWSVPHCFTIYSAQRTIVVAASSKLEMTKWIEDLNMAIDMSKKSQE-KSDLLLDPS--LCDRSNRSSDEVSLEQESEDDVNSSRCSLDK--QSHHRANTTMHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPGEADSIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASTAGRV 1047          

HSP 2 Score: 309.301 bits (791), Expect = 7.529e-87
Identity = 153/348 (43.97%), Postives = 227/348 (65.23%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPK 1205
            K + +RV  LDD+ + F +  +A GQ +   V  ++ L+ESDYF LE+ N +    WL+  K +VKQ  +    +F+  +KF+ P P  L++E+TRYLF+LQ+KRD+ +G L C  NT ALL + + QSEIGD+  DE  D  +L   +L     E    K+ME HR  +GQ+P+E+D+ +L+ ARK+E YGI+ HPA D E   + L+V+H G+++ Q   KIN F+W+K+RKLSFKRKRF IKLH + +G  +D +EF+  SR++CK FWK C+EHH+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VR++  +R  ++R  S  R+S      +IPK
Sbjct:   48 KGLQIRVQGLDDAQEFFDLESKADGQTVLTDVYRRINLIESDYFGLEFQNLQMNWVWLEPTKLIVKQVRRPVNTLFRLSVKFFPPDPGQLQEEFTRYLFSLQMKRDLMEGRLYCTENTAALLASHLVQSEIGDY--DEVADREFLKLNKLLPH-QEHLQDKIMELHRRHLGQTPAESDFQVLEIARKLEMYGIRFHPAADREGTKINLSVAHMGLLVFQGNTKINTFNWSKIRKLSFKRKRFLIKLHPDVHGPHRDTLEFLMASRDQCKIFWKSCVEHHSFFRLLDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRDSGLRRTSYQRRNSKIRMSTRSLATDIPK 391          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Match: FARP1 (FERM, ARH/RhoGEF and pleckstrin domain protein 1 [Source:NCBI gene;Acc:103041913])

HSP 1 Score: 371.703 bits (953), Expect = 1.437e-108
Identity = 207/550 (37.64%), Postives = 305/550 (55.45%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPT----HSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAK-----SSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            P DK++ I KE+L TERTY + L++I + F+      NV+D     PE L   +    +P+H  H+  LKELE R                     L L    S ++++  +        R+ D+ L+N   + L     +     +  L++  + +  L++  R FE+QKVCY+PL  + L P HR+L Y+Q  ERL +H    H D +DC+  L  + +L   L  +  KT+N  +LLELQ+D++G  +L+                 R FIR G L KL  KG QQRMFF+FSD L+YT++   +  QFKVHGQ PL  + I ESE      H FT+ +  +  +VAA S  + ++W+ED+  A+  A+     S+S LT +  V S      +  + D     ++ L          R NT+VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT   LFF+K +QD+ PLA+LPL+GY +  P+  + I KD+VFKL FK+H+Y+FR +S+Y+++RW E +  AT S+++ +
Sbjct:  509 PTDKAYFIAKELLTTERTYLKDLELITLSFQ------NVLDKEECAPESLKSLLKSSFEPLHTYHSDFLKELEQR---------------------LALWEGRSNAHIKGDYQ-------RIGDVMLKNTQGLKLLTAQLQKHSECVTELEKACRASRRLENVCRDFELQKVCYVPLNVFILRPLHRLLHYKQILERLCKHYPATHSDFRDCRAALADVSELEALLHSSMLKTDNYQRLLELQKDLIGVDNLATPT--------------REFIRLGCLSKLSGKGLQQRMFFLFSDVLLYTSRGITSSNQFKVHGQLPLRGMTIRESEEEWGVPHCFTLVTQRQSVVVAAGSVSEMEKWMEDLKMAVDLAEDSNGPSASLLTNSNDVKSPGEWASEVESEDDLGGSRTSLERHGNSSAHHRGNTTVHVCWHRNTSVSMLDFSIATENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKTHQDEYPLASLPLLGYSVTVPAESENIHKDYVFKLHFKSHIYYFRSESEYSFERWMEVIRSATISSSRTR 1010          

HSP 2 Score: 295.819 bits (756), Expect = 1.259e-82
Identity = 147/331 (44.41%), Postives = 222/331 (67.07%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAE-GYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            +++ +RV +LD+S + F +S RA G+ L++ V A L L+E DYF LEY ++  ++ WLD LK ++KQ  + K  + +F +KF+ P    L +E TRYLFALQI++D+  G L C  ++ ALL++ I QSEIGD+ E +   +   ++    + A    + K+ME H+  VGQ+P+E+DY LL+ AR++E YGI+LHPA+D E   L L+V+H G+++ Q   KIN F+W+KVRKLSFKRKRF IKL  +     ++D +EF+  SR+ CK FWK C+E+HAFFR    +   K +  + S+GSS+R++GRTQKQ+ + V++T YK+  F R
Sbjct:   38 RHVPIRVRMLDESEEIFDISQRASGKVLFDLVCAHLNLIEGDYFGLEYQDQRKMTVWLDLLKPIMKQLRRPKHTVLRFVVKFFPPDHAQLMEELTRYLFALQIRQDLATGRLTCTDSSAALLVSHIIQSEIGDYEEAQCRQHLLNNNYIPDQMA---LMDKIMEFHQKHVGQTPAESDYQLLEVARRLEMYGIRLHPAKDREGTKLSLSVAHTGVLVFQGHTKINAFNWSKVRKLSFKRKRFLIKLRPDLNQSAYQDTLEFVMASRDCCKVFWKICVEYHAFFRLFE-EPKPKPKPVLFSRGSSFRFSGRTQKQVIDYVKDTEYKKLPFNR 364          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:103028790])

HSP 1 Score: 309.301 bits (791), Expect = 2.590e-87
Identity = 153/348 (43.97%), Postives = 227/348 (65.23%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVS------NIPK 1205
            K + +RV  LDD+ + F +  +A GQ +   V  ++ L+ESDYF LE+ N +    WL+  K +VKQ  +    +F+  +KF+ P P  L++E+TRYLF+LQ+KRD+ +G L C  NT ALL + + QSEIGD+  DE  D  +L   +L     E    K+ME HR  +GQ+P+E+D+ +L+ ARK+E YGI+ HPA D E   + L+V+H G+++ Q   KIN F+W+K+RKLSFKRKRF IKLH + +G  +D +EF+  SR++CK FWK C+EHH+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VR++  +R  ++R  S  R+S      +IPK
Sbjct:   48 KGLQIRVQGLDDAQEFFDLESKADGQTVLTDVYRRINLIESDYFGLEFQNLQMNWVWLEPTKLIVKQVRRPVNTLFRLSVKFFPPDPGQLQEEFTRYLFSLQMKRDLMEGRLYCTENTAALLASHLVQSEIGDY--DEVADREFLKLNKLLPH-QEHLQDKIMELHRRHLGQTPAESDFQVLEIARKLEMYGIRFHPAADREGTKINLSVAHMGLLVFQGNTKINTFNWSKIRKLSFKRKRFLIKLHPDVHGPHRDTLEFLMASRDQCKIFWKSCVEHHSFFRLLDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRDSGLRRTSYQRRNSKIRMSTRSLATDIPK 391          

HSP 2 Score: 264.233 bits (674), Expect = 2.259e-72
Identity = 160/452 (35.40%), Postives = 241/452 (53.32%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLM-------IEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLID-DNGNSDQQKTEK--------SKLILDERYQIQQRSNTSVHVCWHRNCSLAFTE 4064
            P DK++ I KEILMTERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKE++ R                     L L    S ++++  +        R+ D+ L+N+C +  +  Y +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DC+  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PLH ++       +EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI  +K S     + ++D    L D  N +SD+   E+        S+  LD+  Q   R+NT++HVCWHRN S++ ++
Sbjct:  541 PTDKAYFIAKEILMTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKEIDQR---------------------LALWEGRSNAHVKGDYQ-------RIGDVMLRNMCALKEFTSYLQKHDEVLTELEKATKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPEHKDHHDCREALKEVAEIAAQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLHGMILIVLDAPVEESENEWSVPHCFTIYSAQRTIVVAASSKLEMTKWIEDLNMAIDMSKKSQE-KSDLLLDPS--LCDRSNRSSDEVSLEQESEDDVNSSRCSLDK--QSHHRANTTMHVCWHRNTSVSMSD 939          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002191.1 (pep scaffold:Pmarinus_7.0:GL484618:8047:12162:-1 gene:ENSPMAG00000001987.1 transcript:ENSPMAT00000002191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.922 bits (668), Expect = 3.959e-79
Identity = 138/284 (48.59%), Postives = 186/284 (65.49%), Query Frame = 3
Query: 3585 FIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSS----SSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLI-------LDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            F+REG L KL +KG QQRMFF+FSD L+YT++   +  QFKVHG+ PL  + + ESE      + FT+ + ++  +VAA+S+ + D+W+EDI+ AI   K S    SS   NG  D  KF    N +SD+   E              +R     R+NT++ VCWHRN S++  ++ RA EN+LSGYLLRKFKNS+GWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY I  P+  D I+KD+VFKLQFK+H+YFFR +S Y+  RW E +  AT SA + +
Sbjct:    3 FVREGCLNKLTRKGLQQRMFFLFSDLLIYTSRAPTSTNQFKVHGRLPLVAMKVRESEQEFGVPYCFTISTPHKSIVVAASSRVELDKWMEDIALAIELMKKSNTHPSSPLENGFSD--KF----NRSSDELSLEPESEEDLNPAPGSPDRQAAGHRANTTMQVCWHRNTSISMLDLNRAVENQLSGYLLRKFKNSSGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYSITVPTEADAIQKDYVFKLQFKSHIYFFRAESGYSCRRWMEVIRSATSSAGRTR 280          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Match: farp2 (FERM, RhoGEF and pleckstrin domain protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2993])

HSP 1 Score: 239.195 bits (609), Expect = 8.080e-65
Identity = 135/336 (40.18%), Postives = 189/336 (56.25%), Query Frame = 3
Query: 3432 LVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHG-------QFPLHDLMIEESEPTHS----FTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLI-----DDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            L+ GL D     EN  KL+ELQRD+   + L+                 R FIREG L KL +KG QQRMFF+  +      KL      F+V G       QF L+ L I  SE   S    FT+ +  +  +VAANS  + D+W+ED++ A      +  L    +  +          +D+   +            ER  + Q+++++V VC HR  S++  +I RA EN+LSGYLLRKFKN++GWQKLWVVFT  CLFF+K +QD+ PLA+LP++GY I  PS  D I KD+VFKLQFK+H+YFFR +S+YT++RW E +  AT S+ + +
Sbjct:  680 LLGGLQDTLLHLENVQKLMELQRDLTDMEDLAMPG--------------REFIREGCLHKLTRKGLQQRMFFLIIESAEIFYKL------FEVGGRHVEALKQFALYHLRITASEREFSIPCSFTLSTPQKHVVVAANSPEEMDKWVEDVTLAASLPPPTPPLREKPVAPTPPPPDSSDDQEDSAEDEAASPRSPHGASSERLSVHQQTSSTVQVCCHRQTSVSLLDISRAAENQLSGYLLRKFKNNSGWQKLWVVFTNFCLFFYKTHQDNFPLASLPVLGYSITLPSESDGILKDYVFKLQFKSHIYFFRAESEYTFERWMEVIRSATSSSARTR 995          

HSP 2 Score: 238.039 bits (606), Expect = 1.745e-64
Identity = 135/337 (40.06%), Postives = 198/337 (58.75%), Query Frame = 3
Query:  243 RAIGQHLYNQVIAKLQLLESDYF--DLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYT-RYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLED----EYDDYTYLSSLRLTKQANEEFLM-KVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRY--TGRTQKQLQECVRETSYKRPQFERSLSMSRVSN----IPKSP 1211
            +A G  L   V   L L+ESDYF  +LE   K G + WLD  K + KQ    K  +F+ G+KF+    + L++E T RY FALQ+++D+  G L  +  +++L+ A + Q+++ D+ E     +  +  YL         N+E L  ++++ HR   G SP+EAD  LL+ AR+ ++YG++LH A D E   + LAV + G+ + QN  KIN F+WAK+RKLSFKRK F +K H +  G ++D +EF    R+ CK FWK C+E HAFFR Q   +  K +S + S+GSS+RY  +GRTQKQ+   VR+   +R QFER  +  R S     IP  P
Sbjct:    1 KAEGIALLTTVYKYLNLVESDYFGLELEPYPKCGFTVWLDSQKPIAKQVKNTKNVVFKLGVKFFPEDSSQLQEEITSRYQFALQVRQDLLAGRLVASEMSSSLMAACLLQADVSDYEEQRSSQQLREVQYL--------PNQEVLANRILDYHRQFAGLSPAEADVQLLEIARRQDTYGLRLHQAYDKEGASINLAVGYSGVSVFQNTTKINTFNWAKIRKLSFKRKYFLVKFHPDIEGNYQDTLEFSMKGRDACKAFWKGCVESHAFFRLQDPPR-PKPKSVLFSRGSSFRYRLSGRTQKQVSMYVRDHGSRRVQFERRSTKMRSSQSHRAIPAHP 328          

HSP 3 Score: 52.373 bits (124), Expect = 1.009e-6
Identity = 26/78 (33.33%), Postives = 43/78 (55.13%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMV 3002
            P DK++ I KEI  TERT+ + L++I +WF       + +   S +   LS ++F    P+ + H   LKE+E R+ +
Sbjct:  499 PADKAYFIAKEICTTERTHIKDLEVITVWF------SSFLGQESPMSRELSSKLFSSFQPLCDFHRTFLKEVETRLTL 570          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.098 bits (575), Expect = 8.029e-61
Identity = 124/347 (35.73%), Postives = 194/347 (55.91%), Query Frame = 3
Query:  147 QTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSC-WLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQ--AVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLS 1178
            +TS L R          + LLD++      +    G+ L + V A L L E+DYF L++ +    +  WLD  K + KQ  +   YIF F +KF+   P+ L++EYTRY + LQ++ DI +  L C  NT ALL ++I QSE+GD+ E E+    YLS LR   +   +F  +V + H+  VG +P++A++N L+ A+ VE YG++LH ARD  N+ + + V+  G+ ++ N ++I+ F W K+ K+ FK K F+++L  E     ++I+ F   +   CK  WK C+EHH FFR    A        ++  S GS +RY+GRT+ Q  +  +E S +   F RS S
Sbjct:   16 RTSELARDRHRTEALCHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLP-GYLSDLRFLPRQGLDFEKEVAKLHKQHVGMTPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASPPHLGFLAQYFSLGSKFRYSGRTEMQTVQYGKERSNRNRNFARSPS 361          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 200.29 bits (508), Expect = 1.879e-56
Identity = 118/376 (31.38%), Postives = 196/376 (52.13%), Query Frame = 3
Query:  243 RAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIF--NSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQ---LQECVRETSYKR---PQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGML 1346
            +A+GQ L++QV+  L +LE DYF L++++   VS WLDH K + KQ      Y F   +KFY+  PN L +E TRYLF LQ+K+DI  G L+C   T   L  +  Q+E+GD    E++    +S  R     +EE    ++E  +   GQ+P++A+ N L+ A+ +E YG+ +H  +  +     L ++  G+++ +   KI +F W K+ +L FKR +  + +  +     +    F+F  +    CK+ WK  +EHHAFFR +   + +   S  +  GS +R++GRT+ Q   + +  R +S++R    ++ R  S  + +  PK    S+ P+R T L  +S   +          R  VPV    P G +
Sbjct:    2 KAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNP-ALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQATKVSKARRTSSFERRPSKRYTRRASFQK-AEAPKRTVISI-PSRLTHLFKSSSMPWN---------RPTVPVAAPIPSGHI 365          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 197.593 bits (501), Expect = 1.269e-55
Identity = 118/374 (31.55%), Postives = 189/374 (50.53%), Query Frame = 3
Query:  243 RAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIF--NSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQEC--VRETSYKRPQFER--SLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGML 1346
            +A+GQ L++QV+  L +LE DYF L++++   VS WLDH K + KQ      Y F   +KFY+  PN L +E TRYLF LQ+K+DI  G L+C   T   L  +  Q+E+GD    E++    +S  R     +EE    ++E  +   GQ+P++A+ N L+ A+ +E YG+ +H  +  +     L ++  G+++ +   KI +F W K+ +L FKR +  + +  +     +    F+F  +    CK+ WK  +EHHAFFR +   + +   S  +  GS +R++GRT+ Q  +    R TS     FER  S   +R ++  K      +   H     N   H +   N     R  VPV    P G +
Sbjct:    2 KAVGQDLFDQVMYHLDILEVDYFGLQFMDSAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNP-ALVSEFRFIPSQSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRLRGPSKTNADPSSFIRMGSRFRFSGRTEFQATKVSKARRTS----SFERRPSKRYTRRASFQKGNVVKTVDLNHRSPEKNRNQHTQQPWN-----RPTVPVAAPIPSGHI 365          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Match: EDO33626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRN5])

HSP 1 Score: 334.724 bits (857), Expect = 9.247e-95
Identity = 202/594 (34.01%), Postives = 304/594 (51.18%), Query Frame = 3
Query: 2781 SFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPT----HSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLT------GNGIVDSKK-----FLIDD------------------------------------------NGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLK 4391
            +++I KE+L TERTY + L++I I FR+ V+S  V      LPE   K +F  +DPI++ H   L ELE R+ +    +   +T+ T +                     EP    R+ D+  +N+  I  Y  + +  + ++L L+   K     +   ++FE QK+CY+PL A+ L P+ R+L YR   ERLL++   +  DS+D +  L +L   V+   ++ KK EN  K++ELQRD++G  +L               +  R FIREG LQK+ +KG Q RMFF+FSD L+YT K      QF+V GQ PLH + +E++ P       F +   N+   VAA S+ ++ +WLED+   +  AK S+S +       N +V +       +L D+                                          +G SD      S +   +R      + ++  VCWHRN S++  E   +  N++SG LLRKFK  N WQKLWVVFT  CLFF+K ++D+ PLA LPLIGY + +PS  D I KD VFKLQ+K HVYFFR +++Y++ RW E +  AT  + + +
Sbjct:  698 AYNIAKELLNTERTYVKDLEVITIAFREVVSSPGV------LPEATKKLLFSTIDPIYDFHCAFLSELEERMTL----WDQSFTTSTGT---------------------EP----RIGDLMHKNMKQIKRYVHHLKKHDEVMLELEAATKKFKQFELAYKEFETQKICYLPLNAFLLKPSQRLLHYRFLLERLLKYCVRDSEDSQDIQGALEELVGAVKSTEESMKKLENFQKIIELQRDLIGVDNL--------------VQQGREFIREGCLQKMTRKGPQPRMFFLFSDLLLYTCKGVTLTNQFRVRGQIPLHTVKLEDTGPELHGLFPFNINFSNKHMTVAAPSEEEKYKWLEDLQVVVRQAKESASCSQCLYNRANMMVKAPNLHGTTYLCDECYIINNEDDDSCRNGESDHHVVGRVGKIFPLPTPVNIHRSFSDGESDDDAAVTSPVTSLDRRHAHCHTMSTRRVCWHRNTSVSMHEHALSVRNQMSGDLLRKFKTGNRWQKLWVVFTNFCLFFYKTHEDEFPLANLPLIGYTVDRPSEGDNIEKDLVFKLQYKTHVYFFRSENEYSFHRWMEVIASATQGSTRTR 1242          

HSP 2 Score: 308.145 bits (788), Expect = 5.110e-86
Identity = 157/360 (43.61%), Postives = 230/360 (63.89%), Query Frame = 3
Query:  192 VRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYT----YLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNS 1259
            V+V +LDDSV  F +  +  G  LY QV   L L E +YF L Y +K     WLD LK + KQ  +  + +F+F +KFY   P ML++EYTRYLFALQ+K+D+  G L+C+ +T ALL +++ Q E+GDF     D  +    YL+  +   +   +   ++ + H+     SP++ DYNLLD AR++E YG+ L+PA+D +N+ L+LA ++ GI++ Q+  KIN  SWAK+RKLSFKRKRF IKLH E +G++KD+VEF   SRN CK+FWK  I  HAFFR    +   + R +V S+GSSYR++GRTQKQ+ + ++++   +P F+R+ S+       K+PA + LP  HT  +S S
Sbjct:   25 VKVCMLDDSVVKFDIEPKVKGDILYKQVYEYLNLDEREYFGLSYYDKSDNLFWLDQLKPIKKQVKEIGKVLFRFCVKFYTADPAMLQEEYTRYLFALQVKKDLVNGGLKCSESTAALLASYVVQGELGDF-----DTLSCRPGYLADFQFFPEQTVDSEARISDFHKQHRSLSPTDCDYNLLDVARRLEMYGVILYPAKDKDNVDLELAAANMGIIVFQSGSKINTLSWAKIRKLSFKRKRFLIKLHPEIFGHYKDVVEFQMASRNACKSFWKVAISTHAFFRQSESQSPPRHRPRVFSRGSSYRFSGRTQKQIIDSMQDSFRSQPSFQRTQSL-------KTPARNNLP--HTSQSSAS 370          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 226.483 bits (576), Expect = 5.051e-61
Identity = 124/334 (37.13%), Postives = 185/334 (55.39%), Query Frame = 3
Query:  198 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKE-------GVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLS 1178
            V LLDDS     V   A G  L N+V   L + E  YF L+Y++             WL   K + KQ      YIF F ++F+   P+ L ++ TRY F LQIKRDI  G L C  +T A L ++I Q+E+GD+    + D  Y+S  R      ++F  +  E H+  +GQ+P++A++N L+ A+ ++ YG+ LH A+DH+   L L VS  G+ ++ N+ KIN F W+K+ K+ FKRKRF+I++  +   +  +I+ F   +   CKN WK C+E+H+F+R    K   KR   VL  GS YRY G+T+ Q  E  R  +   P+  R+LS
Sbjct:   39 VELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQEKHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDPSKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLD-GYVSEFRFIPDQTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFIQIRPDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYPKATEKR---VLRMGSKYRYKGKTEYQAIEESRTHARPEPKIVRTLS 368          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 204.142 bits (518), Expect = 1.104e-58
Identity = 106/279 (37.99%), Postives = 159/279 (56.99%), Query Frame = 3
Query:  198 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYT--YLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 1028
            + LLD+S     ++    G  +  +V   L LLE DYF L +I K   S WLD +K V KQ      Y+  F +KFYA  PN L +E TRYLF LQ+KRDI+QG   C I+   L+ +FI  +E+GDF   +Y  YT  Y+S  R   +  E+   K+ +CH+ L+G  PS A+Y  LD A+ +E YG+ LH  +  + +   +A+   G+V++ N+  +  + W K+ K+ FK K+F   L+ +G    + +  F   +++ CK+ WK C+EHHAFFR
Sbjct:   15 IVLLDESEFPIEITKSTKGFEVLEKVFDHLNLLERDYFGLRFIEKNTQSRWLDPMKSVTKQLKAGPPYLMYFCVKFYAADPNKLHEELTRYLFFLQVKRDIFQGSAPCEIHADTLISSFILLAELGDF---DYQSYTPGYVSEFRFVPKQTEDLEEKISDCHKRLIGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTYLWQKITKIDFKGKKF--SLNVQGKEDREYVYVFYLPNKSACKHLWKCCVEHHAFFR 288          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 193.741 bits (491), Expect = 4.182e-55
Identity = 107/293 (36.52%), Postives = 166/293 (56.66%), Query Frame = 3
Query:  165 RANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKE-YIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAE----GYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 1028
            ++NL     V+++LLDD+         A GQ +++ V   L L+E DYF L Y++      WLD  K V+KQ    K  +   F +KFYA  P ++ +E TRY   LQIKRDI  G L C+ N  A L A+I Q+E+GD+  ++ +D  Y+S  R+  + +E+   K+ + HR+L GQ PS A+ N LD  + ++ YG+  HP +D +N+ L L ++  GI I ++  K++ F WA++ K S++ K FY+++H +     YG       F       CK+ WK  +EHHAF+R
Sbjct:    7 KSNLDAEFVVKISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDSKQRHWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDPGLIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQED-NYVSEFRIVPKQSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYVQVHKDDRKANYG-------FRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 184.496 bits (467), Expect = 1.822e-50
Identity = 114/347 (32.85%), Postives = 178/347 (51.30%), Query Frame = 3
Query:  252 GQHLYNQVIAKLQLLESDYFDLEYIN-KEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHA--EGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFE---------RSLSMSRVSNI--------PKSPASSVLPT 1232
            G HL++QV   + L E +YF L YI+ K+G   WL+  + + +Q  +   + F F +KFY   P  L ++ TRY F LQ++ D+ +G +QC+    ALL +++ Q+E+GD   +E++   YLS L+   +   E   K+   HR  VG +PS+A++  LD  RK+  YG  ++ A   E   + +A+S  G+ + QN  +++ F W K+  + FK K+F + L A  E   Y    + F   S+   K  WK C+EHHAFFR +      K  +     GS +RY+GRTQ Q +        ++P F+         R L  +R S +        PKSP   V P 
Sbjct:   30 GDHLFDQVCDHIGLAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMGKAPLH-FYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHE-VAYLSDLKFFPKQPPELRQKIEAFHRKHVGMTPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRLKEPVPLPK-NTNFFKIGSKFRYSGRTQHQARNNESVGVREQPSFDRVSSKRFSLRVLDSNRKSMLIDDDAKKEPKSPEHPVTPV 373          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:101173454])

HSP 1 Score: 415.616 bits (1067), Expect = 9.659e-124
Identity = 227/553 (41.05%), Postives = 318/553 (57.50%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAI-LAAKS---SSSLTGNGIVD-----SKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEIL TERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKEL+ R+ +                        E  SN   K   +     R+ D+ L+N+C +  +  + +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DCK  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PL  +++EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI LA KS   SS     G  D     S +  ++     D   +  S   LD+  Q   R+NT++HVCWHRN S++ ++   A EN+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +  ++
Sbjct:  544 PTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKELDQRLAL-----------------------WEGRSNAHVKGDYQ-----RIGDVMLKNMCALKEFTSFLQKHDEVLTELEKASKRLKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPAHRDFDDCKKALKEVAEIATQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLQGMIVEESENEWSVPHCFTIYSAQRTIVVAASSKVEMGKWIEDLNMAIDLAKKSQEKSSFFLDAGFGDRSNRSSDEVSLEQESEDDMSSSHTS---LDK--QTHHRANTTMHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPEESDGIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASTTGRM 1043          

HSP 2 Score: 309.686 bits (792), Expect = 5.140e-87
Identity = 153/346 (44.22%), Postives = 226/346 (65.32%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER---SLSMSR---VSNIPK 1205
            + VRV  LDDS + F +  +A GQ L  +V  +  L+ESDYF LE+ N + +  WL+  K + KQ  +    +F+  +KF+ P P  L++EYTRYLF+LQ+KRD+ +G L C+ NT ALL + + QSEIGD+ +    D+   +SL   +   +E    +ME HR  +GQ+P+E+D+ +L+ ARK+E YG++ HPA D E   + LAV+H G+ + Q   KIN F+W+K+RKLSFKRKRF IKLH E +G  +DI+EF+  SR++CK FWK C+E+H+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VRE   KR  ++R    + MS     +++PK
Sbjct:   50 LQVRVKGLDDSQEFFDIDPKAFGQTLLTKVFLRGNLMESDYFGLEFQNMQMMWVWLEPTKPIAKQVRKPANTLFRLSVKFFPPDPGQLQEEYTRYLFSLQMKRDLMEGRLICSENTGALLASHLVQSEIGDYDDVADRDFLKANSLLPYQDKVQEI---IMELHRRHLGQTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLAVAHMGLQVFQGHTKINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQDILEFLMASRDQCKVFWKICVEYHSFFRLFDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRENGPKRTPYQRRNSKIGMSTRSYTTDVPK 391          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Match: farp2 (FERM, ARH/RhoGEF and pleckstrin domain protein 2 [Source:NCBI gene;Acc:101173454])

HSP 1 Score: 414.846 bits (1065), Expect = 1.747e-123
Identity = 228/549 (41.53%), Postives = 313/549 (57.01%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESE----PTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDE---RYQIQQ--RSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKL 4388
            P DK++ I KEIL TERTY + L++I +WFR AV   N       +PE L   +F  +DPI+E H   LKEL+ R                       L   E  SN   K   +     R+ D+ L+N+C +  +  + +  + +L  L++  K    L+   ++FE+QKVCY+PL  + L P  R++ Y+   ERL +H    H D  DCK  L ++ ++   L  +  + EN  KL ELQRD++G ++L+                 R FIREG L KL KKG QQRMFF+FSD L+YT+K      QFKVHGQ PL  +++EESE      H FT+YS  R  +VAA+S+ +  +W+ED++ AI  AK S          S  FL  D G  D+     S     E   RY + Q  R NT  HVCW+RN +L+ ++ LR N+N+LSGYLLRKFKNSNGWQKLWVVFT  CLFF+K +QDD PLA+LPL+GY +  P   D I K++VFKLQFK+HVYFFR +S+YT++RW E +  A  +  ++
Sbjct:  544 PTDKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENA------MPEGLMTLLFSNIDPIYEFHRGFLKELDQR-----------------------LALWEGRSNAHVKGDYQ-----RIGDVMLKNMCALKEFTSFLQKHDEVLTELEKASKRLKKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILERLCKHYSPAHRDFDDCKKALKEVAEIATQLQSSLIRLENFQKLTELQRDLIGIENLTAPG--------------REFIREGCLYKLTKKGLQQRMFFLFSDMLLYTSKGVTATNQFKVHGQLPLQGMIVEESENEWSVPHCFTIYSAQRTIVVAASSKVEMGKWIEDLNMAIDLAKKSQE-------KSSFFL--DAGFGDRSNLFGSPAATPELPPRYLLGQGQRPNTITHVCWYRNQNLSLSDYLRMNQNQLSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPEESDGIHKEYVFKLQFKSHVYFFRAESEYTFERWMEVIKSAASTTGRM 1035          

HSP 2 Score: 310.071 bits (793), Expect = 3.740e-87
Identity = 153/346 (44.22%), Postives = 226/346 (65.32%), Query Frame = 3
Query:  186 IGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER---SLSMSR---VSNIPK 1205
            + VRV  LDDS + F +  +A GQ L  +V  +  L+ESDYF LE+ N + +  WL+  K + KQ  +    +F+  +KF+ P P  L++EYTRYLF+LQ+KRD+ +G L C+ NT ALL + + QSEIGD+ +    D+   +SL   +   +E    +ME HR  +GQ+P+E+D+ +L+ ARK+E YG++ HPA D E   + LAV+H G+ + Q   KIN F+W+K+RKLSFKRKRF IKLH E +G  +DI+EF+  SR++CK FWK C+E+H+FFR     Q  K ++ + ++GSS+RY+GRTQKQL + VRE   KR  ++R    + MS     +++PK
Sbjct:   50 LQVRVKGLDDSQEFFDIDPKAFGQTLLTKVFLRGNLMESDYFGLEFQNMQMMWVWLEPTKPIAKQVRKPANTLFRLSVKFFPPDPGQLQEEYTRYLFSLQMKRDLMEGRLICSENTGALLASHLVQSEIGDYDDVADRDFLKANSLLPYQDKVQEI---IMELHRRHLGQTPAESDFQILEIARKLEMYGVRFHPAADREGTKINLAVAHMGLQVFQGHTKINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQDILEFLMASRDQCKVFWKICVEYHSFFRLFDQPQ-PKSKAILFTRGSSFRYSGRTQKQLVDYVRENGPKRTPYQRRNSKIGMSTRSYTTDVPK 391          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Match: FARP1 (FERM, ARHGEF and pleckstrin domain-containing protein 1 [Source:NCBI gene;Acc:101165518])

HSP 1 Score: 365.54 bits (937), Expect = 3.239e-106
Identity = 206/558 (36.92%), Postives = 312/558 (55.91%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNL-CIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSS----SSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKSTPSAQIH 4415
            P D+++ + KE+L TERTY + L+++ + F+ AV            P+ L + +    +P+H+ HT  L+E+E R                     L L    S ++++  +        R+ D+ L+NL  + PL     + +E +LL L++  K +  +    R FE+QKVCY+PL  + L P HR++ Y+Q  E L +H    H+D +DC+  L ++ ++V  L     + EN  KLLEL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT +      QF+VHGQ PL  L I ESE      ++FT+    +  +VAA+S  + ++W++DI  A+  AK+S    S L    + D+K +  D +  ++ +    +     ER     R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT   LFF+K++QDD PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +S+YT+ RW E +  AT  +++ ++  S + H
Sbjct:  528 PTDRAYFMAKELLTTERTYLKDLEVVTVSFQSAVGQDEAT------PDSLKETLLSTFEPLHKFHTGFLREVEQR---------------------LALWEGRSNAHIKGDYQ-------RIGDVMLKNLQALKPLTVNLSKQSE-VLLKLEKACKASRRMDSLCRDFELQKVCYVPLNVFILRPLHRLIHYKQILESLCKHYPATHVDFRDCRAALAEVSEVVDQLQGNLVEMENLQKLLELKKDLIGVDNLVVPG--------------REFIRLGCLSKLSGKGLQQRMFFLFNDVILYTTRGMTPTNQFRVHGQLPLRGLTIRESEDEWGVPYAFTLAGQGQSVVVAASSLTEMEKWMDDIKMAVQMAKTSNGPLSDLLTPSLADNK-YPEDSSVEAESEDDMTASHTTLER-PAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDDYPLASLPLLGYSVTIPSDNENIHKDYVFKLHFKSHVYYFRSESEYTFGRWMEVIRSATIPSSRGRALNSKEAH 1034          

HSP 2 Score: 304.294 bits (778), Expect = 1.996e-85
Identity = 158/373 (42.36%), Postives = 240/373 (64.34%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSM----SRVSNIPKSPASSVLPTR----HTRLASNSYAHYK 1274
            + + +RV +LDD+ + F VS +A G+ L++ V + + L+E DYF LEY N + +  WLDH+K + KQ  + K  I +F +KF+ P    L +E TRYLFALQIK+D+  G L CN ++ AL+++ I QSEIGDF E +   +  L++  +  Q     + K+ME H   +GQ+P+E+DY +L+ ARK++ YGI+LHPA+D +   L LAV+H G+++ Q   +IN F+W+K+RKLSFKRKRF IKL  +    ++D +EF+  SR+ CK FWK C+EHHAFFR    +   K +  + ++GS +R++GRTQKQ+ + V+E+ +K+  FER  S     S +S +P SP    +PT     + RL+S    H+K
Sbjct:   41 RQVAIRVRMLDDTEEIFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEYQNHQKMIVWLDHIKPIYKQLRRPKHAILKFSVKFFPPDHAQLLEELTRYLFALQIKQDLCCGRLTCNESSAALMISHIIQSEIGDFEESQCRSH-LLNNNYIPDQM--PLIDKIMEFHSKHIGQTPAESDYQMLEVARKLDMYGIRLHPAKDRDRTKLSLAVAHTGVLVFQRHTRINAFNWSKIRKLSFKRKRFLIKLKPDLNSSYQDTLEFLMASRDCCKVFWKICVEHHAFFRLFE-EPKPKPKPVLFTRGSYFRFSGRTQKQVIDYVKESEFKKIPFERKHSRVQHNSHLSPLP-SPQHHQVPTESGDFNDRLSSPPRRHWK 408          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Match: FARP1 (FERM, ARHGEF and pleckstrin domain-containing protein 1 [Source:NCBI gene;Acc:101165518])

HSP 1 Score: 358.607 bits (919), Expect = 6.369e-104
Identity = 206/558 (36.92%), Postives = 311/558 (55.73%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNL-CIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSS----SSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKSTPSAQIH 4415
            P D+++ + KE+L TERTY + L+++   F+ AV            P+ L + +    +P+H+ HT  L+E+E R                     L L    S ++++  +        R+ D+ L+NL  + PL     + +E +LL L++  K +  +    R FE+QKVCY+PL  + L P HR++ Y+Q  E L +H    H+D +DC+  L ++ ++V  L     + EN  KLLEL++D++G  +L                  R FIR G L KL  KG QQRMFF+F+D ++YT +      QF+VHGQ PL  L I ESE      ++FT+    +  +VAA+S  + ++W++DI  A+  AK+S    S L    + D+K +  D +  ++ +    +     ER     R NT VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT   LFF+K++QDD PLA+LPL+GY +  PS  + I KD+VFKL FK+HVY+FR +S+YT+ RW E +  AT  +++ ++  S + H
Sbjct:  522 PTDRAYFMAKELLTTERTYLKDLEVVTS-FQSAVGQDEAT------PDSLKETLLSTFEPLHKFHTGFLREVEQR---------------------LALWEGRSNAHIKGDYQ-------RIGDVMLKNLQALKPLTVNLSKQSE-VLLKLEKACKASRRMDSLCRDFELQKVCYVPLNVFILRPLHRLIHYKQILESLCKHYPATHVDFRDCRAALAEVSEVVDQLQGNLVEMENLQKLLELKKDLIGVDNLVVPG--------------REFIRLGCLSKLSGKGLQQRMFFLFNDVILYTTRGMTPTNQFRVHGQLPLRGLTIRESEDEWGVPYAFTLAGQGQSVVVAASSLTEMEKWMDDIKMAVQMAKTSNGPLSDLLTPSLADNK-YPEDSSVEAESEDDMTASHTTLER-PAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDDYPLASLPLLGYSVTIPSDNENIHKDYVFKLHFKSHVYYFRSESEYTFGRWMEVIRSATIPSSRGRALNSKEAH 1027          

HSP 2 Score: 299.671 bits (766), Expect = 7.219e-84
Identity = 146/335 (43.58%), Postives = 224/335 (66.87%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMS 1184
            + + +RV +LDD+ + F VS +A G+ L++ V + + L+E DYF LEY N + +  WLDH+K + KQ  + K  I +F +KF+ P    L +E TRYLFALQIK+D+  G L CN ++ AL+++ I QSEIGDF E +   +  L++  +  Q     + K+ME H   +GQ+P+E+DY +L+ ARK++ YGI+LHPA+D +   L LAV+H G+++ Q   +IN F+W+K+RKLSFKRKRF IKL  +    ++D +EF+  SR+ CK FWK C+EHHAFFR    +   K +  + ++GS +R++GRTQKQ+ + V+E+ +K+  FER+  +S
Sbjct:   41 RQVAIRVRMLDDTEEIFDVSQKASGKVLFDLVCSHMNLIEGDYFGLEYQNHQKMIVWLDHIKPIYKQLRRPKHAILKFSVKFFPPDHAQLLEELTRYLFALQIKQDLCCGRLTCNESSAALMISHIIQSEIGDFEESQCRSH-LLNNNYIPDQM--PLIDKIMEFHSKHIGQTPAESDYQMLEVARKLDMYGIRLHPAKDRDRTKLSLAVAHTGVLVFQRHTRINAFNWSKIRKLSFKRKRFLIKLKPDLNSSYQDTLEFLMASRDCCKVFWKICVEHHAFFRLFE-EPKPKPKPVLFTRGSYFRFSGRTQKQVIDYVKESEFKKIPFERANGLS 371          
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Match: farp1 (FERM, ARHGEF and pleckstrin domain-containing protein 1 [Source:NCBI gene;Acc:101170009])

HSP 1 Score: 340.502 bits (872), Expect = 1.154e-97
Identity = 200/543 (36.83%), Postives = 302/543 (55.62%), Query Frame = 3
Query: 2769 PMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEP----THSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANK 4385
            P DK++ I KE+L TERTY + L +I    +      NV       P+ +   +    DP H+ H   L+E E R+            ++   RSN         ++++  +        R+ D+ L+N+  +     + +     L+ L++  +++  ++   R FE Q+VCY+PLY + L P HR+L Y+   ERL +H    HLD +DC+  L  + ++V  L     K EN  KLLEL++D+ G ++              I    R FIR G L KL  KG QQRMFF+FSD L+YT++      QFKVHGQ PL+ + I +SE      HSFT+    +  +VAA+   + +RW+ED+  AI  ++ ++ L      + K  L DD    ++++    +  L+ +     R NT+VHVCWHRN S++  +   A EN+LSG LLRKFKNSNGWQKLWVVFT   LFF+K++QD+ PLA+LPL+GY +  P+  + I KD+VFKL FK+HVY+FR +S+Y ++RW E +  AT S+++
Sbjct:  522 PTDKAYFIAKELLTTERTYLKDLKVITESLQ------NVAKAEEAFPDSVRVLLAAHYDPFHKFHQGFLRETEQRL------------AQWEGRSN---------AHIKGDYQ-------RIGDVLLRNIQALRQLTAHLQKHPECLVELERACRSSRKVEALCRDFEQQRVCYLPLYVFLLRPLHRLLHYKLLLERLCKHYPPTHLDFRDCRAALADVSEMVLQLQGVMMKMENFQKLLELKKDLTGLEN--------------IVVPGREFIRLGCLSKLSGKGLQQRMFFLFSDCLLYTSRGTTPSNQFKVHGQLPLYGMTIRDSEEEWGVPHSFTLSGQRQSLVVAASCAAEMERWVEDVRMAIDLSEQTAGLLPPCPPEHK--LSDDGAEEEEEELGGLRASLERQCP---RGNTTVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDEYPLASLPLLGYSVTVPAEAENIHKDYVFKLHFKSHVYYFRSESEYNFERWMEVIRSATCSSSR 1011          

HSP 2 Score: 299.671 bits (766), Expect = 7.135e-84
Identity = 151/331 (45.62%), Postives = 218/331 (65.86%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAE-GYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFER 1169
            + + +RV +LDDS + F ++ R+ G+ L++ V A L L E+DYF LEY +   ++ WLD LK  +KQ  + K  I +F +KF+ P    L +E TRYLFALQIKRD+  G L CN ++ AL+++ I QSEIGDF  DE   + +L   +      +     +MECHR   GQ+P+E+DY LL+ AR++E YG++LHPA+D E   L L+V+H G+++ QN  KIN F+WAK+RKLSFKRKRF IKL A+       D +EF   SR+ CK FWK C+E+HAFFR    +   K +  + ++GSS+R++GRTQKQL + V+++ +K+  FER
Sbjct:   38 RQVPIRVQMLDDSQEVFQITQRSPGKGLFDLVCAHLNLTEADYFGLEYQDHRKMTVWLDLLKPTLKQIRRPKNTILRFVVKFFPPDHTQLMEELTRYLFALQIKRDLACGRLICNDSSAALMVSHIIQSEIGDF--DETQSWQHLLHNKYLPD-QDAIRDNIMECHRKHAGQTPAESDYQLLEIARRLEMYGVRLHPAKDREGSHLSLSVAHTGVLVFQNHTKINAFNWAKIRKLSFKRKRFLIKLRADPAQSAHHDTLEFAMASRDCCKVFWKICVEYHAFFRLFE-EPKPKPKPILFTRGSSFRFSGRTQKQLIDYVKDSEFKKIPFER 364          
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 2742.22 bits (7107), Expect = 0.000e+0
Identity = 1426/1428 (99.86%), Postives = 1427/1428 (99.93%), Query Frame = 3
Query:  138 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNXXXXXXXXXXXXXXXXXXXXXXXXXNKSASALLQNFDRVXXXXXXXXXXGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGKNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECLNVATGSANKLKSTPSAQIHNR 4421
            MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSG NSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWF+CLNVATGSANKLKSTPSAQIHNR
Sbjct:    1 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGNNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFDCLNVATGSANKLKSTPSAQIHNR 1428          
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 2689.45 bits (6970), Expect = 0.000e+0
Identity = 1403/1407 (99.72%), Postives = 1404/1407 (99.79%), Query Frame = 3
Query:  138 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNXXXXXXXXXXXXXXXXXXXXXXXXXNKSASALLQNFDRVXXXXXXXXXXGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGKNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFECL 4358
            MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSG NSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRW+  L
Sbjct:    1 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGNNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWYSDL 1407          
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 2631.67 bits (6820), Expect = 0.000e+0
Identity = 1381/1405 (98.29%), Postives = 1383/1405 (98.43%), Query Frame = 3
Query:  138 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNXXXXXXXXXXXXXXXXXXXXXXXXXNKSASALLQNFDRVXXXXXXXXXXGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGKNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRWFE 4352
            MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGY    DIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSG NSNAKSPSLGNVPLSPNGMTVSHPQVIGKEE                LKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDR+ +
Sbjct:    1 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGY----DIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGNNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEE----------------LKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDRYIK 1385          
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 2626.28 bits (6806), Expect = 0.000e+0
Identity = 1381/1402 (98.50%), Postives = 1381/1402 (98.50%), Query Frame = 3
Query:  138 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNXXXXXXXXXXXXXXXXXXXXXXXXXNKSASALLQNFDRVXXXXXXXXXXGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGKNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIPSNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDR 4343
            MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGY    DIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSG NSNAKSPSLGNVPLSPNGMTVSHPQVIGKEE                LKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDR
Sbjct:    1 MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGY----DIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSRVSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPMGMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASALLQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRDNYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTELALLISSGNNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEE----------------LKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNSTKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSDVIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPGYMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQRSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNLSRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSLDIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELENRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVSDIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVCYMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLVQGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNFIREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDLMIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSLTGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWHRNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNYQDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTYDR 1382          
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Match: SMESG000048801.1 (SMESG000048801.1)

HSP 1 Score: 437.573 bits (1124), Expect = 1.758e-127
Identity = 203/342 (59.36%), Postives = 259/342 (75.73%), Query Frame = 3
Query:  180 KYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQAVKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRET-SYKRPQFERSLSMSRVSNIP 1202
            + I  R+ LLDDSV  F ++  AIG  L+  +I K  +LE+DYFDLEY+N EGV CW++H K +VKQ    K+ +F F +KFY  +PN+LE+EYTRYLFALQIKRDI  G L C+ NT ALL ++I Q+EIGDFL+DEY D +YL  L+L  Q NEE L K+ME H+T +G S +EAD++LLDTARK+E YG+K+H A+DHENLPL L+V+H G+V+ QN  KIN FSWAK+RKLSFKRK+F IKLH EGYGY+K +VEF F +R++CK FWK+CIEHHAFFRC A ++  K+  KV++KGSS+RY GRTQK+L E VRE+ S KR  F R  S +RVS  P
Sbjct:   22 RQIQARIFLLDDSVHTFSINSCAIGHELFMAIIEKQNILEADYFDLEYVNSEGVRCWINHNKCIVKQVGAGKDMVFIFAVKFYTSHPNLLEEEYTRYLFALQIKRDIVSGQLICSTNTAALLASYIVQAEIGDFLDDEYIDNSYLRHLKLVNQPNEEILNKIMEFHKTHIGMSATEADFHLLDTARKIEYYGVKMHLAKDHENLPLNLSVTHMGVVVFQNLTKINTFSWAKIRKLSFKRKKFLIKLHPEGYGYYKGMVEFYFETRDDCKRFWKKCIEHHAFFRCPASEKSLKKTPKVVTKGSSFRYCGRTQKELIEYVRESYSSKRDNFVRP-SKARVSKSP 362          
The following BLAST results are available for this feature:
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FARP12.228e-11339.64FERM, ARH/RhoGEF and pleckstrin domain protein 1 [... [more]
FARP12.318e-11138.84FERM, ARH/RhoGEF and pleckstrin domain protein 1 [... [more]
FARP12.318e-11138.84FERM, ARH/RhoGEF and pleckstrin domain protein 1 [... [more]
FARP26.350e-11038.45FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
FARP25.860e-9044.08FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-31.923e-9547.75FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-31.055e-9347.75FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
ptp-11.574e-5436.58Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-11.574e-5436.58Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
ptp-11.574e-5436.58Tyrosine-protein phosphatase 1 [Source:UniProtKB/... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdep1.847e-11953.33gene:FBgn0265082 transcript:FBtr0336810[more]
Cdep1.089e-11153.30gene:FBgn0265082 transcript:FBtr0336809[more]
Cdep1.902e-11154.44gene:FBgn0265082 transcript:FBtr0336812[more]
Cdep5.095e-10752.44gene:FBgn0265082 transcript:FBtr0336811[more]
cora1.222e-6934.48gene:FBgn0010434 transcript:FBtr0301279[more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
farp21.017e-12440.40FERM, RhoGEF and pleckstrin domain protein 2 [Sour... [more]
farp12.863e-10639.63FERM, RhoGEF (ARHGEF) and pleckstrin domain protei... [more]
farp13.514e-8645.45FERM, RhoGEF (ARHGEF) and pleckstrin domain protei... [more]
FRMD77.320e-8045.00si:ch211-243g6.3 [Source:ZFIN;Acc:ZDB-GENE-121214-... [more]
frmd72.181e-7846.05FERM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
muc61.579e-11340.00mucin 6, oligomeric mucus/gel-forming [Source:Xenb... [more]
muc67.159e-10639.85mucin 6, oligomeric mucus/gel-forming [Source:Xenb... [more]
muc61.246e-10539.85mucin 6, oligomeric mucus/gel-forming [Source:Xenb... [more]
muc61.713e-10539.85mucin 6, oligomeric mucus/gel-forming [Source:Xenb... [more]
muc61.843e-10539.85mucin 6, oligomeric mucus/gel-forming [Source:Xenb... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Farp28.064e-11438.52FERM, RhoGEF and pleckstrin domain protein 2 [Sour... [more]
Farp11.688e-11239.27FERM, RhoGEF (Arhgef) and pleckstrin domain protei... [more]
Farp27.821e-9245.27FERM, RhoGEF and pleckstrin domain protein 2 [Sour... [more]
Frmd71.565e-8044.82FERM domain containing 7 [Source:MGI Symbol;Acc:MG... [more]
Epb41l33.820e-6738.79erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91VS8|FARP2_MOUSE5.641e-11338.52FERM, ARHGEF and pleckstrin domain-containing prot... [more]
sp|Q9Y4F1|FARP1_HUMAN1.070e-11239.64FERM, ARHGEF and pleckstrin domain-containing prot... [more]
sp|F1LYQ8|FARP1_RAT1.815e-11239.29FERM, ARHGEF and pleckstrin domain-containing prot... [more]
sp|F8VPU2|FARP1_MOUSE1.181e-11139.27FERM, ARHGEF and pleckstrin domain-containing prot... [more]
sp|Q5RAB8|FARP1_PONAB3.128e-11139.06FERM, ARHGEF and pleckstrin domain-containing prot... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7FMD97.526e-17347.52Putative ferm (Fragment) OS=Clonorchis sinensis OX... [more]
A0A074ZL751.048e-16847.96Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
G7Y7U62.990e-16847.52FERM RhoGEF and pleckstrin domain-containing prote... [more]
A0A4V3SFK49.089e-16848.06Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RHY72.438e-16547.89Farp1 protein OS=Fasciola hepatica OX=6192 GN=D915... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
farp21.337e-12641.23FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
farp22.766e-12440.83FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
farp25.440e-12440.71FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
FARP11.437e-10837.64FERM, ARH/RhoGEF and pleckstrin domain protein 1 [... [more]
farp22.590e-8743.97FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002191.13.959e-7948.59pep scaffold:Pmarinus_7.0:GL484618:8047:12162:-1 g... [more]
farp28.080e-6540.18FERM, RhoGEF and pleckstrin domain protein 2 [Sour... [more]
ENSPMAT00000001312.18.029e-6135.73pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
epb41l51.879e-5631.38erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l51.269e-5531.55erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO336269.247e-9534.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448235.051e-6137.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320451.104e-5837.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343914.182e-5536.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302241.822e-5032.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
farp29.659e-12441.05FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
farp21.747e-12341.53FERM, ARH/RhoGEF and pleckstrin domain protein 2 [... [more]
FARP13.239e-10636.92FERM, ARHGEF and pleckstrin domain-containing prot... [more]
FARP16.369e-10436.92FERM, ARHGEF and pleckstrin domain-containing prot... [more]
farp11.154e-9736.83FERM, ARHGEF and pleckstrin domain-containing prot... [more]
back to top
BLAST of FERM and pleckstrin domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038155.10.000e+099.86SMESG000038155.1[more]
SMESG000038155.10.000e+099.72SMESG000038155.1[more]
SMESG000038155.10.000e+098.29SMESG000038155.1[more]
SMESG000038155.10.000e+098.50SMESG000038155.1[more]
SMESG000048801.11.758e-12759.36SMESG000048801.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010740 ID=SMED30010740|Name=FERM and pleckstrin domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4786bp
GTTGCAAAATTTGAAATTTCTGTTTGAATTCACGCTTGAAAATAGTAATT
TACAAACTTTTATGTATAAATGCAAACTTGCGATGTTTTTCATATGTCGC
TGAACTCCTTAGTGATTTTTAATTAGAAACTTAAATAATGGAAAATCAAA
CGTCTCCGTTAAAGCGTGCAAATCTAAGCAAATATATTGGAGTACGAGTT
ACATTACTTGATGATAGTGTTCAGCATTTCCATGTTTCGGTACGAGCTAT
TGGTCAACACTTGTATAATCAGGTTATCGCCAAGTTACAGTTACTTGAAA
GTGATTATTTCGATTTAGAATACATCAATAAAGAAGGGGTTTCGTGTTGG
TTGGATCATCTGAAACAAGTTGTTAAACAATGTACTCAAAGGAAAGAATA
TATATTTCAATTCGGCATTAAGTTTTATGCTCCATACCCTAACATGCTAG
AAGATGAGTATACTCGATATCTATTTGCTTTACAAATTAAACGAGATATT
TATCAAGGACACTTACAGTGTAATATTAATACTACAGCACTTTTATTAGC
ATTTATTGCTCAATCTGAAATTGGTGATTTTCTTGAAGACGAATATGATG
ATTACACGTATTTATCCTCATTGCGACTCACAAAGCAAGCAAACGAAGAG
TTTTTAATGAAAGTAATGGAATGCCATCGAACACTTGTAGGTCAATCTCC
GAGTGAAGCAGATTATAATTTGCTTGATACAGCTCGTAAAGTTGAAAGTT
ATGGAATAAAATTACATCCGGCAAGAGATCACGAGAATCTTCCTCTGAAA
TTAGCCGTTTCTCACCAAGGAATTGTTATTCATCAAAATCGAATAAAAAT
TAATATATTTTCATGGGCGAAGGTTCGTAAGTTGAGCTTCAAACGGAAAC
GATTCTACATAAAATTACACGCAGAAGGATATGGCTATTTTAAGGATATT
GTTGAATTTATTTTCAACTCAAGAAACGAATGCAAAAATTTCTGGAAACA
GTGCATTGAGCATCATGCATTCTTTAGATGTCAAGCTGTTAAACAAGGTA
GTAAACGACGAAGTAAAGTTCTCAGCAAGGGTTCGTCTTACAGGTATACT
GGACGAACTCAAAAACAGTTACAAGAGTGTGTCAGAGAAACAAGCTACAA
ACGTCCACAGTTCGAAAGGTCATTGTCTATGAGCCGTGTCAGTAATATTC
CAAAATCACCAGCTTCGAGTGTTCTTCCAACTCGACATACACGTCTAGCT
AGTAATTCTTACGCTCATTACAAAAGCGAAAGCAATTCTGCTGGCGAATA
CCGATCTCAAGTTCCAGTTAATCTAGGTGGCCCTATGGGAATGTTATTAA
TAACTGGAGGAACAGCTAGCTCAGCATCATATACCATGAATAGCTCGGCG
GCATCTGCAAGATCAAGAACAGTAAGTACCAGCTCCGACAGTAGTCAACA
TCAAAAATCTCGTTCAAATAAATCAGCATCAGCACTACTTCAAAACTTTG
ATAGAGTTCCCAGACGTTCGATATCTAGACCTTCTATAGGGTCAAAAAAT
CGTAGATCACTTAGTCATTCGCCGCCTGTTGGATCTACTAGTCGATCAAA
TTTACCCCACCAAAACAACATGAACACAAATCGTGATAATTATGGCGAAT
CTCCGCTTAATACTCGAACACTTCCAGCTGGATTTGGCCGTGGATATTCT
TTAATGTCAGATCAATCGTTAGAATGCAATTCACGAATTATCAATAAATC
CCAAGAAGAAAGTTCAATTCCAAATTATACTGAATTGGCTCTGTTAATTT
CTTCGGGAAAAAATTCCAATGCCAAATCCCCCAGTTTAGGTAATGTTCCT
TTGTCTCCAAATGGAATGACTGTATCACATCCTCAAGTTATCGGTAAAGA
AGAGGTAACAAACTTATGGAGTTCTTCAAAAATCCCGAGTAATACTTCAA
CTCTGAAATCGTCATTAACGTATCTTAGAAAATCTCAACAGCGCCTTGAT
GATTTGCTTATAGCAACTATGGCAGCAGTTGGCGTGGAAGACCCAGCTTT
ATCTGGAATGTGGTGTCAGAATAACTTAACAAATTCCACAAAAAATGAAC
ATGATATGGGTAGCGCAAACTCTAATACATATATGTTATTCTCAGGCCAA
AAACCATGTGTCAGTCCAATCACTCAAAACATTAATCACAGAGAGCCTTT
GTCAACGTTATTGCCAGGGAATCAAATTGATAGTGATGTCATTATTCAAG
ATAGTTGCTCATTTGATATTTATTCCAATCCTCCAAGAAAAGATCAACAA
ACTGGAAATCTATCAACTAGATCTGTTGAAAACTCAAGCGTTTTCAACGC
CGTCACATCGTCGTCCCAGATGAACCAATTCCCTGGATATATGGCGACAA
GTACAGACATGAACAGATATATGGATGCCAAAAACTTAAAAGCAGCTTTA
TTAAACGAACTTAAACGAGATAGGGGTCCACCACTTCCTCCACTCAGATC
TGGAAGTTCTCTCGGTAAATTAAACAGCCCAGTTCAAAGATCTCAAATTC
AGAGTCAGCCTGATGTGTTACCAATGGATTTAAAAAATTCCAAACTATCT
GAGCAATTGTCCGATGATGATCTCAGTAGGCCAACTAGTATTGATGGTTC
TAGAGCATCTATTACTAGAGATCCAAGTCTCAATCTCAGTAGAGGCGGTT
CATTAAGTAGACGCAGTTCCACATCTTCTAGTAGAAGATCCCATCATCAA
TCTAGTAAAAAAAGATTACCGATGGATAAATCATTCCATATAATAAAGGA
AATCTTAATGACTGAGAGAACATACAAGAGGAGTCTTGATATAATATGTA
TATGGTTTAGAAAAGCTGTAGCGAGTGGAAACGTTGTTGATGTCAATAGT
CGATTACCGGAACCACTATCGAAGAGAATATTTGGTCTTTTGGATCCTAT
TCACGAACAACATACTCAAATTTTGAAAGAATTAGAAAACCGAGTGATGG
TTGAATTTAATACTTTTCAATCTCCCTACACTTCAAAAACCAGTTCGCGT
TCAAATCTTGGATTAGATACTACTGAATCAGAGTCGAACCTTGAAAGAAA
ATTCCATAATGAACCAAGTCCAGTTTATCGCGTCAGCGATATTTTTCTAC
AAAACCTTTGCATAATACCGTTGTATAAACAGTACTTTGAATCTGCTGAG
TCTATTTTGTTATCGCTTGATCAAAATATCAAAAACAATCCTGTTTTGAA
GGACAATATCAGAAAATTCGAGATTCAGAAGGTTTGTTACATGCCATTAT
ATGCATATTTTTTGAGTCCCGCTCATCGCATTCTTCAATACCGGCAAGCT
TTTGAACGGTTATTGCGCCACATCGGAGAAAATCATTTGGACAGCAAGGA
TTGCAAGTTGATTCTTGTTCAACTGCAAGACTTGGTTCAAGGATTGTGGG
ATGCGTATAAGAAAACTGAAAATACCTGCAAACTGCTGGAATTGCAGAGG
GACATTGTGGGATTCCAATCATTATCAAACGGTGCACATGAAAAGCTGAA
TAGTAGCAGTACAATTTTTGAATCACACCGAAACTTTATTAGAGAAGGCT
GGCTACAAAAACTAGGGAAAAAAGGATATCAACAGCGCATGTTTTTCATG
TTTTCTGATCAATTAGTTTACACAAACAAATTAAATGGAAATATTTTACA
GTTTAAAGTACACGGACAATTTCCACTTCACGATTTGATGATTGAAGAAT
CTGAGCCGACTCATAGTTTTACTGTTTACTCTGGTAATCGATGCTTTTTA
GTAGCTGCCAACAGTCAATGGCAGCGTGACCGATGGCTAGAGGATATCAG
TAGAGCGATTTTAGCCGCAAAGTCCTCTTCCAGTCTCACGGGAAATGGAA
TAGTTGATAGTAAAAAATTCTTGATTGATGACAATGGAAATTCTGATCAG
CAGAAAACTGAAAAATCAAAACTTATTCTTGATGAGCGGTATCAAATTCA
GCAGAGATCTAACACCAGCGTTCATGTTTGCTGGCATCGCAACTGCAGTT
TGGCATTTACTGAGATTCTCAGAGCAAATGAAAACGAGCTCTCAGGATAT
TTACTTCGAAAATTTAAAAACAGTAATGGTTGGCAAAAGCTTTGGGTAGT
TTTCACACAATTGTGCCTGTTTTTCTTCAAAAATTATCAGGATGATAGTC
CTTTAGCCACTTTGCCATTAATTGGATATTTAATTTGCCAACCTTCACCA
GAAGATCAAATCAGAAAAGACTTCGTGTTCAAATTGCAATTCAAAAATCA
TGTTTACTTTTTCAGGGGTGACAGCCAATACACATATGACAGATGGTTTG
AGTGTTTGAATGTCGCAACTGGATCTGCGAACAAATTAAAATCGACTCCC
TCCGCCCAAATACATAATCGGTAATCTTTGGAAATCTTATGTAAGATCTA
ATAAATAAATTGCCAAATAAAATCTGTGGGATTGTCCATAAATTTTGCCC
ATTTGTTTCTAAGGGTTTTTCTATTAATTTCAATTACAACAGTTCCTTAT
ATGGATATCAGTTCAATTCTAATCATGAGCCAGTCGGATCAAATTTTGTT
TTCGAAGAATTCAATAAAGTTTTAATTTTTTTTCATTAATAAATCCATTG
GAAAACCTTTGAACATAGAAATGTTTGTAATCTCTTTACTGATCTAGTTC
AACCGCTTGATTTTTATGACATTTTTATAAATGATCTCAATTATACTCGT
GTCAGAGTATAAAACTTTCAATTTATTCAAACAAGT
back to top

protein sequence of SMED30010740-orf-1

>SMED30010740-orf-1 ID=SMED30010740-orf-1|Name=SMED30010740-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1429bp
MENQTSPLKRANLSKYIGVRVTLLDDSVQHFHVSVRAIGQHLYNQVIAKL
QLLESDYFDLEYINKEGVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPY
PNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLE
DEYDDYTYLSSLRLTKQANEEFLMKVMECHRTLVGQSPSEADYNLLDTAR
KVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLS
FKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFRCQA
VKQGSKRRSKVLSKGSSYRYTGRTQKQLQECVRETSYKRPQFERSLSMSR
VSNIPKSPASSVLPTRHTRLASNSYAHYKSESNSAGEYRSQVPVNLGGPM
GMLLITGGTASSASYTMNSSAASARSRTVSTSSDSSQHQKSRSNKSASAL
LQNFDRVPRRSISRPSIGSKNRRSLSHSPPVGSTSRSNLPHQNNMNTNRD
NYGESPLNTRTLPAGFGRGYSLMSDQSLECNSRIINKSQEESSIPNYTEL
ALLISSGKNSNAKSPSLGNVPLSPNGMTVSHPQVIGKEEVTNLWSSSKIP
SNTSTLKSSLTYLRKSQQRLDDLLIATMAAVGVEDPALSGMWCQNNLTNS
TKNEHDMGSANSNTYMLFSGQKPCVSPITQNINHREPLSTLLPGNQIDSD
VIIQDSCSFDIYSNPPRKDQQTGNLSTRSVENSSVFNAVTSSSQMNQFPG
YMATSTDMNRYMDAKNLKAALLNELKRDRGPPLPPLRSGSSLGKLNSPVQ
RSQIQSQPDVLPMDLKNSKLSEQLSDDDLSRPTSIDGSRASITRDPSLNL
SRGGSLSRRSSTSSSRRSHHQSSKKRLPMDKSFHIIKEILMTERTYKRSL
DIICIWFRKAVASGNVVDVNSRLPEPLSKRIFGLLDPIHEQHTQILKELE
NRVMVEFNTFQSPYTSKTSSRSNLGLDTTESESNLERKFHNEPSPVYRVS
DIFLQNLCIIPLYKQYFESAESILLSLDQNIKNNPVLKDNIRKFEIQKVC
YMPLYAYFLSPAHRILQYRQAFERLLRHIGENHLDSKDCKLILVQLQDLV
QGLWDAYKKTENTCKLLELQRDIVGFQSLSNGAHEKLNSSSTIFESHRNF
IREGWLQKLGKKGYQQRMFFMFSDQLVYTNKLNGNILQFKVHGQFPLHDL
MIEESEPTHSFTVYSGNRCFLVAANSQWQRDRWLEDISRAILAAKSSSSL
TGNGIVDSKKFLIDDNGNSDQQKTEKSKLILDERYQIQQRSNTSVHVCWH
RNCSLAFTEILRANENELSGYLLRKFKNSNGWQKLWVVFTQLCLFFFKNY
QDDSPLATLPLIGYLICQPSPEDQIRKDFVFKLQFKNHVYFFRGDSQYTY
DRWFECLNVATGSANKLKSTPSAQIHNR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041788FARP1/FARP2/FRMD7_FERM_C
IPR035963FERM_2
IPR035899DBL_dom_sf
IPR019749Band_41_domain
IPR000219DH-domain
IPR014847FERM-adjacent
IPR018980FERM_PH-like_C
IPR001849PH_domain
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR011993PH-like_dom_sf
IPR018979FERM_N
IPR019748FERM_central
IPR000299FERM_domain
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 115..128
score: 43.15
coord: 190..206
score: 33.95
coord: 128..148
score: 36.31
coord: 50..62
score: 44.23
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 13..210
e-value: 6.0E-40
score: 148.7
IPR014847FERM adjacent (FA)SMARTSM01195FA_2coord: 309..355
e-value: 5.5E-11
score: 52.5
IPR014847FERM adjacent (FA)PFAMPF08736FAcoord: 310..351
e-value: 2.6E-10
score: 40.2
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 885..1105
e-value: 8.8E-9
score: 45.2
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 885..1100
e-value: 1.3E-18
score: 67.9
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 881..1106
score: 19.987
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 884..1101
e-value: 5.01029E-18
score: 81.19
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 1150..1244
e-value: 3.2E-14
score: 63.2
coord: 1316..1414
e-value: 1.2E-13
score: 61.4
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 1318..1408
e-value: 1.5E-10
score: 41.5
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 1315..1412
score: 12.008
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 1149..1242
score: 13.846
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 214..304
e-value: 1.5E-30
score: 117.5
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 214..300
e-value: 3.9E-20
score: 72.0
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 98..203
e-value: 4.9E-30
score: 106.1
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 21..82
e-value: 8.7E-11
score: 41.6
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 205..298
e-value: 1.3E-33
score: 117.1
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 1314..1415
e-value: 2.7E-23
score: 84.1
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 12..97
e-value: 1.7E-19
score: 71.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 827..862
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..494
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 423..451
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 775..878
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 423..494
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 790..812
NoneNo IPR availablePANTHERPTHR45858FAMILY NOT NAMEDcoord: 16..1419
NoneNo IPR availableCDDcd17098FERM_F1_FARP1_likecoord: 19..101
e-value: 6.39746E-31
score: 115.003
NoneNo IPR availableCDDcd01220PH1_FARP1-likecoord: 1147..1247
e-value: 1.39837E-51
score: 174.811
NoneNo IPR availableCDDcd13235PH2_FARP1-likecoord: 1314..1411
e-value: 6.5601E-55
score: 183.674
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 203..348
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 1137..1246
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 1290..1411
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 101..210
e-value: 5.9E-13
score: 49.3
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 109..201
e-value: 2.23233E-21
score: 88.0722
IPR000299FERM domainPROSITEPS50057FERM_3coord: 17..300
score: 66.745
IPR041788FARP1/FARP2/FRMD7, FERM domain C-lobeCDDcd13193FERM_C_FARP1-likecoord: 197..318
e-value: 2.10146E-65
score: 214.9
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 101..205
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 868..1126
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 15..98