Adenylate kinase

Overview
NameAdenylate kinase
Smed IDSMED30010721
Length (bp)941
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Adenylate kinase (SMED30010721) t-SNE clustered cells

Violin plots show distribution of expression levels for Adenylate kinase (SMED30010721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Adenylate kinase (SMED30010721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Adenylate kinase (SMED30010721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 268.47 bits (685), Expect = 1.165e-89
Identity = 127/212 (59.91%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAP+LAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S  D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK  L +Y T+  PL+ YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF 227          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 268.085 bits (684), Expect = 1.862e-89
Identity = 127/212 (59.91%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAP+LAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S  D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK  L +Y T+  PL+ YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF 227          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 268.085 bits (684), Expect = 2.458e-89
Identity = 127/212 (59.91%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAP+LAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S  D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK  L +Y T+  PL+ YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF 227          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 193.741 bits (491), Expect = 7.153e-61
Identity = 102/212 (48.11%), Postives = 124/212 (58.49%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQ                                          +SDE+V +LI +NL  P C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S  D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK  L +Y T+  PL+ YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQ------------------------------------------VSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF 185          
BLAST of Adenylate kinase vs. Ensembl Human
Match: AK2 (adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:362])

HSP 1 Score: 192.971 bits (489), Expect = 1.553e-60
Identity = 102/212 (48.11%), Postives = 124/212 (58.49%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQ                                          +SDE+V +LI +NL  P C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S  D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK  L +Y T+  PL+ YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQ------------------------------------------VSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAF 185          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 251.136 bits (640), Expect = 6.704e-83
Identity = 118/212 (55.66%), Postives = 152/212 (71.70%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + AI +GP GSGKGTQAP  A+K+  CHL+TGD+LRA V+SGS  G+++   M  G L+SDE+VCKLI + L  P C+ GF+LDGFPRT GQAEKLD +LE+R + +D V+E +  D +L RRI+GRLFHI SGRSYH EF PPK PM DD+TGE LIRR DDN +TL+  L+ Y     PLV YY+K  ++  V+AA+P   V   I ++F
Sbjct:   27 IRAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAKPMTDVKAHIDQVF 238          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: let-754 (Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc:P34346])

HSP 1 Score: 251.136 bits (640), Expect = 6.704e-83
Identity = 118/212 (55.66%), Postives = 152/212 (71.70%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + AI +GP GSGKGTQAP  A+K+  CHL+TGD+LRA V+SGS  G+++   M  G L+SDE+VCKLI + L  P C+ GF+LDGFPRT GQAEKLD +LE+R + +D V+E +  D +L RRI+GRLFHI SGRSYH EF PPK PM DD+TGE LIRR DDN +TL+  L+ Y     PLV YY+K  ++  V+AA+P   V   I ++F
Sbjct:   27 IRAIFIGPPGSGKGTQAPAFAQKYFSCHLATGDLLRAEVASGSEFGKELKATMDAGKLVSDEVVCKLIEQKLEKPECKYGFILDGFPRTSGQAEKLDEILERRKTPLDTVVEFNIADDLLVRRITGRLFHIASGRSYHLEFKPPKVPMKDDLTGEPLIRRSDDNEETLRKRLVQYHQMTVPLVDYYKKHGVHVAVDAAKPMTDVKAHIDQVF 238          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F38B2.4 (Adenylate kinase isoenzyme 1 [Source:UniProtKB/Swiss-Prot;Acc:Q20140])

HSP 1 Score: 103.605 bits (257), Expect = 2.942e-26
Identity = 66/210 (31.43%), Postives = 102/210 (48.57%), Query Frame = 2
Query:  206 ILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHP--NCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFH--ITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDIL 823
             ++G  GSGKGTQ  K+  K+ + HLS+GD+LR  V SGSP G Q+  IM+ G L+  E+V  L+ E +         GF++DG+PR V Q ++ ++ +++         +L     + E  +  RL H   TSGR+                         DDN DT+K  L ++ T   P+V YYE +    R+ A    D +F  ++
Sbjct:   24 FIVGGPGSGKGTQCDKIVAKYGLTHLSSGDLLRDEVKSGSPRGAQLTAIMESGALVPLEVVLDLVKEAMLKAIEKGSKGFLIDGYPREVAQGQQFESEIQEA--------KLVLFFDVAEETLVKRLLHRAQTSGRA-------------------------DDNADTIKKRLHTFVTSTAPVVDYYESKGKLVRINAEGSVDDIFAVVV 200          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: ZK673.2 (Probable adenylate kinase isoenzyme ZK673.2 [Source:UniProtKB/Swiss-Prot;Acc:Q09629])

HSP 1 Score: 95.5153 bits (236), Expect = 4.288e-23
Identity = 60/190 (31.58%), Postives = 98/190 (51.58%), Query Frame = 2
Query:  206 ILLGPSGSGKGTQAPKLAEKFK---ICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRN 766
            +L G +GSGKGT A  L  +F+     + + GD +R  ++ G+  G +    + KG  + D I+   I   +     R   VLDG+PR + Q + ++       + ++ ++EL     +L  R+S +L H  SGR+Y+ E  PPK+   DDITGE L +R  D L+  +  L  Y      ++ YY+K+N
Sbjct:    5 LLSGAAGSGKGTIARMLVREFEPLGFNYFAAGDFIRDHIARGTEFGVRAQSFLNKGEHVPDSILNGAILAEMLKAGPR--VVLDGYPRNMSQLKMVE-----EQAPLNLIVELKVPRKVLIDRLSKQLVHPASGRAYNLEVNPPKEEGKDDITGEPLFKRSTDQLEVARRRLEVYDKTENKVLDYYKKQN 187          
BLAST of Adenylate kinase vs. Ensembl Celegans
Match: F40F8.1 (UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20230])

HSP 1 Score: 86.6557 bits (213), Expect = 4.058e-20
Identity = 64/218 (29.36%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVS-SGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDG------VIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFE 835
              +LGP GSGKGT   K+ E     HLS GD+LRA     GS  G  I   ++ G ++  EI C L+   +       GF++DGFPR        +  L+  N  +DG      V+ LS    I   R   R      GR+                         DDN ++LK  + +Y  +  P++ ++EK  L   V++ +P D V+ D+ K+F+
Sbjct:    5 VFVLGPPGSGKGTICAKIQENLNYVHLSAGDLLRAERQREGSEFGALIESHIKNGSIVPVEITCSLLENAMKACGDAKGFLVDGFPRN-------EDNLQGWNKQMDGKALVQFVLFLSCPVSICIERCLNR----GQGRT-------------------------DDNEESLKKRVETYNQQTFPIIEHFEKSGLVREVKSERPVDVVYADVEKVFD 186          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk2 (gene:FBgn0283494 transcript:FBtr0072163)

HSP 1 Score: 268.855 bits (686), Expect = 6.195e-90
Identity = 127/213 (59.62%), Postives = 160/213 (75.12%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFE 835
            +NAILLGP GSGKGTQAP L EKF +CHLSTGDMLRA +SSGS LG ++ ++M  G L+SD++V  +I  NL+ P C+NGF+LDGFPRTV QAEKLD LL+KR +++D VIE + +D +L RRI+GRL H  SGRSYHEEF PPK+PM DD+TGE LIRR DDN + LK  L +Y  + +PLV YY  R L+ +V+AA+    VF  I  IF+
Sbjct:   19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQ 231          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082331)

HSP 1 Score: 124.405 bits (311), Expect = 5.033e-34
Identity = 72/212 (33.96%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            A+++G  GSGKGT +  + +     H+STGD+LR  +   + LG++  + + +G L+ D IV K +   +     R+ ++LDGFPR + QAE L A        ID VI L     ++  R+  R  H  SGR Y+  F  PK P  DD+TGE L++R+DD    +   L  Y   M P++ +YEK+ L    +  Q   K    ++++F N
Sbjct:    8 AVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRS-YILDGFPRNIAQAEALAA-----REQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ--TKEIWPMMELFLN 211          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339379)

HSP 1 Score: 124.405 bits (311), Expect = 5.033e-34
Identity = 72/212 (33.96%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            A+++G  GSGKGT +  + +     H+STGD+LR  +   + LG++  + + +G L+ D IV K +   +     R+ ++LDGFPR + QAE L A        ID VI L     ++  R+  R  H  SGR Y+  F  PK P  DD+TGE L++R+DD    +   L  Y   M P++ +YEK+ L    +  Q   K    ++++F N
Sbjct:    8 AVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRS-YILDGFPRNIAQAEALAA-----REQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ--TKEIWPMMELFLN 211          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0082330)

HSP 1 Score: 124.405 bits (311), Expect = 5.033e-34
Identity = 72/212 (33.96%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            A+++G  GSGKGT +  + +     H+STGD+LR  +   + LG++  + + +G L+ D IV K +   +     R+ ++LDGFPR + QAE L A        ID VI L     ++  R+  R  H  SGR Y+  F  PK P  DD+TGE L++R+DD    +   L  Y   M P++ +YEK+ L    +  Q   K    ++++F N
Sbjct:    8 AVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRS-YILDGFPRNIAQAEALAA-----REQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ--TKEIWPMMELFLN 211          
BLAST of Adenylate kinase vs. Ensembl Fly
Match: Adk3 (gene:FBgn0042094 transcript:FBtr0339378)

HSP 1 Score: 124.405 bits (311), Expect = 5.033e-34
Identity = 72/212 (33.96%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            A+++G  GSGKGT +  + +     H+STGD+LR  +   + LG++  + + +G L+ D IV K +   +     R+ ++LDGFPR + QAE L A        ID VI L     ++  R+  R  H  SGR Y+  F  PK P  DD+TGE L++R+DD    +   L  Y   M P++ +YEK+ L    +  Q   K    ++++F N
Sbjct:    8 AVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTELGKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRS-YILDGFPRNIAQAEALAA-----REQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDDVTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQ--TKEIWPMMELFLN 211          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:321793])

HSP 1 Score: 271.937 bits (694), Expect = 4.320e-91
Identity = 130/219 (59.36%), Postives = 162/219 (73.97%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M  G L+SDE+V +LI  NL+ P C+NGF+LDGFPRTV QAE LD L+EKR+  +D VIE S +D +L RRI GRL H  SGRSYHEEF+PPK+ M DD+TGE LIRR DDN  TL+S L SY  +  PLV YY  R L+  ++A+Q  D VF  IL  F
Sbjct:   11 VSGIRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDASQSTDLVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:321793])

HSP 1 Score: 271.552 bits (693), Expect = 7.734e-91
Identity = 130/219 (59.36%), Postives = 162/219 (73.97%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M  G L+SDE+V +LI  NL+ P C+NGF+LDGFPRTV QAE LD L+EKR+  +D VIE S +D +L RRI GRL H  SGRSYHEEF+PPK+ M DD+TGE LIRR DDN  TL+S L SY  +  PLV YY  R L+  ++A+Q  D VF  IL  F
Sbjct:   11 VSGIRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDASQSTDLVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak3 (adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2142])

HSP 1 Score: 147.132 bits (370), Expect = 1.681e-42
Identity = 72/194 (37.11%), Postives = 120/194 (61.86%), Query Frame = 2
Query:  188 KSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            +S   A+++G  GSGKGT + ++A+ F + HLS+GDMLRA + + + LG  +   + +G L+ D+++ +LI  +L     +  ++LDGFPRTV QAE LD + +     +D VI L      +  R++ R  H+ SGR Y+ +F PPK+P +DD+TGE L++R DD+ +T+   L  Y  + +P++ YY  + +
Sbjct:    4 QSVFRAVIMGAPGSGKGTVSSRIAQSFGLKHLSSGDMLRANIEAKTDLGLLMKSCIDQGQLVPDDVISRLILSSLRGLE-KTSWLLDGFPRTVAQAEALDCVYD-----VDSVINLDVPFQTIRERLTSRWVHLPSGRVYNIDFNPPKKPGLDDVTGEPLVQRDDDSPETVSRRLKDYERQTQPVLEYYRSKGV 191          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 120.939 bits (302), Expect = 1.733e-32
Identity = 68/206 (33.01%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDI 820
            A+++GP GSGKGT + ++A  F + HLS+GD +R  +SS +  G      + KG L+ D ++ +L+   L     +  ++LDGFPRT+ QAE L++     +  +D  I L+     L+ R+  R  H  SGR Y+  F PP+   +DDITGE LI+++DD  + L + L  Y+   +P++ +Y+ + + +     +  D+++ +I
Sbjct:    7 AVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEE-MTKYSWLLDGFPRTLAQAEALNS-----SCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTE-TDRIWPNI 205          
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Match: ak4 (adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-2505])

HSP 1 Score: 120.939 bits (302), Expect = 1.733e-32
Identity = 68/206 (33.01%), Postives = 118/206 (57.28%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDI 820
            A+++GP GSGKGT + ++A  F + HLS+GD +R  +SS +  G      + KG L+ D ++ +L+   L     +  ++LDGFPRT+ QAE L++     +  +D  I L+     L+ R+  R  H  SGR Y+  F PP+   +DDITGE LI+++DD  + L + L  Y+   +P++ +Y+ + + +     +  D+++ +I
Sbjct:    7 AVIMGPPGSGKGTISERIAHNFGLKHLSSGDFVRENISSKTDAGVLAKTYINKGLLVPDHVMTRLLLPRLEE-MTKYSWLLDGFPRTLAQAEALNS-----SCDLDVAINLNIPLETLKERLRHRWIHPPSGRVYNMCFNPPRIQGLDDITGEALIQQEDDRPEALVARLRHYKDVAKPVIDFYKAKGILYTFSDTE-TDRIWPNI 205          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 269.24 bits (687), Expect = 6.344e-90
Identity = 128/212 (60.38%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG ++   M  G L+SDE+V +LI +NL+ P C+ GF+LDGFPRTV QAE LD LLEKR   +D VIE   +D +L RRI GRL H +SGRSYHEEF PPK+ M DD+TGE L+RR DDN  TLKS L +Y T   PLV YY++  ++  V+AAQ PD VF  IL  F
Sbjct:   18 IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHTAVDAAQSPDVVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 268.855 bits (686), Expect = 9.810e-90
Identity = 128/212 (60.38%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG ++   M  G L+SDE+V +LI +NL+ P C+ GF+LDGFPRTV QAE LD LLEKR   +D VIE   +D +L RRI GRL H +SGRSYHEEF PPK+ M DD+TGE L+RR DDN  TLKS L +Y T   PLV YY++  ++  V+AAQ PD VF  IL  F
Sbjct:   18 IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHTAVDAAQSPDVVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:448011])

HSP 1 Score: 268.855 bits (686), Expect = 1.003e-89
Identity = 128/212 (60.38%), Postives = 157/212 (74.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG ++   M  G L+SDE+V +LI +NL+ P C+ GF+LDGFPRTV QAE LD LLEKR   +D VIE   +D +L RRI GRL H +SGRSYHEEF PPK+ M DD+TGE L+RR DDN  TLKS L +Y T   PLV YY++  ++  V+AAQ PD VF  IL  F
Sbjct:   18 IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGMRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEAMKDDVTGEPLMRRSDDNETTLKSRLEAYHTMTSPLVEYYQRHGIHTAVDAAQSPDVVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 144.436 bits (363), Expect = 1.211e-41
Identity = 72/188 (38.30%), Postives = 116/188 (61.70%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRN 766
            A+++GP GSGKGT + ++ + F + HLS+GD+LR  V + + +G      + +G L+ D+++ +L+ + L+  N  N ++LDGFPRTV QA  LD        HI+ VI+L+     ++ R++ R  H  SGR Y+ EF PPK P +DD+TGE L++R+DD  +T+   L  Y     P++ YY+ R+
Sbjct:    9 AVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINETN-WLLDGFPRTVPQAVALDKAF-----HINSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETVTRRLKGYEALTRPVLEYYQGRH 190          
BLAST of Adenylate kinase vs. Ensembl Xenopus
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:100170447])

HSP 1 Score: 144.436 bits (363), Expect = 2.175e-41
Identity = 71/189 (37.57%), Postives = 116/189 (61.38%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            A+++GP GSGKGT + ++ + F + HLS+GD+LR  V + + +G      + +G L+ D+++ +L+ + L+  N  N ++LDGFPRTV QA  LD        HI+ VI+L+     ++ R++ R  H  SGR Y+ EF PPK P +DD+TGE L++R+DD  +T+   L  Y     P++ YY+ + +
Sbjct:    9 AVIMGPPGSGKGTVSDRIVKNFALKHLSSGDLLRTNVQNKTEIGVVAKSYIDQGQLVPDDVITRLVLQELHKINETN-WLLDGFPRTVPQAVALDKAF-----HINSVIDLNVPFQTIKDRLTARWIHPASGRVYNTEFNPPKVPEVDDLTGEPLVQREDDKPETVTRRLKGYEALTRPVLEYYQNKGV 191          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 273.478 bits (698), Expect = 8.866e-92
Identity = 129/212 (60.85%), Postives = 160/212 (75.47%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAPKLAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P+C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S +D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK+ L +Y T+  PLV YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAF 227          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak2 (adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:87978])

HSP 1 Score: 273.092 bits (697), Expect = 1.679e-91
Identity = 129/212 (60.85%), Postives = 160/212 (75.47%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAPKLAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P+C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S +D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK+ L +Y T+  PLV YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAF 227          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak3 (adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860835])

HSP 1 Score: 139.813 bits (351), Expect = 1.084e-39
Identity = 73/192 (38.02%), Postives = 119/192 (61.98%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNH-PNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            + A+++G  GSGKGT + ++ + F++ HLS+GD+LR  +  G+ +G      + +G LI D+++ +L    L     C   ++LDGFPRT+ QAE LD + +     ID VI L+    ++++R++ R  H  SGR Y+ EF PPK   IDD+TGE LI+R+DD  +T+   L +Y  + EP++ YY+K+ +
Sbjct:    8 LRAVIMGAPGSGKGTVSSRITKHFELKHLSSGDLLRQNMLQGTEIGVLAKTFIDQGKLIPDDVMTRLALHELKTLTQC--SWLLDGFPRTLPQAEALDKVYQ-----IDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEAQTEPVLQYYQKKGV 192          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 138.658 bits (348), Expect = 3.271e-39
Identity = 72/214 (33.64%), Postives = 130/214 (60.75%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            + A++LGP GSGKGT   ++A+ F + HLS+G +LR  + +G+ +G    + ++KG L+ D ++ +L+   L   + ++ ++LDGFPRT+ QAE LD + +     +D VI L+     L+ R+S R  H +SGR Y+ +F PP+   IDDITGE L++++DD  + + + L  Y+   +P++  Y+ R + H+    +  ++++  +  +F N
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQH-WLLDGFPRTLVQAEALDGICD-----VDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTE-TNRIWPYVYTLFSN 212          
BLAST of Adenylate kinase vs. Ensembl Mouse
Match: Ak4 (adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:87979])

HSP 1 Score: 138.658 bits (348), Expect = 3.271e-39
Identity = 72/214 (33.64%), Postives = 130/214 (60.75%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            + A++LGP GSGKGT   ++A+ F + HLS+G +LR  + +G+ +G    + ++KG L+ D ++ +L+   L   + ++ ++LDGFPRT+ QAE LD + +     +D VI L+     L+ R+S R  H +SGR Y+ +F PP+   IDDITGE L++++DD  + + + L  Y+   +P++  Y+ R + H+    +  ++++  +  +F N
Sbjct:    6 LRAVILGPPGSGKGTVCERIAQNFGLQHLSSGHLLRENLKTGTEVGDVAKQYLEKGLLVPDHVITRLMMSELETRSAQH-WLLDGFPRTLVQAEALDGICD-----VDLVISLNIPFETLKDRLSRRWIHPSSGRVYNLDFNPPQVQGIDDITGEPLVQQEDDKPEAVAARLRRYKDAAKPVIELYKSRGVLHQFSGTE-TNRIWPYVYTLFSN 212          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q8AVD3|KAD2_XENLA (Adenylate kinase 2, mitochondrial OS=Xenopus laevis OX=8355 GN=ak2 PE=2 SV=1)

HSP 1 Score: 276.944 bits (707), Expect = 3.515e-92
Identity = 131/218 (60.09%), Postives = 161/218 (73.85%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENIHLQ 850
            + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL+ P C+ GF+LDGFPRTV QAE LD LLEKR   +D VIE   +D +L RRI GRL H +SGRSYHEEF PPK+PM DD+TGE LIRR DDN  TLKS L +Y T   PLV YY++  ++  V+AAQ PD VF  IL  F   H +
Sbjct:   18 IRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGKRLKATMDAGKLVSDEMVVELIEKNLDTPPCKKGFLLDGFPRTVKQAEMLDELLEKRQEKLDSVIEFKVDDSLLVRRICGRLIHASSGRSYHEEFNPPKEPMKDDVTGEALIRRSDDNESTLKSRLEAYHTMTSPLVDYYQRHGIHTAVDAAQSPDVVFASILAAFSKAHCK 235          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|B4PAR6|KAD2_DROYA (Adenylate kinase OS=Drosophila yakuba OX=7245 GN=Adk2 PE=3 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 8.948e-91
Identity = 130/218 (59.63%), Postives = 162/218 (74.31%), Query Frame = 2
Query:  185 QKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            Q   +NAILLGP GSGKGTQAP L EKF +CHLSTGDMLRA +SSGS LG ++ ++M  G L+SDE+V  +I  NL+ P C+NGF+LDGFPRTV QAEKLD LL+KR +++D VIE + +D +L RRI+GRL H  SGRSYHEEF PPK+PM DD+TGE LIRR DDN + LK  L +Y  + +PLV YY  R L+ +V+AA+    VF  I  IF+N
Sbjct:   15 QNIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDELVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIFQN 232          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q9WTP6|KAD2_MOUSE (Adenylate kinase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ak2 PE=1 SV=5)

HSP 1 Score: 273.092 bits (697), Expect = 1.174e-90
Identity = 129/212 (60.85%), Postives = 160/212 (75.47%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            + A+LLGP G+GKGTQAPKLAE F +CHL+TGDMLRA+V+SGS LG+++   M  G L+SDE+V +LI +NL  P+C+NGF+LDGFPRTV QAE LD L+EKR   +D VIE S +D +L RRI+GRL H  SGRSYHEEF PPK+PM DDITGE LIRR DDN   LK+ L +Y T+  PLV YY KR ++  ++A+Q PD VF  IL  F
Sbjct:   16 IRAVLLGPPGAGKGTQAPKLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPSCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIQDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKTRLEAYHTQTTPLVEYYRKRGIHCAIDASQTPDIVFASILAAF 227          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|B4MQT3|KAD2_DROWI (Adenylate kinase OS=Drosophila willistoni OX=7260 GN=Adk2 PE=3 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 1.201e-90
Identity = 130/213 (61.03%), Postives = 162/213 (76.06%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFE 835
            +NAILLGP GSGKGTQAP L EKF +CHLSTGDMLRA +SSGS LG ++ ++M +G L+SDE+V  +I  NL+ P C+NGF+LDGFPRTV QA+KLD LL+KR +++D V+E S +D++L RRI+GRL H  SGRSYHEEF PPKQPM DDITGE LIRR DDN + LK  L SY  + +PLV YY  R L+ +V+AA+    VF  I  IF+
Sbjct:   19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDEGKLVSDELVVNMIDSNLDKPECKNGFLLDGFPRTVVQAQKLDTLLDKRKTNLDAVVEFSIDDNLLVRRITGRLIHQASGRSYHEEFAPPKQPMKDDITGEPLIRRSDDNAEALKKRLESYHKQTKPLVDYYGFRGLHFKVDAARKSSDVFSKIDSIFQ 231          
BLAST of Adenylate kinase vs. UniProt/SwissProt
Match: sp|Q1L8L9|KAD2_DANRE (Adenylate kinase 2, mitochondrial OS=Danio rerio OX=7955 GN=ak2 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 5.838e-90
Identity = 130/219 (59.36%), Postives = 162/219 (73.97%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M  G L+SDE+V +LI  NL+ P C+NGF+LDGFPRTV QAE LD L+EKR+  +D VIE S +D +L RRI GRL H  SGRSYHEEF+PPK+ M DD+TGE LIRR DDN  TL+S L SY  +  PLV YY  R L+  ++A+Q  D VF  IL  F
Sbjct:   11 VSGIRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDDLMEKRSEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFHPPKEHMKDDVTGEPLIRRSDDNETTLRSRLESYHRQTSPLVQYYSARGLHTAIDASQSTDLVFASILAAF 229          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A482WEB0 (Adenylate kinase (Fragment) OS=Asbolus verrucosus OX=1661398 GN=BDFB_000686 PE=3 SV=1)

HSP 1 Score: 283.493 bits (724), Expect = 3.312e-92
Identity = 132/217 (60.83%), Postives = 169/217 (77.88%), Query Frame = 2
Query:  182 QQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            Q  + +NA+LLGP GSGKGTQAPKL EK+ +CHLSTGDMLRA + SGS LG ++ +IM +G L+SD++V  +I +NL+ P C+NGF+LDGFPRTV QAEKLD LLEKRN+ +D VIE   +D++L RRI+GRL H  SGRSYHEEF+PP++PM DD+TGE LIRR DDN + LK  L +Y T+  PLV YY+ R L+HRV+AA+  + VF +I KIF
Sbjct:   12 QDATGINAVLLGPPGSGKGTQAPKLKEKYCVCHLSTGDMLRAEILSGSALGSKLKKIMDEGKLVSDDLVVNMIDKNLDSPECKNGFLLDGFPRTVVQAEKLDDLLEKRNTGLDAVIEFGIDDNLLVRRITGRLIHSASGRSYHEEFHPPRKPMTDDLTGEPLIRRSDDNAEALKKRLQAYHTQTRPLVDYYQIRGLHHRVDAAKAAETVFCNIDKIF 228          
BLAST of Adenylate kinase vs. TrEMBL
Match: C3Y4K4 (Adenylate kinase OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_115743 PE=3 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 6.050e-91
Identity = 131/217 (60.37%), Postives = 165/217 (76.04%), Query Frame = 2
Query:  182 QQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +Q   + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M +G L+SDE+V ++I  NL+ P C+NGF+LDGFPRTV QA+KLD LL+ R S +D V+E   +D +L RRI GRL H  SGRSYHEEF PPK  M DD+TGE LIRR DDN +TL   L +Y T+ +PLV YY+KRNL+ +V+AAQ PD VF  I  IF
Sbjct:   13 EQSVGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAVVASGSELGKRLKETMDQGKLVSDEMVVEMIDNNLDKPECKNGFLLDGFPRTVTQAKKLDDLLDTRESKLDSVVEFGIDDSLLVRRICGRLIHKPSGRSYHEEFNPPKVDMTDDVTGEPLIRRSDDNAETLTKRLEAYHTQTKPLVDYYQKRNLHAKVDAAQSPDIVFASIQAIF 229          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A3N0XZR4 (Adenylate kinase 2, mitochondrial OS=Anabarilius grahami OX=495550 GN=AK2 PE=3 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 7.283e-91
Identity = 133/219 (60.73%), Postives = 163/219 (74.43%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M  G L+SDE+V +LI  NL+ P C+NGF+LDGFPRTV QAE LD LLEKR   +D ++E S +D +L RRI GRL H  SGRSYHEEF PPK+PM DD+TGE LIRR DDN +TL+S L SY  +  PLV YY  R L+  V+AAQ PD VF  IL  F
Sbjct:   11 VSGVRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDGLLEKRTEKLDSLVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDVTGEPLIRRSDDNENTLRSRLESYHRQTAPLVQYYSARGLHTAVDAAQSPDLVFASILAAF 229          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A498LIT6 (Adenylate kinase 2, mitochondrial OS=Labeo rohita OX=84645 GN=AK2 PE=3 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 1.632e-90
Identity = 133/219 (60.73%), Postives = 163/219 (74.43%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ E M  G L+SDE+V +LI  NL+ P C+NGF+LDGFPRTV QAE LD LLEKR+  +D V+E S +D +L RRI GRL H  SGRSYHEEF PPK+PM DD+TGE LIRR DDN  TL+S L SY  +  PLV YY  R L+  V+A+Q PD VF  IL  F
Sbjct:   11 VSGVRKGIRAILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAMVASGSELGQRLKETMDAGKLVSDEMVVELIDNNLDTPACKNGFLLDGFPRTVKQAEMLDGLLEKRSEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDLTGEPLIRRSDDNETTLRSRLESYHKQTAPLVQYYSARGLHAAVDASQSPDLVFASILAAF 229          
BLAST of Adenylate kinase vs. TrEMBL
Match: A0A2B4RS52 (Adenylate kinase OS=Stylophora pistillata OX=50429 GN=ak2 PE=3 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.932e-90
Identity = 129/216 (59.72%), Postives = 163/216 (75.46%), Query Frame = 2
Query:  188 KSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFE 835
            K  VN ILLGP G+GKGTQAPKLAEK+ +CHL+TGDMLRA+V+SGS LG+++ ++M  G L+SD +V +LI +NL  P C NGF+LDGFPRTV QAEKLD LLEKR + +D V+E   +D +L RRI+GRL H  SGR+YH EF PPK+PM DDITGE L+RR DDN  TL   L +Y  +  PLV YY+KR L+ R++AA+ PD VF+ +L  FE
Sbjct:   37 KKGVNGILLGPPGAGKGTQAPKLAEKYCVCHLATGDMLRAVVASGSTLGKKVKQVMDSGQLVSDALVVELIDDNLGKPACANGFLLDGFPRTVVQAEKLDELLEKRKTALDAVVEFGIDDSLLVRRITGRLLHKPSGRTYHNEFNPPKKPMTDDITGEPLVRRSDDNEATLTKRLEAYHKQTSPLVDYYKKRGLHSRIDAAETPDVVFNSVLNEFE 252          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 267.7 bits (683), Expect = 1.832e-89
Identity = 128/219 (58.45%), Postives = 161/219 (73.52%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAP+LAEKF +CHL+TGDMLRA+V+SGS LG+++ + M  G L+SDE+V +LI +NL+ P C+NGF+LDGFPRTV QAE LD LL+KR   +D V+E S +D +L RRI GRL H  SGRSYHEEF PPK+ M DD+TGE L RR DDN +TL+S L SY  +  PLV YY  R L+  V+A+  PD VF  IL  F
Sbjct:   11 VSGVRKGIRAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKNGFLLDGFPRTVKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEHMKDDVTGEPLSRRSDDNENTLRSRLESYHRQTAPLVEYYSARGLHRAVDASLSPDLVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:103022510])

HSP 1 Score: 266.929 bits (681), Expect = 4.166e-89
Identity = 128/219 (58.45%), Postives = 161/219 (73.52%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +S  +  + AILLGP G+GKGTQAP+LAEKF +CHL+TGDMLRA+V+SGS LG+++ + M  G L+SDE+V +LI +NL+ P C+NGF+LDGFPRTV QAE LD LL+KR   +D V+E S +D +L RRI GRL H  SGRSYHEEF PPK+ M DD+TGE L RR DDN +TL+S L SY  +  PLV YY  R L+  V+A+  PD VF  IL  F
Sbjct:   11 VSGVRKGIRAILLGPPGAGKGTQAPRLAEKFCVCHLATGDMLRAMVASGSELGQRLKQTMDAGKLVSDEMVVELIEKNLDTPPCKNGFLLDGFPRTVKQAEMLDDLLDKRTEKLDSVVEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEHMKDDVTGEPLSRRSDDNENTLRSRLESYHRQTAPLVEYYSARGLHRAVDASLSPDLVFASILAAF 229          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:103033473])

HSP 1 Score: 149.828 bits (377), Expect = 1.356e-43
Identity = 72/189 (38.10%), Postives = 121/189 (64.02%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            A+++GP GSGKGT + ++ + F + HLS+GD+LRA + + + LG  +   + +G L+ D+++ +LI  NL + +  + ++LDGFPRTV QAE LD++       +D VI L      ++ R++ R  H+ SGR Y+ +F PPK P +DD+TGE LI+R+DD  +T+   L +Y  + +P++ YY  + +
Sbjct:    9 AVIMGPPGSGKGTVSNRITDSFGLKHLSSGDILRANIKAKTELGLLMKSCIDQGQLVPDDVISRLILSNLRNMD-HSSWLLDGFPRTVAQAESLDSMCT-----VDTVINLDVPFQTIKERLTSRWLHLPSGRVYNTDFNPPKIPGLDDVTGEPLIQREDDTPETVTRRLKAYEFQTQPVLEYYRSKGV 191          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 130.183 bits (326), Expect = 4.072e-36
Identity = 71/191 (37.17%), Postives = 113/191 (59.16%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYH 775
            A+++GP GSGKGT + ++A  F + HLS+GD LR  ++S +  G      ++KG L+ D ++ +L+   L    C + ++LDGFPRT+ QAE L++  E     +D VI L+     L+ R+S R  H  SGR Y+  F PP+   +DDITGE LI++ DD  + L + L  Y+   +P++  Y+ + + H
Sbjct:    7 AVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTC-HSWLLDGFPRTLAQAEALNSSCE-----LDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHYKDVAKPVIDVYKAKGILH 191          
BLAST of Adenylate kinase vs. Ensembl Cavefish
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:103040221])

HSP 1 Score: 130.183 bits (326), Expect = 4.891e-36
Identity = 71/191 (37.17%), Postives = 113/191 (59.16%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYH 775
            A+++GP GSGKGT + ++A  F + HLS+GD LR  ++S +  G      ++KG L+ D ++ +L+   L    C + ++LDGFPRT+ QAE L++  E     +D VI L+     L+ R+S R  H  SGR Y+  F PP+   +DDITGE LI++ DD  + L + L  Y+   +P++  Y+ + + H
Sbjct:   14 AVIMGPPGSGKGTISERIARGFGLQHLSSGDFLRENIASNTEAGVLAKTYIEKGLLVPDHVMTRLLLPRLEEMTC-HSWLLDGFPRTLAQAEALNSSCE-----LDLVISLNIPLETLKERLSHRWIHQASGRVYNMCFNPPRVQGVDDITGEPLIQQDDDKPEALVARLRHYKDVAKPVIDVYKAKGILH 198          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:321793])

HSP 1 Score: 103.99 bits (258), Expect = 3.374e-28
Identity = 51/89 (57.30%), Postives = 58/89 (65.17%), Query Frame = 2
Query:  566 ISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            +  RL H  SGRSYHEEF PP  PM DD+TGE LIRR DDN   L S L SY T+  PLV YY++R L+  V+AAQ PD VF  I   F
Sbjct:    1 VCSRLIHKESGRSYHEEFNPPIVPMRDDVTGEPLIRRSDDNEQALASRLASYHTQTSPLVGYYQRRGLHTAVDAAQSPDVVFASIQAAF 89          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ak5l (adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE-050410-2])

HSP 1 Score: 74.3294 bits (181), Expect = 3.413e-16
Identity = 64/214 (29.91%), Postives = 99/214 (46.26%), Query Frame = 2
Query:  215 GPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQ---INEIMQKGGLISDEI-VCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIR--RKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            G  GSGKGTQ+ KL+E + +  +S G++LR  V   +P  R+   I +I+ KG L   E  + +L    L +P+   GFV+DGFPR + QA       E++    D VI L+     L +R+                             GE+  R  R DDN   ++  L ++R    PLV +Y++R L    +A +   ++F DI    E+
Sbjct:    1 GGPGSGKGTQSRKLSESYGLVCVSLGEVLRQHVLQRAPSNRKWRLIAQIISKGELAPQETAIWELKQHFLQNPDA-PGFVIDGFPREISQA----LAFEEQVGAPDAVILLACASERLRQRL-----------------------------GERADRHGRPDDNPRAVERRLATFRQHTVPLVQHYQERGLLLTFDADREEGELFGDIGAAVES 180          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005320.1 (pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gene:ENSPMAG00000004809.1 transcript:ENSPMAT00000005320.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 9.538e-9
Identity = 39/128 (30.47%), Postives = 57/128 (44.53%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDM-------LRAIVSSGS-------------PLGRQINE-----------IMQKGGLISDEIVCKLISENLNHPNCRN-GFVLDGFPRTVGQAEKL 484
            +   +LGP  +GK T A  L + +KI H++  D+       L  IV S S                  + E           ++Q  G + D  + +L  E L+ P C+N GFVLDGFP+T  QA +L
Sbjct:  271 IRICILGPPVTGKTTVAQMLCKHYKIHHVNMKDVITEALSKLERIVGSASRKEETEWHEEDVEAFTEDVQEAQDFLEALRENMLQNEGRLEDSYLVRLYKETLSSPPCQNQGFVLDGFPKTFSQAVQL 398          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: spef2 (sperm flagellar 2 [Source:NCBI gene;Acc:553375])

HSP 1 Score: 51.6026 bits (122), Expect = 1.433e-7
Identity = 25/66 (37.88%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  299 LRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALL 496
            L  I S+   LGRQ +E++ +GG++ D+++  L+ + L     + G++LDGFP TV QA+ L+  L
Sbjct:  575 LSNITSNVVELGRQASEVLAQGGVVPDQLLVFLVLQALRELPEQTGWILDGFPATVQQAKLLEKAL 640          
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004607.1 (pep scaffold:Pmarinus_7.0:GL477409:196306:217011:1 gene:ENSPMAG00000004138.1 transcript:ENSPMAT00000004607.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 6.391e-6
Identity = 42/183 (22.95%), Postives = 71/183 (38.80%), Query Frame = 2
Query:  209 LLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINE------------------------------IMQKGGLISDEIVCKLISENLNHPNCRN-GFVLDGFPRTVGQAEKL-----------DALLEKRNSH-----IDGVIELSAEDHILERRISGRLFHITSGRSYHEE 616
            +LGP   GK +   KL + +++ H+   D++   +     +  +  +                              + Q  G + D  + +   E L   +C+N GF+LDGFP+T  QA++L           DA+  K N +      D V+ L A D  L  R+      + +G  Y EE
Sbjct:  384 VLGPPAVGKTSLVEKLCKHYRLHHIKAKDVIDEAIERLERIAARAQKEGEEEEHRETGEEEQEDEDAQELLEAVKESLEQNNGRLEDTYLVRFFKEKLRSMSCQNQGFILDGFPKTYAQAKELFTGEDDAEEEEDAISGKENYYDKSIIPDLVVSLEAPDEFLRDRVMNLPEAVVAGTHYTEE 566          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK1 (Adenylate kinase, required for purine metabolism; localized to the cytoplasm and the mitochondria; lacks cleavable signal sequence; protein abundance increases in response to DNA replication stress; mutations affecting Adk1p catalytic activity deregulate expression of phosphate utilization genes PHO5 and PHO84; human homolog AK1 can complement yeast adk1 mutant [Source:SGD;Acc:S000002634])

HSP 1 Score: 236.884 bits (603), Expect = 1.907e-78
Identity = 107/211 (50.71%), Postives = 154/211 (72.99%), Query Frame = 2
Query:  194 SVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENL-NHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDIL 823
            S+  +L+GP G+GKGTQAP L E+F   HL+TGDMLR+ ++ G+ LG +  +IM +GGL+SD+I+  +I + L N+P C+NGF+LDGFPRT+ QAEKLD +L+++ + ++  IEL  +D +L  RI+GRL H  SGRSYH+ F PPK+ M DD+TGE L++R DDN D LK  L +Y  + EP+V +Y+K  ++  V+A+QPP  V+ DIL
Sbjct:    6 SIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIELKVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLAAYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADIL 216          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: ADK2 (Mitochondrial adenylate kinase; catalyzes the reversible synthesis of GTP and AMP from GDP and ADP; may serve as a back-up for synthesizing GTP or ADP depending on metabolic conditions; 3' sequence of ADK2 varies with strain background [Source:SGD;Acc:S000000972])

HSP 1 Score: 138.658 bits (348), Expect = 3.128e-40
Identity = 76/207 (36.71%), Postives = 122/207 (58.94%), Query Frame = 2
Query:  215 GPSGSGKGTQAPKLAEKF-KICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLN-----HPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHD 817
            G  GSGKGTQ  +L ++  ++  +S+GD+LR  + S S LGR+    + +G L+ D+++ +LI+  L+      P+    ++LDGFPRT  QA  LD LL++ ++ ++ V+EL   +  +  RI  R  H+ SGR Y+ ++ PPK P +DDITGE L +R DD  +  K  L  Y+   EPL  YY+K  ++  V + +  D +F +
Sbjct:   21 GAPGSGKGTQTSRLLKQIPQLSSISSGDILRQEIKSESTLGREATTYIAQGKLLPDDLITRLITFRLSALGWLKPSAM--WLLDGFPRTTAQASALDELLKQHDASLNLVVELDVPESTILERIENRYVHVPSGRVYNLQYNPPKVPGLDDITGEPLTKRLDDTAEVFKKRLEEYKKTNEPLKDYYKKSGIFGTV-SGETSDIIFRN 224          
BLAST of Adenylate kinase vs. Ensembl Yeast
Match: URA6 (Uridylate kinase; catalyzes the seventh enzymatic step in the de novo biosynthesis of pyrimidines, converting uridine monophosphate (UMP) into uridine-5'-diphosphate (UDP) [Source:SGD;Acc:S000001507])

HSP 1 Score: 75.485 bits (184), Expect = 1.064e-16
Identity = 63/221 (28.51%), Postives = 105/221 (47.51%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVS-SGSPLGRQINEIMQKGGLISDEIVCKL----ISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGE-KLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDI 820
             S  + SV  +L GP G+GKGTQ  KL + +   HLS GD+LRA    +GS  G  I   +++G ++  EI   L    IS+N+     ++ F++DGFPR + QA                   +S E  I+E +    LF           F  P+  M++ +    K   R DDN++++K    +++    P++ Y+E ++   RV   +  + V+ D+
Sbjct:   11 FSPDQVSVIFVLGGP-GAGKGTQCEKLVKDYSFVHLSAGDLLRAEQGRAGSQYGELIKNCIKEGQIVPQEITLALLRNAISDNVKAN--KHKFLIDGFPRKMDQA-------------------ISFERDIVESKFI--LF-----------FDCPEDIMLERLLERGKTSGRSDDNIESIKKRFNTFKETSMPVIEYFETKSKVVRVRCDRSVEDVYKDV 196          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO30550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G9])

HSP 1 Score: 246.128 bits (627), Expect = 1.735e-81
Identity = 114/214 (53.27%), Postives = 155/214 (72.43%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFEN 838
            V AILLGP GSGKGTQ  +      +C L   DMLRA+V+SGS LG+++  +M  G L+SD++V +LI +NL  P C+NG++LDGFPRTV QAEKLD LLEKRN+ +D V+E +  D +L +RI+GRL H +SGR+YH EF PPK+ M DDITGE L RR DDN  TL   L +Y ++  PL+ YY KR ++H+++A++PPD V+  +LK F++
Sbjct:   15 VRAILLGPPGSGKGTQVKRRRISIVVCLLFC-DMLRAVVASGSALGKKVKSVMDAGQLVSDDLVVELIDDNLTKPECQNGWLLDGFPRTVAQAEKLDGLLEKRNAQLDAVVEFNIADSLLVKRITGRLLHKSSGRTYHTEFNPPKEHMKDDITGEPLERRSDDNEATLTKRLQAYHSQTTPLIDYYTKRGIHHKIDASKPPDTVYSSVLKAFDD 227          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO42583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S170])

HSP 1 Score: 130.954 bits (328), Expect = 5.619e-37
Identity = 73/186 (39.25%), Postives = 106/186 (56.99%), Query Frame = 2
Query:  212 LGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            +GP GSGKGT + ++   F + HLS+G++LR  V + + LG +    + KG L+ DE++  LI   L+    +  ++LDGFPRTVGQAE L          ID V+ +      +  RI  R  H  SGR Y+ EF PPK    DDITGE L +R+DD  +T+ + L  Y  + +PL+ YY K+ +
Sbjct:    1 MGPPGSGKGTVSERIVRDFGVEHLSSGELLRHHVQNHTDLGEEAQAYILKGELVPDELMVDLILHELD--AKKGNWLLDGFPRTVGQAETL-----SEKHKIDVVVNMDVPFATIVDRIKQRWVHAVSGRVYNLEFNPPKVEGKDDITGEPLTQREDDKPETVMARLKKYEEQTKPLIEYYNKKGV 179          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38863 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK8])

HSP 1 Score: 108.227 bits (269), Expect = 1.551e-28
Identity = 64/215 (29.77%), Postives = 112/215 (52.09%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENI 841
            V  I LG  G+GKGT    + +K+  CHLS GD+LR  V+ G+  G+ I E+M++G L+  EI   L+ + +       GF++DGFPR + Q        E++ +  D V+ L   + +++ R+  R    TSGR                          DDN++T+K   +++  +  P+V +YEK++  HR++A++P ++V++ I  +F  +
Sbjct:    2 VYIITLGGPGAGKGTICDSVVKKYNYCHLSAGDLLREEVTRGNERGQMITEMMREGKLVPKEITIGLLQDAMREHKDMPGFLIDGFPRDIDQG----ITFEEQVTDSDFVLYLECTEEVMQERLLKRAE--TSGRP-------------------------DDNIETIKKRFVTFLEKTVPVVEHYEKQSKAHRIDASRPLEEVYNAISSLFAEL 185          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO38864 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBK9])

HSP 1 Score: 93.9745 bits (232), Expect = 2.721e-23
Identity = 64/211 (30.33%), Postives = 105/211 (49.76%), Query Frame = 2
Query:  212 LGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLIS-ENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENI 841
            LG  GSGKGTQ  ++ EKF   H STGD+LR  V+SGS  G+ I  +M+KG L+ + I+ +L+    +  PN   GF++DGFPR + Q  +     EK  +  + ++        ++ R+  R    TSGR                          DDN +T+ S L ++ T+  P++ +Y++     ++ A   PD+VF  + ++ E +
Sbjct:    1 LGGPGSGKGTQCARIVEKFGYTHFSTGDLLREEVNSGSERGKNIVAMMEKGELVPNGIILELLRLAMVKQPNT-TGFLIDGFPRELEQGLE----FEKELALCELLLYFECSPDTMKARLLKR--GETSGRV-------------------------DDNEETILSRLETFITQTMPVIEHYQEEGKVKKISAEGGPDEVFKKVSRVLEEL 179          
BLAST of Adenylate kinase vs. Ensembl Nematostella
Match: EDO36160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH0])

HSP 1 Score: 77.7962 bits (190), Expect = 3.953e-17
Identity = 56/224 (25.00%), Postives = 100/224 (44.64%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHID--GVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENI 841
            +S     V   +LG  G+GKGTQ  ++ +++   HLS G++LR    SGS  G  I   M +G ++   I   L+ + +   + +  F++DGFPR     + L     + N  +D   V+     + I   RI  R      G+S                       R DDN+++L+    ++     P++ +Y ++ L   +  A  PD+VF  + ++FE++
Sbjct:    1 MSSASKPVVIFVLGGPGAGKGTQCERIVKEYGYVHLSAGELLREERRSGSKDGDLIENCMTEGKIVPVAITVSLLQKAMAKSDVQK-FLIDGFPRN---EDNLQGWESRMNDKVDVKAVLFFECPEDICIGRIMSR------GQSSG---------------------RPDDNIESLRKRFHTHENSTMPIIEHYRRQGLVKPISGAPTPDEVFLQVKRVFESL 193          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak2 (adenylate kinase 2 [Source:NCBI gene;Acc:101169712])

HSP 1 Score: 266.159 bits (679), Expect = 8.819e-89
Identity = 125/219 (57.08%), Postives = 160/219 (73.06%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIF 832
            I+     + AILLGP G+GKGTQAP+LAEK+ +CHL+TGDMLRA+V+SGS LG+++ + M  G L+SDE+V +LI +NL+   C+NGF+LDGFPRTV QAE LD LL+KR   +D VIE S +D +L RRI GRL H  SGRSYHEEF PPK+PM DD+TGE LIRR DDN  TL+S L +Y  +  PLV YY  R ++  ++AAQ P+ V   I+  F
Sbjct:   11 IADVHEGIRAILLGPPGAGKGTQAPRLAEKYCVCHLATGDMLRAMVASGSELGKRLKQTMDSGKLVSDEMVVELIEKNLDTAACKNGFLLDGFPRTVKQAEMLDDLLDKRQEKLDSVIEFSVDDSLLVRRICGRLIHQPSGRSYHEEFNPPKEPMKDDVTGEPLIRRSDDNETTLRSRLDAYHRQTAPLVQYYSARGIHTAIDAAQSPNVVLASIMAAF 229          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak3 (adenylate kinase 3 [Source:NCBI gene;Acc:101160331])

HSP 1 Score: 145.591 bits (366), Expect = 5.950e-42
Identity = 72/191 (37.70%), Postives = 118/191 (61.78%), Query Frame = 2
Query:  197 VNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNL 769
            + A+++GP GSGKGT + ++ + F + H+S+GD+LRA +   + LG  +   M +G L+ D ++ +LI ++L        ++LDGFPRTV QAE LD     +   +D VI L+     ++ R++ R  HI+SGR Y+ +F PPK P  DD+TGE L++R DD  DT+   L +Y T+ +P++ +Y  + +
Sbjct:    8 LRAVIMGPPGSGKGTVSARIVKSFGVKHISSGDILRANIKQQTELGLLVRSCMDQGQLVPDGLMSRLILKDLKSME-HISWLLDGFPRTVSQAEALD-----QAYTLDTVINLNVPFQTIKERLTSRWTHISSGRVYNTDFNPPKVPGFDDVTGEPLVQRDDDKPDTVTQRLKAYETQTQPVLEFYRSKGV 192          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak4 (adenylate kinase 4 [Source:NCBI gene;Acc:101175146])

HSP 1 Score: 120.553 bits (301), Expect = 2.450e-32
Identity = 68/197 (34.52%), Postives = 111/197 (56.35%), Query Frame = 2
Query:  203 AILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQ 793
            A +LGP GSGKGT + ++A+ F + ++S+GD LRA + + +  G Q+   +++G  + D +V  L+   L   +  + ++LDGFPRT+ QA  L+ + +     +D VI L+     L+ R+S R  H  SGR Y+  F PP+    DDITGE LI+  DD  + L S L  Y+   +P++  Y+ + + H     +
Sbjct:    7 AAILGPPGSGKGTISKRIAQSFGLQYVSSGDYLRAGIPANTEAGVQMKTYIERGLSVPDHVVTGLVLPKLEQLSSHS-WLLDGFPRTLAQALVLNNVYQ-----LDLVISLNIPYETLKDRLSDRWIHPASGRVYNMSFNPPRVQGKDDITGEPLIQHDDDKPEALMSRLRQYKEVAKPVIDLYKTQGILHSFSGTE 197          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 105.145 bits (261), Expect = 5.970e-27
Identity = 67/213 (31.46%), Postives = 110/213 (51.64%), Query Frame = 2
Query:  209 LLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENL-NHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENIH 844
            ++G  GSGKGTQ  ++  K+   HLS+GD+LRA V+SGS  G+Q+  IMQKG L+  + V  +I + +    +   GF++DG+PR V Q E+     EK+      ++ + A+   + +R+  R    TSGRS                         DDN +T+K  L  Y    EP++ +YE R +  +V++  P D+VF  + +  +++ 
Sbjct:   13 VVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEE----FEKKIGKPCLLLYVDAKSETMIKRLLKR--GETSGRS-------------------------DDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of Adenylate kinase vs. Ensembl Medaka
Match: ak1 (adenylate kinase 1 [Source:NCBI gene;Acc:101156342])

HSP 1 Score: 105.145 bits (261), Expect = 7.086e-27
Identity = 67/213 (31.46%), Postives = 110/213 (51.64%), Query Frame = 2
Query:  209 LLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENL-NHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENIH 844
            ++G  GSGKGTQ  ++  K+   HLS+GD+LRA V+SGS  G+Q+  IMQKG L+  + V  +I + +    +   GF++DG+PR V Q E+     EK+      ++ + A+   + +R+  R    TSGRS                         DDN +T+K  L  Y    EP++ +YE R +  +V++  P D+VF  + +  +++ 
Sbjct:   13 VVGGPGSGKGTQCERIVAKYGYTHLSSGDLLRAEVASGSDRGKQLQAIMQKGELVPLDTVLDMIKDAMIAKADVSKGFLIDGYPREVKQGEE----FEKKIGKPCLLLYVDAKSETMIKRLLKR--GETSGRS-------------------------DDNEETIKKRLDLYYKATEPVIAFYESRGIVKKVDSELPVDEVFVQVSQAIDSLK 194          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000037481.1 (SMESG000037481.1)

HSP 1 Score: 459.144 bits (1180), Expect = 2.702e-165
Identity = 224/226 (99.12%), Postives = 224/226 (99.12%), Query Frame = 2
Query:  176 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENIHLQF 853
            ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLL SYRTEMEPLV YYEKRNLYHRVEAAQPPDKVFHDILKIFENIHLQF
Sbjct:    6 ISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLRSYRTEMEPLVCYYEKRNLYHRVEAAQPPDKVFHDILKIFENIHLQF 231          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000047137.1 (SMESG000047137.1)

HSP 1 Score: 134.806 bits (338), Expect = 2.998e-39
Identity = 78/182 (42.86%), Postives = 105/182 (57.69%), Query Frame = 2
Query:  296 MLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKL--DALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFE 835
            MLRAIVSSGSPLGRQ+NEIMQ+GGLISDEIVCKLI ENL+   C+NGF+LDGFPRTVGQAEK+  + L+ +++ +++           L+ R+          +SY  +  P                            L+ Y          Y+KRN++++V+A+Q PD+VF DILK FE
Sbjct:    1 MLRAIVSSGSPLGRQVNEIMQQGGLISDEIVCKLIEENLSKQECKNGFILDGFPRTVGQAEKITGEKLVRRKDDNVE----------TLKSRL----------QSYRTDTAP----------------------------LIGY----------YQKRNVHYQVKASQKPDRVFEDILKFFE 124          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000061897.1 (SMESG000061897.1)

HSP 1 Score: 119.783 bits (299), Expect = 3.484e-32
Identity = 67/192 (34.90%), Postives = 111/192 (57.81%), Query Frame = 2
Query:  179 SQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYY 754
            S+  +S   +++G  GSGKGT + ++ + F I ++S+GD+LR  V++ + LG   ++ M  G L+ D ++  LI   +      N  ++DG+PRTV QA+ LD     +   I+ VI L     ++  R+  R  H+ SGR YH EF PP+   +DDITGE L +R DD   T+   L +Y++  +P++++Y
Sbjct:    4 SRSLNSFKCLIIGAPGSGKGTISSRINKDFSIKYISSGDLLRNNVANKTELGIHASKFMNDGKLVPDSLITDLILSEIKKYKNEN-LLIDGYPRTVEQAKVLD-----KEETINCVINLDIPFQVIIDRLKKRWTHLASGRIYHLEFNPPRISGLDDITGEPLEQRDDDKPATIALRLENYQSLADPVLYHY 189          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000060686.1 (SMESG000060686.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.843e-26
Identity = 68/224 (30.36%), Postives = 116/224 (51.79%), Query Frame = 2
Query:  179 SQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENL-NHPNCRNGFVLDGFPRTVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEKRNLYHRVEAAQPPDKVFHDILKIFENIHL 847
            S+ KS+    +LG  GSGKGTQ  K+  K+   HLS+GD+LR  V SGS  G ++ EIM+KG L+S +IV  LI + +    +  +GF++DG+PR + Q ++     E      + VI  S  + ++  R+  R    TSGR                          DDN +T+   L ++    +P++ +YEK++  H+++A+   D++F  +  + + +H+
Sbjct:   11 SKLKSAKVIFVLGGPGSGKGTQCEKIVNKYGFNHLSSGDLLREEVESGSERGNKLKEIMEKGELVSLDIVLDLIRDAMVKKIDHSHGFLIDGYPRELEQGKR----FENEIIPCECVIAFSVSEDVMRARLLKR--GETSGRV-------------------------DDNAETIIKRLKTFNELTKPVIDHYEKQHKAHQIDASGTIDEIFEKVTHVIDKLHM 203          
BLAST of Adenylate kinase vs. Planmine SMEST
Match: SMESG000027219.1 (SMESG000027219.1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.876e-15
Identity = 53/186 (28.49%), Postives = 92/186 (49.46%), Query Frame = 2
Query:  206 ILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAIVSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRN-GFVLDGFPRTVGQAEKLDAL-LEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYHEEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYE 757
            ILLGPSGSGK T A  + +K+ I  ++ GD++R  ++  +  G  +   ++K   + D ++ +LI E L +  C   G++L G+P +V QAE LD   LE        V    + + + ERR+        +G  YH  + PP    ++     ++ +   D++  +K  L  Y + +  L  YY+
Sbjct:  272 ILLGPSGSGKSTIANLICKKYSIMKVNCGDLIREAIADENKHGLAMRSYVEKNLPVPDFVLIQLIEERLTNLCCSTYGWLLYGYPLSVKQAELLDCTKLEPNRVFFLEVPSFVSLERLCERRLDP-----VTGDQYHLSYNPP----VNQSAFNRMSKHPKDDVKVIKHKLAVYNSTVIELKEYYK 448          
The following BLAST results are available for this feature:
BLAST of Adenylate kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AK21.165e-8959.91adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK21.862e-8959.91adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK22.458e-8959.91adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK27.153e-6148.11adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
AK21.553e-6048.11adenylate kinase 2 [Source:HGNC Symbol;Acc:HGNC:36... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
let-7546.704e-8355.66Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
let-7546.704e-8355.66Adenylate kinase [Source:UniProtKB/Swiss-Prot;Acc... [more]
F38B2.42.942e-2631.43Adenylate kinase isoenzyme 1 [Source:UniProtKB/Sw... [more]
ZK673.24.288e-2331.58Probable adenylate kinase isoenzyme ZK673.2 [Sour... [more]
F40F8.14.058e-2029.36UMP-CMP kinase 2 [Source:UniProtKB/Swiss-Prot;Acc... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adk26.195e-9059.62gene:FBgn0283494 transcript:FBtr0072163[more]
Adk35.033e-3433.96gene:FBgn0042094 transcript:FBtr0082331[more]
Adk35.033e-3433.96gene:FBgn0042094 transcript:FBtr0339379[more]
Adk35.033e-3433.96gene:FBgn0042094 transcript:FBtr0082330[more]
Adk35.033e-3433.96gene:FBgn0042094 transcript:FBtr0339378[more]
back to top
BLAST of Adenylate kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak24.320e-9159.36adenylate kinase 2 [Source:NCBI gene;Acc:321793][more]
ak27.734e-9159.36adenylate kinase 2 [Source:NCBI gene;Acc:321793][more]
ak31.681e-4237.11adenylate kinase 3 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.733e-3233.01adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ak41.733e-3233.01adenylate kinase 4 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak26.344e-9060.38adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
ak29.810e-9060.38adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
ak21.003e-8960.38adenylate kinase 2 [Source:NCBI gene;Acc:448011][more]
ak31.211e-4138.30adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
ak32.175e-4137.57adenylate kinase 3 [Source:NCBI gene;Acc:100170447... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ak28.866e-9260.85adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak21.679e-9160.85adenylate kinase 2 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak31.084e-3938.02adenylate kinase 3 [Source:MGI Symbol;Acc:MGI:1860... [more]
Ak43.271e-3933.64adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
Ak43.271e-3933.64adenylate kinase 4 [Source:MGI Symbol;Acc:MGI:8797... [more]
back to top
BLAST of Adenylate kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AVD3|KAD2_XENLA3.515e-9260.09Adenylate kinase 2, mitochondrial OS=Xenopus laevi... [more]
sp|B4PAR6|KAD2_DROYA8.948e-9159.63Adenylate kinase OS=Drosophila yakuba OX=7245 GN=A... [more]
sp|Q9WTP6|KAD2_MOUSE1.174e-9060.85Adenylate kinase 2, mitochondrial OS=Mus musculus ... [more]
sp|B4MQT3|KAD2_DROWI1.201e-9061.03Adenylate kinase OS=Drosophila willistoni OX=7260 ... [more]
sp|Q1L8L9|KAD2_DANRE5.838e-9059.36Adenylate kinase 2, mitochondrial OS=Danio rerio O... [more]
back to top
BLAST of Adenylate kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A482WEB03.312e-9260.83Adenylate kinase (Fragment) OS=Asbolus verrucosus ... [more]
C3Y4K46.050e-9160.37Adenylate kinase OS=Branchiostoma floridae OX=7739... [more]
A0A3N0XZR47.283e-9160.73Adenylate kinase 2, mitochondrial OS=Anabarilius g... [more]
A0A498LIT61.632e-9060.73Adenylate kinase 2, mitochondrial OS=Labeo rohita ... [more]
A0A2B4RS521.932e-9059.72Adenylate kinase OS=Stylophora pistillata OX=50429... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak21.832e-8958.45adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
ak24.166e-8958.45adenylate kinase 2 [Source:NCBI gene;Acc:103022510... [more]
ak31.356e-4338.10adenylate kinase 3 [Source:NCBI gene;Acc:103033473... [more]
ak44.072e-3637.17adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
ak44.891e-3637.17adenylate kinase 4 [Source:NCBI gene;Acc:103040221... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak23.374e-2857.30adenylate kinase 2 [Source:NCBI gene;Acc:321793][more]
ak5l3.413e-1629.91adenylate kinase 5, like [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000005320.19.538e-930.47pep scaffold:Pmarinus_7.0:GL477536:369:14184:1 gen... [more]
spef21.433e-737.88sperm flagellar 2 [Source:NCBI gene;Acc:553375][more]
ENSPMAT00000004607.16.391e-622.95pep scaffold:Pmarinus_7.0:GL477409:196306:217011:1... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ADK11.907e-7850.71Adenylate kinase, required for purine metabolism; ... [more]
ADK23.128e-4036.71Mitochondrial adenylate kinase; catalyzes the reve... [more]
URA61.064e-1628.51Uridylate kinase; catalyzes the seventh enzymatic ... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO305501.735e-8153.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425835.619e-3739.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388631.551e-2829.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388642.721e-2330.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361603.953e-1725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ak28.819e-8957.08adenylate kinase 2 [Source:NCBI gene;Acc:101169712... [more]
ak35.950e-4237.70adenylate kinase 3 [Source:NCBI gene;Acc:101160331... [more]
ak42.450e-3234.52adenylate kinase 4 [Source:NCBI gene;Acc:101175146... [more]
ak15.970e-2731.46adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
ak17.086e-2731.46adenylate kinase 1 [Source:NCBI gene;Acc:101156342... [more]
back to top
BLAST of Adenylate kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037481.12.702e-16599.12SMESG000037481.1[more]
SMESG000047137.12.998e-3942.86SMESG000047137.1[more]
SMESG000061897.13.484e-3234.90SMESG000061897.1[more]
SMESG000060686.12.843e-2630.36SMESG000060686.1[more]
SMESG000027219.12.876e-1528.49SMESG000027219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010721 ID=SMED30010721|Name=Adenylate kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=941bp
TTTCAATGGTGTTTGTTTAATGTAAGAAATAAAAATTTAATTTCCAAAAG
TAAATTAACCGGACAAACGTCTTCTCTTGTTTAAACAGGAGTTTTTCTTC
AGCATAACATTGCGTTTATTTAACTTAAATTTTCCTAATAATTTGTTTTT
CTAAAATTTAATGGGTAATCTTTTTATCAGTCAGCAAAAATCATCGGTAA
ATGCAATTTTGTTAGGACCTTCTGGATCAGGCAAAGGAACTCAAGCTCCT
AAACTGGCAGAAAAATTTAAGATTTGTCACTTGTCTACAGGAGACATGCT
TAGAGCTATAGTATCTTCAGGATCTCCATTAGGGAGACAAATCAATGAAA
TAATGCAAAAAGGTGGACTAATTTCAGATGAAATTGTTTGCAAATTAATA
AGTGAGAACCTGAATCATCCTAACTGTAGAAATGGATTTGTGCTTGACGG
ATTTCCCAGAACAGTCGGACAGGCTGAAAAACTCGATGCTTTATTGGAGA
AGCGTAATTCTCATATAGACGGTGTCATCGAATTGAGTGCGGAAGATCAT
ATTTTGGAGCGAAGAATCTCCGGTAGACTGTTTCATATTACCAGTGGTAG
ATCGTATCATGAAGAATTCTATCCCCCAAAGCAGCCAATGATTGATGATA
TAACTGGTGAGAAATTGATTCGGCGTAAAGATGATAATCTTGATACATTG
AAATCACTGCTTCTGTCTTATCGCACCGAGATGGAGCCTTTGGTTTGGTA
TTATGAAAAGAGAAATTTATATCACAGAGTTGAAGCAGCGCAGCCTCCAG
ATAAAGTTTTTCATGATATTTTAAAAATTTTTGAAAATATACATTTGCAA
TTTTAGAAATGTATTATTTTTCTTGAAATTATTTTAGTTTTATAGTTTAG
TATGTGCTAAATTCTTATTTTGTTTTCAATTGAAATATAGA
back to top

protein sequence of SMED30010721-orf-1

>SMED30010721-orf-1 ID=SMED30010721-orf-1|Name=SMED30010721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=232bp
MGNLFISQQKSSVNAILLGPSGSGKGTQAPKLAEKFKICHLSTGDMLRAI
VSSGSPLGRQINEIMQKGGLISDEIVCKLISENLNHPNCRNGFVLDGFPR
TVGQAEKLDALLEKRNSHIDGVIELSAEDHILERRISGRLFHITSGRSYH
EEFYPPKQPMIDDITGEKLIRRKDDNLDTLKSLLLSYRTEMEPLVWYYEK
RNLYHRVEAAQPPDKVFHDILKIFENIHLQF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046033AMP metabolic process
GO:0046034ATP metabolic process
GO:0046940nucleoside monophosphate phosphorylation
GO:0006139nucleobase-containing compound metabolic process
GO:0006172ADP biosynthetic process
GO:0016310phosphorylation
GO:0022008neurogenesis
GO:0046939nucleotide phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006259Adenyl_kin_sub
IPR033690Adenylat_kinase_CS
IPR036193ADK_active_lid_dom_sf
IPR000850Adenylat/UMP-CMP_kin
IPR007862Adenylate_kinase_lid-dom
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0019205nucleobase-containing compound kinase activity
GO:0004017adenylate kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0016776phosphotransferase activity, phosphate group as acceptor
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005758mitochondrial intermembrane space
GO:0005811lipid particle
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 170..190
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 6..230
e-value: 3.0E-80
score: 271.1
NoneNo IPR availablePFAMPF00406ADKcoord: 17..202
e-value: 3.1E-52
score: 177.0
NoneNo IPR availablePANTHERPTHR23359:SF170ADENYLATE KINASE 2, MITOCHONDRIALcoord: 11..225
IPR000850Adenylate kinase/UMP-CMP kinasePRINTSPR00094ADENYLTKNASEcoord: 172..187
score: 41.53
coord: 16..29
score: 68.16
coord: 93..109
score: 60.32
coord: 189..203
score: 31.3
coord: 44..58
score: 55.48
IPR000850Adenylate kinase/UMP-CMP kinasePANTHERPTHR23359NUCLEOTIDE KINASEcoord: 11..225
IPR000850Adenylate kinase/UMP-CMP kinaseCDDcd01428ADKcoord: 14..216
e-value: 1.85206E-83
score: 244.839
IPR007862Adenylate kinase, active site lid domainPFAMPF05191ADK_lidcoord: 139..174
e-value: 3.1E-12
score: 46.2
IPR006259Adenylate kinase subfamilyTIGRFAMTIGR01351TIGR01351coord: 15..224
e-value: 4.3E-69
score: 230.3
IPR033690Adenylate kinase, conserved sitePROSITEPS00113ADENYLATE_KINASEcoord: 93..104
IPR036193Adenylate kinase, active site lid domain superfamilySUPERFAMILYSSF57774Microbial and mitochondrial ADK, insert "zinc finger" domaincoord: 138..175
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 16..225