DOP1 leucine zipper like protein A

Overview
NameDOP1 leucine zipper like protein A
Smed IDSMED30010714
Length (bp)7506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DOP1 leucine zipper like protein A (SMED30010714) t-SNE clustered cells

Violin plots show distribution of expression levels for DOP1 leucine zipper like protein A (SMED30010714) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DOP1 leucine zipper like protein A (SMED30010714) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DOP1 leucine zipper like protein A (SMED30010714) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010714

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v6_6117_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010714SMESG000074794.1 SMESG000074793.1 dd_Smed_v4_6117_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 394.43 bits (1012), Expect = 1.216e-109
Identity = 312/1163 (26.83%), Postives = 555/1163 (47.72%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1348 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2343          

HSP 2 Score: 347.821 bits (891), Expect = 3.001e-95
Identity = 213/558 (38.17%), Postives = 329/558 (58.96%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 534          

HSP 3 Score: 92.0485 bits (227), Expect = 1.807e-17
Identity = 84/311 (27.01%), Postives = 149/311 (47.91%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+             S E   +  +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENIN------------SVE--PAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 394.43 bits (1012), Expect = 1.216e-109
Identity = 312/1163 (26.83%), Postives = 555/1163 (47.72%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1348 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2343          

HSP 2 Score: 347.821 bits (891), Expect = 3.001e-95
Identity = 213/558 (38.17%), Postives = 329/558 (58.96%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 534          

HSP 3 Score: 92.0485 bits (227), Expect = 1.807e-17
Identity = 84/311 (27.01%), Postives = 149/311 (47.91%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+             S E   +  +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENIN------------SVE--PAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 394.045 bits (1011), Expect = 1.590e-109
Identity = 312/1163 (26.83%), Postives = 555/1163 (47.72%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1357 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2352          

HSP 2 Score: 348.206 bits (892), Expect = 1.789e-95
Identity = 214/558 (38.35%), Postives = 334/558 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 91.6633 bits (226), Expect = 1.997e-17
Identity = 84/311 (27.01%), Postives = 149/311 (47.91%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+             S E   +  +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  751 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENIN------------SVE--PAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1011          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Match: DOP1B (DOP1 leucine zipper like protein B [Source:HGNC Symbol;Acc:HGNC:1291])

HSP 1 Score: 300.056 bits (767), Expect = 8.859e-81
Identity = 190/516 (36.82%), Postives = 302/516 (58.53%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRS--------QLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP--TSSASERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRH 1532
            E+Q+  ND ++R++++ ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++PR+ L+ KRL+QCLHPALP+GVH+KALE +++IF I+G + LA DLF+Y  G+FPLL+ +A+ ++  L  LYEKYF+ L   + P+    + GLLPGLEEG+E   R + +L + +  V    FYT LW  +L +PS+R   + F++ H NR     +Q Y LG +  L + SL   L D  VLVQR  L+ VLF    +           L  SD  ++ +A    LLRRDMSLNRR Y+WL+G+++ + N +    E  N ++ D  S         +F+KYS+D+L+  +  I+      +   ER  + +KPFR++ +L+D+ EIG  ++ ++   +I       +  + L S+  K +     N   S I+E+  +      E +KT NL   +L + F W+Y+ R F    + +KQ  +     S   T+  +C L+ F+L  +P+E YS+V +++
Sbjct:    4 EEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPRRLLISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAHAAVSVRPVLLTLYEKYFLPLQKLLLPSLQAFIVGLLPGLEEGSEISDRTDALLLRLSLVVGKEVFYTALWGSVLASPSIRLPASVFVVGHINRDAPGREQKYMLGTNHQLTVKSLRASLLDSNVLVQRNNLEIVLFFFPFYTCLDSNERAIPLLRSDIVRILSAATQTLLRRDMSLNRRLYAWLLGSDI-KGNTVVPESEISNSYE-DQSSY--------FFEKYSKDLLVEGLAEILHQKFIDADVEERHHAYLKPFRVLISLLDKPEIGPQVVGNLFLEVIRAFYS--YCRDALGSDL-KLSYTQSGNSLISAIKENRNAS-----EIVKTVNLLITSLSTDFLWDYMTRCFEECFRPVKQRYSVRNSVSPPPTVSELCALLVFLLDVIPLELYSEVQTQY 501          

HSP 2 Score: 221.476 bits (563), Expect = 7.724e-57
Identity = 134/371 (36.12%), Postives = 207/371 (55.80%), Query Frame = 3
Query: 6207 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-NDINK-------------------RLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            ++QAL+LL   LAS++D+ Y+S+EKEK  P ++ +++  V PYLR  S+ N  +FR  +QL++SLS Y +T+R+WRK++ +L  +  FFQ D  S   WK IID+L+T +K  FK+     + +            + ++Q AM +K+ AF ++S ELDQY   +P IQE+L+++LR+G    +  Q+FL FRVLL+RIS QHLTSLW I +  L      L +DLK + +S++  N +N+                    L +YLSACK LD       D +P F  Y+WAF+  +D E   F S+        +P    +++      L  G   +S E+    + +E PL+ + S+ S+  L PFF T
Sbjct: 1895 SVQALSLLAEVLASLLDMVYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNAPSFRAGAQLLSSLSGYAYTKRAWRKEVLELFLDPAFFQMDT-SCVHWKSIIDHLLTHEKTMFKDLMNMQSSS--------LKLFSSFEQKAMLLKRQAFAVFSGELDQYHLYLPLIQERLTDNLRVGQTSIVAAQMFLFFRVLLLRISPQHLTSLWPIMVSELIQTFTQLEEDLKDEDESLRSTNKVNRTKVSVPDANGPSVGEIPQSELILYLSACKFLDTALSFPPDKMPLFQIYRWAFIPEVDTEGPAFLSDVEENHQECKPHTVRILE---LLKLKFGEISSSDEI---TMKSEFPLLRQHSVSSIRQLMPFFMT 2249          

HSP 3 Score: 140.584 bits (353), Expect = 3.086e-32
Identity = 175/768 (22.79%), Postives = 330/768 (42.97%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVS--FDRCNVAKYALHCMSTSITQPEKTTNILS---------DSIMLLNES----GLDQRVRDAA-QVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW----EKSSLSEKINLNQECIPPSWTMGRPDK-VRQMILSIIKPLMRQHPSIILISLARVWP------HLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQ--VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNE 5981
            +  L  H+LLY   YDS  VLY+ S L  + ++ P   +  +                +++  S   + N I  +L+RH  AL G +FY     +          LE++  +C  F+ S YP      KVS  DI  N+ VQ+ + E+L  I+ +++++ +                  E KN+  +     RC V ++ L  +S S+   +K   + +         DS  L  ES    G DQ   +   Q+ L++L+  ++ L++ L  ++        ++++ + +   +++  L +  + + +  Y    P   ++ Q +L++++V  +       +H      +  SL  +GKS    + P V ++CKN+      YES  + +  +    S   N  P DY L+ L  L  + HF LL++A                       N++K   +  D      ++ +ARN +++ + R ++++ +LW    ++ +    ++L       S    +  K +RQ IL  + PL       +  ++A VW       H    ++   + SQ  L+  VC      + S L ++                  T+ H++   ++++++          PP++   +E    V + +L+F   FL       L      L G+LKES+  +L P   F+LL +L+DF+++    + K++Q+++Q++ QK+LE V  IAGSSLEQ SW  R  ++K       E   + E
Sbjct: 1221 VEALFKHILLYLQPYDSRRVLYAFSVLEAVLKTNPKEFIEAVSR--------------TSMDTSSTAHLNLISNLLARHQEALIGQSFYGKLQTQVPNVCPHSLLLELLTYLCLSFLRSYYP---CYLKVSHRDILGNRDVQVKSVEVLIRIMMQLVSVAKSS----------------EGKNVEFIHSLLQRCKVQEFVLLSLSASMYTSQKRYGLATAHHGRALPEDS--LFEESLINLGQDQIWSEHPLQIELLKLLQVLIVLEHHLGRAH--------EEAENQPDLSREWQRAL-NFQQAISALQYVQPHP---LTSQGLLVSAVVRGLQPAYGYGMHPAWVSLVTHSLPYFGKSLGWTVTPFVVQICKNLDDLVKQYES--ESVKLSVSTTSKRENISP-DYPLTLLEGLTTISHFCLLEQA-----------------------NQNKKTMAAGDP----ANLRNARNAILEELPRTVNTMALLWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDFLNPLTAHLGVQLTAAVAAVWSRKKAQRHSKMKIIPTASASQLTLVDLVC------ALSTLQTD------------------TLLHLV---KEVVKR----------PPQVKGGDEKSPLVDIPVLQFCYAFLQRLPVPALQENFSSLLGVLKESVQLNLAPPGYFLLLSMLNDFVTRTPNLENKKDQKDLQEITQKILEAVGNIAGSSLEQTSWLSRNLEVKAQPQASLEESDAEE 1874          

HSP 4 Score: 74.7146 bits (182), Expect = 3.144e-12
Identity = 72/328 (21.95%), Postives = 138/328 (42.07%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFST-ENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCIS----------WLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            E +   C L+++  ++P+Y +  E+ E +  +   +    +   P WL  L+T  C + +  ++++A+S LL++I        + +Q +++  ++  K   S G +  F   +      I+P                              +++ +  KT F+      LW+ L+    + H   V L  RLH  AP+A+ICE++I   +L  +    L++  RF ++W L  + + S    ++        R+FD+ +                 VVL +L  +          WL +A   G   +I+ P+LL LL+P T R S+
Sbjct:  748 EAFAAACHLLLDCATFPVYLS-EEETEQLCATLFQLPGAGDSSFPSWLKSLMTICCCVTDCYLQNVAISTLLEVI--------NHSQSLALVIEDKMKRYKSSGHNPFFGKLQMVTVPPIAPG-----------------------------ILKVIAEKTDFYQRVARVLWNQLNKETREHHVTCVELFYRLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDRSL----------------FVVLDSLACTDGAIGAAAQGWLVRALSLGDVARILEPVLLLLLQPKTQRTSI 1013          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Match: DOP1B (DOP1 leucine zipper like protein B [Source:HGNC Symbol;Acc:HGNC:1291])

HSP 1 Score: 167.548 bits (423), Expect = 5.530e-47
Identity = 72/141 (51.06%), Postives = 110/141 (78.01%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+Q+  ND ++R++++ ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++PR+ L+ KRL+QCLHPALP+GVH+KALE +++IF I+G + LA DLF+Y  G+FPLL+ +A+ ++  L  LYEKYF+ L   + P+ 
Sbjct:    4 EEQELLNDYRYRSYSSVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPRRLLISKRLAQCLHPALPSGVHLKALETYEIIFKIVGTKWLAKDLFLYSCGLFPLLAHAAVSVRPVLLTLYEKYFLPLQKLLLPSL 144          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Celegans
Match: pad-1 (pep chromosome:WBcel235:I:12878595:12902806:1 gene:WBGene00003905.1 transcript:Y18D10A.13.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pad-1)

HSP 1 Score: 276.944 bits (707), Expect = 4.540e-74
Identity = 309/1267 (24.39%), Postives = 551/1267 (43.49%), Query Frame = 3
Query: 3765 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ-PEKTTNI---------LSDSIMLLNESGLDQRVR-----DAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTS-IVACIGAMKLR-HLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANL-YESCNQIIPYTKDV--DS-----NEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY----------------------QLQEEKGSSSEQSF----------------------LGALFNKSKDN---TSKEDS-MSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNL--NSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKES-ISSLPPTAAFILLKILSDFISKVS---ISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--------DERP-------GSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQ-NESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKP-LIYRQSIHSLTDLAPFFFT 7259
            L   +H+HMLLY      +G +  L++  T FR L  ++ P                S+     S +  ++ ++E+++RH  A+ G +F+  P  +E +  K    LE+++ +   F+ S +  +     V+  D+    K +I A E L  + +E+  +L      H      Q           +   +R  + K  LH + T++   P ++++          LS SI   NE  L +  R      A   +L+    + ++L+  +   +          SD  S+++        S+ +++ +  +   +  +     ++ L + ++  + A+K + H H    QF++  L    +S + ++  +V++LCKN+  A ++ YE+     P T DV  DS     +E +  P +Y   T+  L  + HF ++D    S                       Q+  E  + +  S                       LG +F+ S D+    SK DS    G     A++ M+  +   + ++  +W          + +   PP   +G   ++R+++L ++ P+ + H    L SLA VW             ++S     V L +     +    +S Q  +  +L   + +     I+ + +T R+   K+  V I          +E       LLE +   +     T+L L    L  L  E+ +S+L   A F+L  ILSDF+  V    I ++K   R +Q++C ++ E V  I G  LE  +W +R   +K D  +         D+ P        SN     G +   + +      + IN        GS   ST ++ +     +   +  N  A    T N R  P+  T   QAL LL   L  ++D   KS+EK+KV P L +V + NV+PYL+ +++ N   F  SSQL+AS+SSY + R  W+K   DLL +S FF+ D  +LK W V+ D+LMT D+ +FK+    ++ +     ++ TSKE EY+  A  +K+L F+++ S+LDQY   M +IQE+LS++LR+   P I + +FLC RVLL+R+    L  +W    PI+ + L + +  L+  ++S +Q+        ++ + +Y++ACKLL+ +  +    +  F  + WAFV ++  +             +F+PF   + D   + Y  L  P        E + N    L   + + S  +L PFF+T
Sbjct: 1196 LFEEMHTHMLLY----GESGKVVDLARAETAFRILTALLAP--RGATGNRMLLNCLVSSGTTTTSDSSAEHSLVELMNRHVRAILGQHFWSAPASDE-EKHKHITLLELLITISLHFLRSYFLNSPIS-PVTEADLTSLWKCKISALEFLCELFRELSAMLN----EHESKQFVQ---------FVQTILNRSKLQKCILHLLLTAVDHNPMESSSSKKTGGGGGPLSVSISKFNEGLLGESRRLSPLLAAYHRSLLTFTSHAIRLECDIKRGFATF-------SDANSSHRF-------SIIQSVMNQSFNNRTSRVDNHASTVELRAFLLILLNALKKQPHRHEMWLQFVVQILPWVERSLATIVCRVVEQLCKNMENAMSVAYEN-----PPTSDVVVDSPGDVRDEPDCYPANYLAMTMELLTTLVHFCVIDSVPTSAVAGGAPGVGGAGGVTSSSGGVQQVIHENATPTPSSTSMVGHAMSVIPGSKVATELFSQLGKVFSMSGDSGGVISKLDSSRQHGNGWRQAQSDMLSSLPHSLATICNVW---------TVVRRAQPPIVPIGTNSQLRRLVLHLLSPIAQYHKHAFLTSLALVW------------LTRSTAKPTVTLRKQDPDRATFEYSSAQLDITNLLLSLQVIPFEDLISSVNSTLREASFKANKVGITTIDKANFPTEEP------LLELVHSCVSAVLQTQLRLCWSSLLSLFSEAPLSALSARAVFLLFVILSDFVKCVGGAYIVEDKAMYRNVQEVCSRLAEAVNAIVGWQLETTTWLKRTLVVKQDHGSSISSSIRSVDQSPIIEIQSSMSNVSGGGGSLDNPSGSTRNSTLSLINKPGGSIGTGSSVTSTLVDSKSENMKIEKKSSSNLRASIKDTNNNRRDPAHST---QALFLLAERLTDLLDSVSKSDEKDKVLPTLQAV-WANVVPYLKAKNARNARFFLASSQLLASMSSYSYMRPVWKKTTLDLLLDSGFFKMDHSALKQWLVVTDHLMTHDRTSFKDLLKSISYSPNTSFSIMTSKEQEYEARAQALKRLTFVVFGSQLDQYHGQMNDIQERLSDNLRVSQSPVIRSAVFLCIRVLLLRLRPHSLIGVW----PIMVTELVHALSQLEQQLQSGEQDSGATAASSDQWMQLYVAACKLLETLCTLPAGYLSHFQMFHWAFVSSVSADKT----------EIFKPFAERINDLLAKKYGELLTP--------ETMSNHTASLGAVKILTSFEELRPFFYT 2369          

HSP 2 Score: 240.35 bits (612), Expect = 6.426e-63
Identity = 150/396 (37.88%), Postives = 234/396 (59.09%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKW-----IIDNPTSS----------ASERI--SSIKPFRIITTLMDRSEIGGDIIEDILFNLI 1181
            D+K+R +A  +D+ LK FE  +EWADLI+ LGKL K+ Q+N +F  IP +  V KRLSQCLHPALP GVH+KALE +  IF I+GP KL + L+++  G+FPL+    + +K+ LF ++E Y V LG ++RPA  G L G+L  LEEG EFY R   +L++  E V P  FY CLWQ +L +P VR     ++   F++  S DDQ++ +G+ ++ M+ +L  + +D    LVQR  LDF++ A  +  + LT  D  +L   CL V+LRRDMSLNRR Y+WL    ++R+       E+  V    L    ++ ++L +FK+    ++  A+        I+ P ++           +E++  + ++  R++  L DR++IG  I+E +  + +
Sbjct:   16 DSKYRAYAKAIDQALKTFETPNEWADLISALGKLAKVFQSNAKFCAIPNRVTVAKRLSQCLHPALPMGVHLKALETYRQIFEILGPNKLPECLYLFAVGLFPLMDHCGIKVKSELFTIFENYLVPLGANLRPALPGFLGGVLLALEEGTEFYERSFILLDRVCEKVGPRAFYACLWQAILGSPPVRLPAMIYVNAKFDKLKSLDDQIHLVGDHVNHMVAALCAVADDTGSPLVQRYLLDFLVAAFPLDSTNLTNEDFVQLLRRCLFVVLRRDMSLNRRLYTWL----INRSG------ETKGVSGLSLGG-PDDGIELTFFKERVLGLVHGALGEYLALDTIETPFANHQNSMWGDRKEAEQVQFAEVRVCRLLLYLQDRADIGRTILETVFADFL 400          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Celegans
Match: pad-1 (pep chromosome:WBcel235:I:12878639:12902806:1 gene:WBGene00003905.1 transcript:Y18D10A.13.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pad-1)

HSP 1 Score: 276.944 bits (707), Expect = 4.540e-74
Identity = 309/1267 (24.39%), Postives = 551/1267 (43.49%), Query Frame = 3
Query: 3765 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ-PEKTTNI---------LSDSIMLLNESGLDQRVR-----DAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTS-IVACIGAMKLR-HLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANL-YESCNQIIPYTKDV--DS-----NEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY----------------------QLQEEKGSSSEQSF----------------------LGALFNKSKDN---TSKEDS-MSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNL--NSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKES-ISSLPPTAAFILLKILSDFISKVS---ISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--------DERP-------GSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQ-NESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKP-LIYRQSIHSLTDLAPFFFT 7259
            L   +H+HMLLY      +G +  L++  T FR L  ++ P                S+     S +  ++ ++E+++RH  A+ G +F+  P  +E +  K    LE+++ +   F+ S +  +     V+  D+    K +I A E L  + +E+  +L      H      Q           +   +R  + K  LH + T++   P ++++          LS SI   NE  L +  R      A   +L+    + ++L+  +   +          SD  S+++        S+ +++ +  +   +  +     ++ L + ++  + A+K + H H    QF++  L    +S + ++  +V++LCKN+  A ++ YE+     P T DV  DS     +E +  P +Y   T+  L  + HF ++D    S                       Q+  E  + +  S                       LG +F+ S D+    SK DS    G     A++ M+  +   + ++  +W          + +   PP   +G   ++R+++L ++ P+ + H    L SLA VW             ++S     V L +     +    +S Q  +  +L   + +     I+ + +T R+   K+  V I          +E       LLE +   +     T+L L    L  L  E+ +S+L   A F+L  ILSDF+  V    I ++K   R +Q++C ++ E V  I G  LE  +W +R   +K D  +         D+ P        SN     G +   + +      + IN        GS   ST ++ +     +   +  N  A    T N R  P+  T   QAL LL   L  ++D   KS+EK+KV P L +V + NV+PYL+ +++ N   F  SSQL+AS+SSY + R  W+K   DLL +S FF+ D  +LK W V+ D+LMT D+ +FK+    ++ +     ++ TSKE EY+  A  +K+L F+++ S+LDQY   M +IQE+LS++LR+   P I + +FLC RVLL+R+    L  +W    PI+ + L + +  L+  ++S +Q+        ++ + +Y++ACKLL+ +  +    +  F  + WAFV ++  +             +F+PF   + D   + Y  L  P        E + N    L   + + S  +L PFF+T
Sbjct: 1196 LFEEMHTHMLLY----GESGKVVDLARAETAFRILTALLAP--RGATGNRMLLNCLVSSGTTTTSDSSAEHSLVELMNRHVRAILGQHFWSAPASDE-EKHKHITLLELLITISLHFLRSYFLNSPIS-PVTEADLTSLWKCKISALEFLCELFRELSAMLN----EHESKQFVQ---------FVQTILNRSKLQKCILHLLLTAVDHNPMESSSSKKTGGGGGPLSVSISKFNEGLLGESRRLSPLLAAYHRSLLTFTSHAIRLECDIKRGFATF-------SDANSSHRF-------SIIQSVMNQSFNNRTSRVDNHASTVELRAFLLILLNALKKQPHRHEMWLQFVVQILPWVERSLATIVCRVVEQLCKNMENAMSVAYEN-----PPTSDVVVDSPGDVRDEPDCYPANYLAMTMELLTTLVHFCVIDSVPTSAVAGGAPGVGGAGGVTSSSGGVQQVIHENATPTPSSTSMVGHAMSVIPGSKVATELFSQLGKVFSMSGDSGGVISKLDSSRQHGNGWRQAQSDMLSSLPHSLATICNVW---------TVVRRAQPPIVPIGTNSQLRRLVLHLLSPIAQYHKHAFLTSLALVW------------LTRSTAKPTVTLRKQDPDRATFEYSSAQLDITNLLLSLQVIPFEDLISSVNSTLREASFKANKVGITTIDKANFPTEEP------LLELVHSCVSAVLQTQLRLCWSSLLSLFSEAPLSALSARAVFLLFVILSDFVKCVGGAYIVEDKAMYRNVQEVCSRLAEAVNAIVGWQLETTTWLKRTLVVKQDHGSSISSSIRSVDQSPIIEIQSSMSNVSGGGGSLDNPSGSTRNSTLSLINKPGGSIGTGSSVTSTLVDSKSENMKIEKKSSSNLRASIKDTNNNRRDPAHST---QALFLLAERLTDLLDSVSKSDEKDKVLPTLQAV-WANVVPYLKAKNARNARFFLASSQLLASMSSYSYMRPVWKKTTLDLLLDSGFFKMDHSALKQWLVVTDHLMTHDRTSFKDLLKSISYSPNTSFSIMTSKEQEYEARAQALKRLTFVVFGSQLDQYHGQMNDIQERLSDNLRVSQSPVIRSAVFLCIRVLLLRLRPHSLIGVW----PIMVTELVHALSQLEQQLQSGEQDSGATAASSDQWMQLYVAACKLLETLCTLPAGYLSHFQMFHWAFVSSVSADKT----------EIFKPFAERINDLLAKKYGELLTP--------ETMSNHTASLGAVKILTSFEELRPFFYT 2369          

HSP 2 Score: 240.35 bits (612), Expect = 6.426e-63
Identity = 150/396 (37.88%), Postives = 234/396 (59.09%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKW-----IIDNPTSS----------ASERI--SSIKPFRIITTLMDRSEIGGDIIEDILFNLI 1181
            D+K+R +A  +D+ LK FE  +EWADLI+ LGKL K+ Q+N +F  IP +  V KRLSQCLHPALP GVH+KALE +  IF I+GP KL + L+++  G+FPL+    + +K+ LF ++E Y V LG ++RPA  G L G+L  LEEG EFY R   +L++  E V P  FY CLWQ +L +P VR     ++   F++  S DDQ++ +G+ ++ M+ +L  + +D    LVQR  LDF++ A  +  + LT  D  +L   CL V+LRRDMSLNRR Y+WL    ++R+       E+  V    L    ++ ++L +FK+    ++  A+        I+ P ++           +E++  + ++  R++  L DR++IG  I+E +  + +
Sbjct:   16 DSKYRAYAKAIDQALKTFETPNEWADLISALGKLAKVFQSNAKFCAIPNRVTVAKRLSQCLHPALPMGVHLKALETYRQIFEILGPNKLPECLYLFAVGLFPLMDHCGIKVKSELFTIFENYLVPLGANLRPALPGFLGGVLLALEEGTEFYERSFILLDRVCEKVGPRAFYACLWQAILGSPPVRLPAMIYVNAKFDKLKSLDDQIHLVGDHVNHMVAALCAVADDTGSPLVQRYLLDFLVAAFPLDSTNLTNEDFVQLLRRCLFVVLRRDMSLNRRLYTWL----INRSG------ETKGVSGLSLGG-PDDGIELTFFKERVLGLVHGALGEYLALDTIETPFANHQNSMWGDRKEAEQVQFAEVRVCRLLLYLQDRADIGRTILETVFADFL 400          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Fly
Match: CG15099 (gene:FBgn0034400 transcript:FBtr0086628)

HSP 1 Score: 312.383 bits (799), Expect = 9.453e-85
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 244.202 bits (622), Expect = 5.496e-64
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 6207 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7430
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 137.502 bits (345), Expect = 1.408e-31
Identity = 160/762 (21.00%), Postives = 327/762 (42.91%), Query Frame = 3
Query: 3771 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVS---ILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5951
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W              Q  +        A+  N    +EQF+   +L+         ++  ++++ R +   SF ++   ++ + PP      +  ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTW-------------QQRGI--------ATNMNGLSIAEQFQRNSVLQ---ACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLSIEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Fly
Match: CG15099 (gene:FBgn0034400 transcript:FBtr0330054)

HSP 1 Score: 311.997 bits (798), Expect = 1.107e-84
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 244.202 bits (622), Expect = 5.629e-64
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 6207 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7430
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 137.117 bits (344), Expect = 1.655e-31
Identity = 160/762 (21.00%), Postives = 327/762 (42.91%), Query Frame = 3
Query: 3771 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVS---ILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5951
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W              Q  +        A+  N    +EQF+   +L+         ++  ++++ R +   SF ++   ++ + PP      +  ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTW-------------QQRGI--------ATNMNGLSIAEQFQRNSVLQ---ACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLSIEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 363.999 bits (933), Expect = 1.725e-100
Identity = 233/591 (39.42%), Postives = 338/591 (57.19%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASER---ISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNI--RDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRI---CELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPS 1736
            E+ +   D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP+GVH KALE +++IF IIGP++LA DLF+Y +G+FPLLS +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  F+L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G +    N +K    S  +   +       E    YF  YS+++LI A+  I+        E    +  +KPFRI+ +L+D+ E+G  I+ED+L            +   L ++     +    N   +D T   S   +     E +KTANL F + +  + W+Y+ R F    +  +   TP Q  S + +   +   CELV F+L  + LP         ETY ++ + HLP LL  +   L  H+  LG+  +   L++   I  K+     Q   VS L  P   P  +S A  PS
Sbjct:    4 EELELLGDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNGKYQVVPKKLTIGKRLAQCLHPALPSGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLSNAAMSVKPVLLGLYETYYLPLGKTLKPGLQGLLTGVLPGLEEGSEYYDRTNTLLEKVAAAVEQPAFYSALWGSILTSPAVRLPGVTFVLLHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFD---NNGVKAGPRSTRLSNPE-------EHVTHYFNTYSKEMLILAMVGILQGKARGGEEESILMHDLKPFRILISLLDKPELGPAILEDVLIE----------VFRTLHTQCRAELDLQNQNPFSKDQTQLSSKLRENKKTAELIKTANLLFNSFEPYYMWDYIARWFEECCRWTQSSHTPGQTLSSETSARSLVEFCELVDFLLDIVSLPTRSMRVICQETYIEIQTEHLPQLLLRMVSALTTHLQALGLRELTHCLRLCSKILSKV-----QPPLVSPLTLP---PGPSSAATTPS 566          

HSP 2 Score: 257.684 bits (657), Expect = 5.890e-68
Identity = 136/327 (41.59%), Postives = 199/327 (60.86%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN---------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQE+L ESLRL  +P +  Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D    + +                     +  + LN+YLSACKLLD+   +  +S+PQF  Y+WAFV    +++          Q  F+P++
Sbjct: 2042 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNLMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQERLVESLRLPQVPILHAQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRTSGPSVAGLETTYSGGNGFSTSYNSQRWLNLYLSACKLLDLALALPSESLPQFQMYRWAFVPEASDDSGLEVRRQGTHQREFKPYV 2365          

HSP 3 Score: 82.0333 bits (201), Expect = 1.136e-14
Identity = 80/317 (25.24%), Postives = 133/317 (41.96%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y        S T  ++    +       WL  L+ + C   +FSI+++A+S ++DL+  T+ V           +    + +AS             S  +SP+           ++ G              +++ +  KT FF    L LW  L    PQ H+ +V L  +LH  APS SICE++I Q+++  +    L++H +F +LW L   L   + S FN   D S    L S+  +D                         +  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  725 CQLFLECSSFPVYIAEGNMKSSPTREEQAGDSIQP---AVWLQTLMDACCSDTDFSIQAVAVSLVMDLVGLTQSV-----------AMVTAERVASP----------DSSQPMSPSQGRVAVVIRPPLTPG--------------ILKYIAEKTDFFKNVALILWHQLGEETPQHHKRSVELFYQLHNLAPSPSICEDVISQQLMHRDRRIRLEAHVKFSVLWHLTRDLNITKSSPFNRSFDRSLFIMLDSLSYWDGSSS--------------------AVGRAWLNQVLQRHDIARVLEPLLLLLLHPKTHRVSI 983          

HSP 4 Score: 67.781 bits (164), Expect = 2.616e-10
Identity = 62/244 (25.41%), Postives = 105/244 (43.03%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY-QNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLD 4454
            IHPL+ H+LLY  +YDS+  L++LS +  + R+ P   V  +               N+      +  QN    +L+RH  ++ G +FY   P      SF+S   LEII+ +C +F+ S Y         + +D+  N  +Q+ + E+L  +  E+  +   G       F+                  +C V K  LHC+ ++I   +K        TN+ +       DS++ L+E  LD
Sbjct: 1357 IHPLYQHVLLYLQLYDSSRTLHALSAIAAMLRASPTGFVSAIST----------TSINNTYTPQLSLLQN----LLARHRISVMGKDFYCPIPQDSHSHSFRSAMFLEIIISLCLYFLRSYY---SAHVAATSQDLSGNHAMQLTSVEVLTLLFSELAKVTG-GSAKGFASFICD-------------VLSKCKVQKVVLHCLLSTIFSVQKWHEHRVRGTNVAAVEEGLSEDSVINLSEDQLD 1569          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 294.664 bits (753), Expect = 3.710e-86
Identity = 193/555 (34.77%), Postives = 313/555 (56.40%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQ--------LTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASER--ISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQ-----FPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  +AM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEGAE Y R + +L + +  V    FY  LW  +L  P VR   + F++ HF+  ++  +Q + LG    L++ ++   L D  VLVQR  L+ +L+       Q        L   +   + +A    LLRRDMSLNRR Y+W++G ++        +  +D+ H   +E     E    YF  +SR++L+ A+  I+      A+    I  ++PFRII +L+D+SEIG  ++ D+L   +V     Y I       A    N + T++  S +   +K   N   E +KT N+  + + S+F W+Y+ R F   L     P +       S   ++  +  L+ F+L  +P+E Y+++ +++LP +L ++   L  H+ +L +  +   ++    +  KI
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGHAAMSVKPVLLTLYERYFLPLQRALLPSLQAFIMGLLPGLEEGAEVYDRTDALLVKLSVLVGQSVFYGALWGSVLICPLVRLPASLFIVAHFDHSITAKEQKFMLGTDHRLVVKAVCLALQDSNVLVQRNTLEILLYFFPFTTFQDPGECAIPLKQDEMISVVSAASLTLLRRDMSLNRRLYAWMLGLDIKGG-----MGAADSSHYSTVE-----EYTAFYFNTHSRELLVQALVNILKQKDIEANPDNLIDYLRPFRIIISLLDKSEIGPLVLSDVLLE-VVRAFYSYCI-------AMLGDNGNNTSLTGSQLNSKIKENKN-SSEIIKTVNMLVSAMSSNFLWDYMTRHFQICLSSLRDPVEKSPSKSWSSPPSVTELSTLIIFLLDVIPLELYAEIQTQYLPQMLGNMLQSLQSHMTSLSLSELTQAMRACFKVLSKI 539          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 290.041 bits (741), Expect = 1.617e-78
Identity = 314/1218 (25.78%), Postives = 533/1218 (43.76%), Query Frame = 3
Query: 3777 LHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY---QNPTLE---------------EIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLE-IKNIFKVSFDRCNVAKYALHCMSTS------ITQPEKTTNILSDSI---MLLNESGLDQRVRDAAQV-NLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSD-GKSNNKNDFKLPLPSVYK----------NLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRF---IDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVL----QNLIDDLKCDIKSIK-QNDIN-------KRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSND-MNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            L  H+LLY   Y+S+ +LY+ + L TI R+  G   P +E L           S+++L  S   + N I  +L RH  A  G +FY   QN T                    S      LE++  +C  ++ S YP   +   V    +  N++VQ+ + E+L  ++ +++ + Q       GD  T+    LE ++N+         V +Y L  +S S      + +P++ T    D       ++E  L    RD     + +++ L  L     +   +V     K ++ D G+SN +   + P  ++ +          ++ +  Y +S P   ++ Q + +++    +       +H      +   L   G+S + ++ PI+ ++C+N+      +E  +  I  + +      N  P DY L+ L  L  + H+ LLD                            K  T+       G  + D RN    ++  F   I S+ +LW      +  +      P S        +RQ +L  + PL +Q    ++ S+A VW         +   S+    ++  L +AS S           + +++L + L    T T I+   R++++K  P  I  +    L       V + +L+F   ++ + ++  L      L  LL+ES+  +L P   F+LL IL+D ++++   D KR+ +E+Q++ Q++LE V  +AGSSLEQ SW  R  ++K                                           L G      A EF             E A + +T+     PS    ++QAL LL   LA ++D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++ +L  +  FF  +      W+ IID+L+T +K  FK+    L   Q   L LF S E    Q  M +K+ AF ++S E DQY   +P IQE+L+E+LR+G  P +  Q+FL FRVLL+RIS QHLTSLW I +  L  +     + L+DD +     ++  +D N         L+MYLSACK LD       D +P F  Y+WAF+  +D +      N  +  +   +P +  ++D   + Y      LN           E PL+  +S++S+ DL PFF T
Sbjct:  384 LFRHVLLYKQKYESSQILYAFTILETILRTSAG---PFVEAL-----------SSTSLDCSSIAHLNLIQNLLQRHRQAQDGGSFYGQLQNSTPPSGGTPDASQPASSPLHSPSCPPTLLLELLTSLCMRYLRSHYPSYAS---VPTRQLQANREVQVKSVEVLTELMIQLVRVAQ-----QNGD--TKGTAGLEAVRNLLW----GYKVQQYVLLTLSASMYVCQRVDRPDQHTLPEEDQGEDGGEISEESLINFGRDGTWAEHPLQIALLKLLKVLIVLEHHVCPPHTKPQEHDQGQSNPQRRAEPPSSALAREWQTAVMFQQSIKAVRYVSSQP---ITAQGMFVSAAARALHPQYGCAMHPAWVTLLCDVLPYLGRSLAIIVSPIIAQICRNLDELVKQHE--HDGIKGSHNGTLKRENIAP-DYPLTLLEGLTTITHYCLLDH---------------------------KKATA-------GCDVPDLRNASNAILEEFPHMISSMALLWGVVKGCDSTH-GSRATPTSVYFKSTKILRQKVLEFLMPLTQQFGVQVMASVAAVW---------NSRKSRKRRSRNKILPDASDSQ----------MTLVDLVKALNTLRTDT-ILQLIREVVKK--PHQIKGDQKSTL-------VDIPMLQFSYVYIQSLTAQALQENINPLLCLLRESVQLNLAPPGHFLLLGILNDCVNRLPNIDNKRDTKELQEVSQRILEAVGAVAGSSLEQTSWLSRNLEVKAQPQVC-------------------------------------LQGDEDDHDANEF------------EEYAGQGSTMVSSSAPS--VFSVQALVLLAEVLAPLLDMVYRSDEKEKAVPLISRLMY-YVFPYLKNHSAYNMPSFCAGAQLLSSLSGYAYTKRAWKKEVLELFMDPLFFTMESSCSYHWRSIIDHLLTHEKTMFKD----LMSMQSSSLKLFNSAE----QKPMLLKRQAFAMFSGENDQYHFYLPLIQERLTENLRVGQSPSVSAQMFLMFRVLLLRISPQHLTSLWPIMVTELIRIFNRLEKALLDDKEVTKSKLRGGHDKNGLLCFPQAELDMYLSACKFLDTAVSFPPDHMPLFQMYRWAFIPEVDVDHYDGPGNTLLEGEQECKPHIVRILDGINRRYGE----LNGTAAESSTDRVEFPLLTLRSLYSIVDLVPFFNT 1439          

HSP 2 Score: 61.6178 bits (148), Expect = 1.624e-8
Identity = 50/169 (29.59%), Postives = 78/169 (46.15%), Query Frame = 3
Query: 2442 VIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2948
            V++ L++ T F+      LW  L +   + H   V L  RLH  APSASICE++I   +L+ +   CL++  RF +LW L  + + S         S    R+FD+               N+    +R    +WL +A       +I+ P+LL LL P T R  + S+
Sbjct:   54 VLKTLEDSTDFYLRVSQVLWAQLDTERKEHHVSCVELFYRLHCLAPSASICEDIICLGLLSGDKVVCLEALHRFSVLWHLTREIQTS--------RSTSLNRSFDR------SLFVVLDSLNNQDGSVRAAAQNWLVRALSLSDVVRILEPVLLLLLDPKTQRSPIQSI 208          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 172.17 bits (435), Expect = 1.613e-48
Identity = 75/141 (53.19%), Postives = 110/141 (78.01%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  +AM +K  L  LYE+YF+ L  ++ P+ 
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGHAAMSVKPVLLTLYERYFLPLQRALLPSL 144          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 168.318 bits (425), Expect = 1.510e-44
Identity = 83/176 (47.16%), Postives = 122/176 (69.32%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQ 6713
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQ
Sbjct:  200 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNLMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQ 372          

HSP 2 Score: 81.6481 bits (200), Expect = 2.352e-15
Identity = 50/154 (32.47%), Postives = 88/154 (57.14%), Query Frame = 3
Query: 5484 ICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            + ++EL R +    T T +I T ++++++          PP +  EK+   ++V +L+F   ++   S + L      L  LLK+S+  SLP    F++L +L++FI K    + K++QRE+QD+  K++E +  IAGSSLEQ +W RR  ++K
Sbjct:   28 LLLVELVRSVSAMRTET-VIQTVKEVLKQ----------PPAIAKEKKHLSLEVCMLQFFYAYVQRISVSSLVDSWPSLLALLKDSVQLSLPAPGQFLILGVLNEFILKNPTLESKKDQRELQDVTHKIVEAIGTIAGSSLEQTTWLRRNLEVK 170          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 360.147 bits (923), Expect = 4.455e-99
Identity = 216/547 (39.49%), Postives = 330/547 (60.33%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + +E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 532          

HSP 2 Score: 251.906 bits (642), Expect = 4.077e-66
Identity = 133/327 (40.67%), Postives = 197/327 (60.24%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+D+LMT DK TF++  T++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 2006 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMDGSCVSHWRSIMDHLMTHDKTTFRDLMTRVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2329          

HSP 3 Score: 178.333 bits (451), Expect = 9.517e-44
Identity = 173/759 (22.79%), Postives = 336/759 (44.27%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++          PP +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1333 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1975          

HSP 4 Score: 92.4337 bits (228), Expect = 1.248e-17
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N              S+  + S  +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  735 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGEN--------------SSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 995          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 355.14 bits (910), Expect = 1.459e-97
Identity = 218/557 (39.14%), Postives = 331/557 (59.43%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 542          

HSP 2 Score: 251.906 bits (642), Expect = 3.924e-66
Identity = 133/327 (40.67%), Postives = 197/327 (60.24%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+D+LMT DK TF++  T++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 2016 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMDGSCVSHWRSIMDHLMTHDKTTFRDLMTRVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2339          

HSP 3 Score: 178.333 bits (451), Expect = 1.064e-43
Identity = 173/759 (22.79%), Postives = 336/759 (44.27%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++          PP +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1343 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1985          

HSP 4 Score: 92.4337 bits (228), Expect = 1.229e-17
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N              S+  + S  +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  745 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGEN--------------SSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1005          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 354.755 bits (909), Expect = 1.813e-97
Identity = 218/557 (39.14%), Postives = 331/557 (59.43%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEV-----TPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y+ R F +  ++ +     TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 542          

HSP 2 Score: 214.542 bits (545), Expect = 9.409e-55
Identity = 124/327 (37.92%), Postives = 184/327 (56.27%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD--IKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D        VI+   +            ++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D  I  I    +                    + LN+YLSACK LD+   +  +++PQF  Y+WAF+    ++           Q  F+P++
Sbjct: 1999 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMD-----GSCVIMPCFLA-----------RVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRISGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDAGLEVRRQGTHQREFKPYV 2306          

HSP 3 Score: 177.178 bits (448), Expect = 1.986e-43
Identity = 173/759 (22.79%), Postives = 336/759 (44.27%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW    ++  SEK          +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ ST    + S     + ++EL R +    T T +I T ++++++          PP +  +K+   ++V +L+F   ++     + L         LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1326 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLWSVLHQADSSEKNFTAASATVTTVNLGSTKNLRQQILELLGPISMNHGVYFMAAIAFVWNERRQ-------------------NKNSTRTKVIPSASDEQLLLVELVRSISVMRTET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSNLVDSWASFLVLLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1968          

HSP 4 Score: 92.0485 bits (227), Expect = 1.425e-17
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N              S+  + S  +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  745 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGEN--------------SSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1005          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 353.984 bits (907), Expect = 2.798e-97
Identity = 216/554 (38.99%), Postives = 328/554 (59.21%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL------------KQEVTPSQFPSF-QMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G          F      V  +     +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y++  F   L             +  TP    S  ++ +   C LV F+L  + +E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLG----------FDNNGTAVGPRSSRQSNPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYISFYFTSVLFSYLLNLRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 539          

HSP 2 Score: 127.487 bits (319), Expect = 2.269e-28
Identity = 72/176 (40.91%), Postives = 108/176 (61.36%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQ 6713
            TPS    ++ AL LL   LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D        VI+   +            ++ V Q   L LFT+++AE +Q AM +K+LAF I+SSE+DQY K +P+IQ
Sbjct: 1954 TPS--VYSVHALTLLAEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNASSYRACVQLLSSLSGYQYTRRTWKKEAFDLFMDPNFFQMD-----GSCVIMPCFL-----------ARVAVAQSSSLGLFTNRDAELEQRAMLLKRLAFAIFSSEIDQYQKFLPDIQ 2110          

HSP 3 Score: 108.997 bits (271), Expect = 1.079e-22
Identity = 111/506 (21.94%), Postives = 219/506 (43.28%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW 5195
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+      Y+    I       DS  +   + +P D  L+ L  +  + H+ LLD + + +QL      S +Q                        H+L+AR+ M+ ++   + S+ +LW
Sbjct: 1323 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNLDNLIQQYKYETGI------TDSRPLWMASFIPPDMILTVLEGITTIIHYCLLDPSAQYHQLM----VSVDQK-----------------------HLLEARSGMLSILHLIMSSVTLLW 1742          

HSP 4 Score: 92.0485 bits (227), Expect = 1.401e-17
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N              S+  + S  +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  742 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGEN--------------SSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1002          

HSP 5 Score: 65.0846 bits (157), Expect = 2.445e-9
Identity = 30/73 (41.10%), Postives = 51/73 (69.86%), Query Frame = 3
Query: 5724 LLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            LLK+SI  ++P    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K
Sbjct: 1851 LLKDSIQLNIPAPGQFLILGVLNEFIMKNPTLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK 1923          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Match: DOP1A (DOP1 leucine zipper like protein A [Source:HGNC Symbol;Acc:HGNC:21194])

HSP 1 Score: 348.977 bits (894), Expect = 1.772e-96
Identity = 217/564 (38.48%), Postives = 328/564 (58.16%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNP-TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL------------KQEVTPSQFPSF-QMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++PRK  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY  LW  +L +P+VR  G  ++L+H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+     S  S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +     +L  +A    +  P  +  S +RE+ ++      E +KTANL F + +  + W+Y++  F   L             +  TP    S  ++ +   C LV F+L  + LP         E Y ++ + HLP LL  +   L  H+  L +  ++  L++   I  K+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPRKITIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLTNAAMSVKPVLLSLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYDRTNTLLEKVASAVEQSAFYGALWGSLLTSPAVRLPGITYVLSHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALRVVLRRDMSLNRRLYAWLLGPRSSRQS-------------------NPEEHATHYFNTFSKELLVQAMVGILQGKEMSRESAPVQDLKPFRILISLLDKPELGPAILEDVLIEVFRTLYTQ--CKAELDLQAQTPFSKDPVQL-SSKLRENKRTA-----ELIKTANLLFNSFEPYYMWDYISFYFTSVLFSYLLNLRRTLHSRIQTPGGDSSKPELPLINFCLLVDFLLDIVSLPTRSMRVICQEAYIEIQTEHLPQLLLRMISALTSHLQALDLKELEDSLRLCSKILSKV 540          

HSP 2 Score: 97.8265 bits (242), Expect = 2.661e-19
Identity = 87/387 (22.48%), Postives = 174/387 (44.96%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNI 4847
            S H+ IHPL+ H+LLY  +YDS+  LY+L+ ++ I ++ P + V  +               ++      +  QN    +L+RH  ++ G +FY N  L+   +F+S   +EI++ +C +FM S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         NI++       DS++  +E   D       Q  L++++ +++ L++ + T                 +N+  F   +  +      + + S  Y  S P   ++ Q + L +++  +       +H      + S+L   GK    V++ +  +LC+N+
Sbjct: 1324 SPHFNIHPLYQHVLLYLQLYDSSRTLYALTAIKAILKTSPTVFVKAIST----------TNVSNAYTPQLSLLQN----LLARHRISVMGKDFYSNIPLDSNHNFRSSMYIEILISLCLYFMRSHYP---THVKVTQQDLMGNRNMQMMSIEILTLLFTELAKVIESSAKGFASFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSERMAEKNIMAIEEGFSEDSLINFSEDEFDN--GSTLQSQLLKVLQSLIILEHRVLTV--------------PEDNEAGFDFVITDLENINPQQPMTSLQYLHSQP---ITCQGMFLCAVIRALHQHYTCKMHPQWICLMTSTLPYMGKVLQKVVVSVTLQLCRNL 1657          

HSP 3 Score: 91.6633 bits (226), Expect = 1.822e-17
Identity = 82/321 (25.55%), Postives = 140/321 (43.61%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYF----NVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQL---LAKQEVSIFN---DNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y       SE + S+ N+            P WL  L+ +     +FSI+S+A+S ++DL+  T+ V         +  +N              S+  + S  +SPN    +      +++G+              +  +  KT FF    L+LW+ L    P+ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H RF +LW L   L   + S +    D S    L S+ + D C                      ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  743 CQLFLECSSFPVYIAEGSQASEIHASMANTD-----CEQVQPPLWLQTLMNACNMAQDFSIQSVAISLVMDLVGLTQSV-------AVVAGEN--------------SSSLEPSQPLSPNQGRVSVVIRPPLTEGN--------------LRYIAEKTDFFKHVALTLWEQLGDQTPKHHQRSVELFYQLHSLVPSSSICEDVISQQLTHKDKKIRMEAHGRFAVLWHLTRDLHINKTSSYGRTFDRSLFIMLDSLNSLDGCTS--------------------SVAQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1003          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 391.349 bits (1004), Expect = 9.076e-109
Identity = 313/1164 (26.89%), Postives = 551/1164 (47.34%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTTN---------ILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN----------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+  +    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       +      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D + I +                       +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1354 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDNG--STLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKMAVAASASVTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTPSRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTAD-EDISRTSGPSAAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2349          

HSP 2 Score: 354.369 bits (908), Expect = 1.887e-97
Identity = 218/563 (38.72%), Postives = 332/563 (58.97%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 91.2781 bits (225), Expect = 1.749e-17
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+                 + +  +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  750 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSM--------------EPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1009          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 391.349 bits (1004), Expect = 9.076e-109
Identity = 313/1164 (26.89%), Postives = 551/1164 (47.34%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTTN---------ILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQN----------------------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+  +    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       +      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D + I +                       +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1354 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDNG--STLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKMAVAASASVTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTPSRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNIVDSWTSLLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTAD-EDISRTSGPSAAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2349          

HSP 2 Score: 354.369 bits (908), Expect = 1.887e-97
Identity = 218/563 (38.72%), Postives = 332/563 (58.97%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 91.2781 bits (225), Expect = 1.749e-17
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+                 + +  +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  750 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSM--------------EPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1009          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 358.607 bits (919), Expect = 5.157e-106
Identity = 216/553 (39.06%), Postives = 331/553 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQFP-SFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      +V P     S ++ +   C LV F+L  + +ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 533          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Match: Dop1a (DOP1 leucine zipper like protein A [Source:MGI Symbol;Acc:MGI:1289294])

HSP 1 Score: 353.214 bits (905), Expect = 8.384e-98
Identity = 218/570 (38.25%), Postives = 327/570 (57.37%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ-------------EVTPSQFP-SFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G    R +                   +  E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  +Q             +V P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGPRSTRHS-------------------NPEEHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRQSFFLSRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 541          

HSP 2 Score: 91.2781 bits (225), Expect = 1.909e-17
Identity = 88/382 (23.04%), Postives = 175/382 (45.81%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTT---------NILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNI 4847
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+
Sbjct: 1352 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDN--GSTLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNL 1685          

HSP 3 Score: 90.8929 bits (224), Expect = 2.336e-17
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+                 + +  +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  748 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSM--------------EPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1007          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Match: Dop1b (DOP1 leucine zipper like protein B [Source:MGI Symbol;Acc:MGI:1917278])

HSP 1 Score: 320.087 bits (819), Expect = 4.325e-87
Identity = 305/1216 (25.08%), Postives = 532/1216 (43.75%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVS--FDRCNVAKYALHCMSTSITQPEKTTNILS----------DSIMLLNES----GLDQRVRDAA-QVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW----EKSSLSEKINLNQECIPPSWTMGRPDK-VRQMILSIIKPLMRQHPSIILISLARVW------PHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG-DERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIK------SIKQNDINKR----------------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            +  L  H+LLY   YDS  VLY+ S L  + ++ P   +  +                + +  S   + N I  +L+RH  AL G +FY     +          +E++  +C  F+ S YP      KV   DI  N+ VQ+ + E+L  I  +++++ +                  E KN   +     RC V ++ L  +S S+   +K   + +          DS  L  ES    G DQ   +   Q+ L++L+  ++ L++ L        G   ++++ +     +++  L +  + + +  Y    P   ++ Q +L++++V  +       +H      +  SL  +GKS    + P V ++CKN+      YES  + + +T    S + N  P DY L+ L  L  + HF LL++  +                             K  ++S   ++ +A+N +++ + R ++++ ++W    ++ +    ++L       S    +  K +RQ IL ++ PL       ++ ++A VW       H    ++   N SQ  L+  VC      ++S                           ++   ++++++  P  I  +    L       V + +L+F   F+   S   L      L G+LKE+   +L P   F+LL +L+DF+++    + K++Q+++Q++ Q++LE V  IAGSSLEQ SW  R  ++K       +E    ++++T                            G+   ST +            A   S Y                ++QAL+LL   LAS++D+ Y+S+EKEK  P ++ +++  V PYLR  S+ N  +FR  +QL++SLS Y +T+R+W+K++ +L  +  FFQ D  S   WK +ID+L+T +K  FK+     + +            + ++Q AM +K+ AF ++S ELDQY   +P IQE+L+++LR+G    +  Q+FL FRVLL+RIS QHLTSLW I +   + ++Q  I   +   +      S K N I                   L MYLSACK LD       D +P F  Y+WAFV  +D E   F S         RP    +++     Y  +G   +S E+  +    E PL+ + S+  +  L PFF T
Sbjct: 1101 VEALFKHILLYLQPYDSQRVLYAFSVLEAVLKTNPKEFIEAVSR--------------TGIDTSSTAHLNLISNLLARHQEALIGQSFYGKLQTQAPNVCPHSLLIELLTYLCLSFLRSYYP---CYLKVCHRDILGNRDVQVKSVEVLIRITAQLVSMAKSA----------------EGKNTEFIHSLLQRCKVQEFVLLSLSASMYTSQKRYGLATADRGGRLLAEDS--LFEESLINLGQDQIWSEHPLQIELLKLLQALIVLEHHL--------GQGQEEAETQPALSREWQRAL-NFQQAIGAMQYVQPHP---LTSQGLLVSAVVRGLQPAYGYGMHPAWVSLVTHSLPYFGKSLGWTVTPFVIQICKNLDDLVKQYES--ESVKFTISTTSKKENISP-DYPLTLLEGLTTISHFCLLEQPTQH---------------------------KKTAAVSDPINLRNAKNAILEELPRIVNTMALIWNVLRKEETQKRPVDLLGATKGSSSVYFKTTKTIRQKILDLLNPLTGHLGVQLIAAVATVWNRKQARRHSKTKMVPVANTSQHTLVDLVCALSTLQTDS---------------------------VLQLVKEVVKR--PAQIKGDEKSPL-------VDIPVLQFCYAFIQRLSIPDLQEAFPSLLGVLKEAAQLNLAPPGYFLLLSMLNDFVTRTPNLESKKDQKDLQEITQRILEAVGTIAGSSLEQTSWLSRNLEVKAQPQVSLEESDAEDDVHT----------------------------GAAEASTMVS-----------ASAPSVY----------------SVQALSLLAEVLASLLDMVYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNAPSFRAGAQLLSSLSGYAYTKRAWKKEVLELFLDPAFFQMDT-SCVHWKSVIDHLLTHEKTMFKDLMNMQSSS--------LKLFSSFEQKAMLLKRQAFAVFSGELDQYHLYLPLIQERLTDNLRVGQTSIVAGQMFLFFRVLLLRISPQHLTSLWPIMV---SELIQTFIQLEEDLKEEDESRNSHKSNRIKAPVADGNGSAGRVLSPSDLTMYLSACKFLDTALAFPPDKMPLFQIYRWAFVPEVDTEHPAFLSELEENHQECRPHTVRILELLRSRYGEIG---SSDEITRK---KEFPLLRQHSVSCIRQLIPFFTT 2129          

HSP 2 Score: 159.844 bits (403), Expect = 3.231e-38
Identity = 148/479 (30.90%), Postives = 231/479 (48.23%), Query Frame = 3
Query:  372 MHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRS--------QLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSA--SERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF---VKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTS 1766
            M ++  L  LYEKYF+ L   + P+    L GLLPGLEEG+E Y R + +L + +  V    FY  LW  +L +PS+R   + F++NH +R     +Q   LG    L + SL   L D  VLVQR  L+ +LF    +           L   D   + +A    LLRRDMSLNRR Y+WL+G+++ + N I    E  N ++              +F KYS+D+L+ A+  I+      A   ER  + +KPFRI+ +L+D+ EIG  ++E++   +I      Y     +     K +     N   STI+E+  +      E +KT NL  ++L S F W+Y+ R F    + + Q     +  S   T+  +C L+ F+L  +P+E YS+V +++LP +L  L   L E V  L +  +   L+    +  K+ Q      D+     P S  +S    R   +AM T  + +
Sbjct:    1 MSVRPVLLGLYEKYFLPLQKLLLPSLQAFLVGLLPGLEEGSEIYERTDALLLRLSVVVGREVFYAALWGSVLTSPSIRLPASLFVVNHISRDSPGKEQKCMLGTDYQLTVRSLCASLLDANVLVQRNNLEIILFFFPFYTCLDPEERAIPLLRRDVVHILSAATQTLLRRDMSLNRRLYAWLLGSDI-KGNTIVPKSEISNSYEDQCS---------YFFDKYSKDLLVEALAEILHQKFLDADLEERHHAYLKPFRILVSLLDKPEIGPQVVENLFLEVIRAF---YSYCHDVLGSDLKLSYTQSGNPLISTIKENRHAS-----EIVKTVNLLVSSLSSDFLWDYMARRFEACFRPVTQTTAIGEAISPPPTVSELCTLLVFLLDVIPLELYSEVQTQYLPQVLGCLLQPLAEEVEALSLPELTHALKTCFKVLSKV-QMPPSYLDL----EPSSGNSSPVKGRNSGIAMETEAVVA 456          

HSP 3 Score: 68.1662 bits (165), Expect = 2.137e-10
Identity = 78/347 (22.48%), Postives = 142/347 (40.92%), Query Frame = 3
Query: 1968 SVDLIVVEVY--HEICQ--------LVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCIS----------WLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2948
             VD +VVE+    E C+        L+++  ++P+Y +  E+ E +  +       ++   P WL  L+T  C +++ S+++IA++ LL++I        H      +    MK++  S         +      I+P                              +++ +  KT F+      LW+ L+    + H   V L  RLH  AP+A+ICE++I   +L  +    L++  RF ++W L  + + S    ++        R+FD+ +                 VVL +L  +          WL +A   G   +I+ P+LL LL+P T R S+  L
Sbjct:  611 GVDQVVVELVGSKEDCREALAAACHLLLDCATFPVYLS-EEETEQLCETLFQTPGASDCSFPPWLKSLMTICCCVSDCSLQNIAIATLLEVI-------NHSQSLALVIEDKMKRYKTSGNNPFFGKLQMVTVPPIAPG-----------------------------ILKVIAEKTDFYQRVARVLWNQLNKETREHHITCVELFYRLHCLAPTANICEDIICHALLDPDKGTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDRSL----------------FVVLDSLACTDGAISAAAQGWLVRALSLGDVARILEPMLLLLLQPKTQRTSIQCL 896          
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Match: sp|Q5JWR5|DOP1_HUMAN (Protein dopey-1 OS=Homo sapiens OX=9606 GN=DOP1A PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 7.638e-109
Identity = 312/1163 (26.83%), Postives = 555/1163 (47.72%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEK-------TTNILS-------DSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            S ++ IHPL+ H+LLY  +YDS+  LY+ S ++ I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI   +K         N+++       DS++  +E   D       Q  L++++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL            L ++  K               H+ +AR+ ++ ++   + S+ +LW    ++  SEK+ +       +  +G    +RQ IL ++ P+   H    + ++A VW    Q                   N+ +T    + +     + ++EL R +      T +I T ++++++          PP +  +K+   ++V +L+F   ++       L      L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF I+SSE+DQY K +P+IQE+L ESLRL  +P + +Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          +  ++             +  + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1357 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKAILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTAQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSAQKWHSEKMAGKNLVAVEEGFSEDSLINFSEDEFDNG--STLQSQLLKVLQRLIVLEHRVMT-------IPEENETGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWMASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL------------LVSVDQK---------------HLFEARSGILSILHMIMSSVTLLWSILHQADSSEKMTIAASASLTTINLGATKNLRQQILELLGPISMNHGVHFMAAIAFVWNERRQ-------------------NKTTTRTKVIPAASEEQLLLVELVRSISVMRAET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYIQRIPVPNLVDSWASLLILLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDG-----------------------------------------TNLESDVEDMLSPAMETANI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVNHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAIFSSEIDQYQKYLPDIQERLVESLRLPQVPTLHSQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDISRTSGPSVAGLETTYTGGNGFSTSYNSQRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2352          

HSP 2 Score: 348.206 bits (892), Expect = 8.591e-95
Identity = 214/558 (38.35%), Postives = 334/558 (59.86%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ------EVTPSQF-PSFQMTIDRICELVKFIL--IRLPI--------ETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L +LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +V+   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     +  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +      L +E   + +    +   S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  ++      ++ P     S ++ +   C LV F+L  + LP         ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPTLLSLYEIYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNMLLEKVAAAVDQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEENTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQCKAELDLQTEPPFSKDHAQLS---SKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYVARWFEECCRRTLHVRLQIGPGDSNDSSELQLTNFCLLVDFLLDIVSLPTRSMRVLCQETYIEIQTEHLPQLLLRMISALTSHLQTLHLSELTDSLRLCSKILSKV 543          

HSP 3 Score: 91.6633 bits (226), Expect = 9.590e-17
Identity = 84/311 (27.01%), Postives = 149/311 (47.91%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S   S++      +   PQWL  L+ +    ++FS++S+A+S ++DL+  T+ V         +  +N+             S E   +  +SPN           ++QG+              +  +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE++I Q++   + +  +++H +F +LW L     +   N +S+      +R+FD+ + ++LDSL+    S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  751 CQLFLECSSFPVYI-AEGNHTSELRSEKLETDCEHVQPPQWLQTLMNACSQASDFSVQSVAISLVMDLVGLTQSV-------AMVTGENIN------------SVE--PAQPLSPNQGRVAVVIRPPLTQGN--------------LRYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVISQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI---NKSSSF-----VRSFDRSLFIMLDSLNSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1011          
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Match: sp|Q8BL99|DOP1_MOUSE (Protein dopey-1 OS=Mus musculus OX=10090 GN=Dop1a PE=1 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 8.986e-98
Identity = 217/560 (38.75%), Postives = 331/560 (59.11%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIID-NPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRD-----STIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ-------------EVTPSQFP-SFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKI 1646
            E+ +  +D+K+RN+   +DK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP GVH KALE +++IF IIGP++LA DLF+Y +G+FPLL+ +AM +K  L  LYE Y++ LG +++P   GLL G+LPGLEEG+E+Y R N +LE+   +VE   FY+ LW  +L +P+VR  G  ++L H NR+LS +DQLY +G+ I LM+ +++  + D  VLVQR  LD +LF    H SQ T  D  ++ +A L V+LRRDMSLNRR Y+WL+G + + A     ++   +    + E     E    YF  +S+++L+ A+  I+  N     S  +  +KPFRI+ +L+D+ E+G  I+ED+L  +   L  +         +A       P   +D     S +RE+ K+      E +KTANL F + +  + W+Y+ R F +  +Q             +V P     S ++ +   C LV F+L  + +ETY ++ + HLP LL  +   L  H+  L +  +   L++   I  K+
Sbjct:    4 EELELLSDSKYRNYVAAIDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPGGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLANAAMSVKPALLGLYEMYYLPLGKTLKPGLQGLLTGILPGLEEGSEYYERTNTLLEKVAAAVEQSAFYSALWGSLLTSPAVRLPGITYVLAHLNRKLSMEDQLYIIGSDIELMVEAVSTSVQDSSVLVQRSTLDLILFCFPFHMSQATRPDMIRILSAALHVVLRRDMSLNRRLYAWLLGFDNNGA-----IIGPRSTRHSNPE-----EHATYYFTTFSKELLVQAMVGILQVNGFGEESTLMQDLKPFRILISLLDKPELGPVILEDVLIEVFRTLYSQ--------CKAELDLQMEPPFSKDHAQLSSKLRENKKTA-----ELIKTANLLFNSFEPYYMWDYIARWFEECCRQSFFLSRRTLHARLQVGPGDSSDSSELQLTNFCLLVDFLLDIVSLETYIEIQTEHLPQLLLRMISALTSHLQTLRLSELTDSLRLCSKILSKV 540          

HSP 2 Score: 245.743 bits (626), Expect = 1.811e-63
Identity = 161/464 (34.70%), Postives = 246/464 (53.02%), Query Frame = 3
Query: 5715 LFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            L  LLK+SI  SLP    F++L +L++FI K    + K++QR++QD+  K+++ +  IAGSSLEQ +W RR  ++K           S +I  DG                                          +L +  ++  +  M T NI  TPS    ++ AL LL+  LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ I+DNLMT DK TF++  T++ V Q   LNLF +++ E +Q AM +K+LAF + SSE DQY K +P+IQE+L ESLRL   PQ+  Q+FL        +  Q LT+   I      S           +  S   N   + LN+YLSACK LD+   +  +++PQF  Y+WAF+    +++          Q  F+P++
Sbjct: 1876 LLVLLKDSIQLSLPAPGQFLILGVLNEFIMKNPSLENKKDQRDLQDVTHKIVDAIGAIAGSSLEQTTWLRRNLEVK----------PSPKIMVDGT-----------------------------------------NLESDVEDMLSPAMETSNI--TPS--VYSVHALTLLSEVLAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACVQLLSSLSGYQYTRRAWKKEAFDLFMDPSFFQMDASCVSHWRAIMDNLMTHDKTTFRDLMTRVAVAQSSSLNLFANRDVELEQRAMLLKRLAFAVLSSESDQYQKYLPDIQERLVESLRL---PQV--QVFL--------LMEQELTADEDISRTSGPSAAGLETTYTGGNGFSTSYNS-QRWLNLYLSACKFLDLALALPSENLPQFQMYRWAFIPEASDDSGLEVRRQGIHQREFKPYV 2269          

HSP 3 Score: 102.064 bits (253), Expect = 8.006e-20
Identity = 116/513 (22.61%), Postives = 228/513 (44.44%), Query Frame = 3
Query: 3753 SNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQI---GYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI-----TQPEKTT---------NILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEI---NTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILW---EKSSLSEKI 5222
            S ++ IHPL+ H+LLY  +YDS+  LY+ S +++I ++ P          I+  +   +   N+      +  QN    +L+RH  ++ G +FY +  ++   +F+S   +EI++ +C ++M S YP   T  KV+ +D+  N+ +Q+++ EIL  +  E+  +++    G+ +   D ++                 +C V K  LHC+ +SI        EKT              DS++  +E  LD       Q  L+R++  ++ L++ + T       I  ++  G     +D +   P  ++ + S  Y  + P   ++ Q + L +++  +       +H      I S+L   GK    V++ +  +LC+N+    NL +   Q    T   DS  +   + +P D  L+ L  + A+ H+ LLD   + +QL               L N  +             H+++AR+ ++ ++   + S+ +LW    ++  SEK+
Sbjct: 1352 SPNFNIHPLYQHVLLYLQLYDSSRTLYAFSAIKSILKTNP----------IAFVNAISTTSVNNAYTPQLSLLQN----LLARHRISVMGKDFYSHIPVDSNHNFRSSMYIEILISLCLYYMRSHYP---THVKVTTQDLIGNRNMQMMSIEILTLLFTELAKVIESSAKGFPSFISDMLS-----------------KCKVQKVILHCLLSSIFSVQKWHSEKTAGKSMVAVEEGFSEDSLINFSEDELDN--GSTLQSQLLRVLQRLIVLEHHVMT-------IPEENEAGFDFVVSDLEHISP--HQPMTSLQYLHAQP---ITCQGMFLCAVIRALHQHCACKMHPQWIGLITSTLPYMGKVLQRVVVSVTLQLCRNLD---NLIQ---QYKYETGLSDSRPLWVASIIPPDMILTLLEGITAIIHYCLLDPTTQYHQL---------------LVNVDQK------------HLVEARSGILSILHMIMSSVTLLWSILHQADASEKM 1783          

HSP 4 Score: 91.2781 bits (225), Expect = 1.207e-16
Identity = 81/311 (26.05%), Postives = 146/311 (46.95%), Query Frame = 3
Query: 2007 CQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            CQL +E +S+P+Y      + S ++S++      +   PQWL  L+++     +F ++S A+S ++DL+  T+ V         +  +N+                 + +  +SPN           ++QG+              ++ +  KT+FF    L+LWD L    PQ HQ +V L  +LH   PS+SICE+++ Q++   + +  +++H +F +LW L     +       N SS    R+FD+ + ++LDSL     S        ++  +WL +  Q     +++ PLLL LL P T R+S+
Sbjct:  748 CQLFLECSSFPVYI-AEGNHTSESHSEKPDTDCEHAHPPQWLRTLMSACSQARDFRVQSAAVSLVMDLVGLTQSV-------AMVTGENINSM--------------EPAQPLSPNQGRVAVVIRPPLTQGN--------------LKYIAEKTEFFKHVALTLWDQLGDGTPQHHQKSVELFYQLHNLVPSSSICEDVVSQQLTHKDKKIRMEAHAKFAVLWHLTRDLHI-------NKSSFA--RSFDRSLFIMLDSLTSLDGST------SSVGQAWLNQVLQRHDIARVLEPLLLLLLHPKTQRVSV 1007          
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Match: sp|Q642P2|DOP2_XENLA (Protein dopey-2 OS=Xenopus laevis OX=8355 GN=dop1b PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 5.892e-87
Identity = 312/1206 (25.87%), Postives = 541/1206 (44.86%), Query Frame = 3
Query: 3765 LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMR--------LVLNVLKLDYGLNTSYVLSNGIKL--KDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECI-----PPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQ-VKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTG--DERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDI-----KSIKQNDINKRLN-------------MYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDM-NFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYEN---LYNEKPLIYRQSIHSLTDLAPFFFT 7259
            +I  L  H+LLY   YDS  VLY+ + L  I ++ P   +               + + +++  S   + N I  +L+RH  AL G +FY     +          +E++  +C  F+ S YP      KVS +D+  N+ VQ+ + E+L  I+ +++ I +           +    K+E     +   +RC V ++ L  +S S+   +K   ++S         G+D    +   +N  +        L + +LKL   L    VL + ++    D D   +   +++  + +  +++ +  Y  +    +++ Q + ++++V  +       +H      + SSL  +GKS    + P V ++CKN+      YE+ +  I  T    S   N  P DY L+ L  L  + HF LLD     +  Q +K SSS+ + L                        +ARN +++ + R I+++ +LW   S  E+     + +       S        ++Q IL  + PL       ++ ++A VW    +F   + + S++ ++              + SE   +   L  A    K+ TI H++   +++++K          PP++   E+   V + +L+F   F+   S ++L   S  L  LLKES+  +L P   F+LL +L+DF+++    + K++Q+E+Q++ QK+LE V  +AGSSLEQ SW  R  ++K        D      ++N D V+A                        S   ++A                 S Y +  +++        L     NLL M         Y+S+EKEK  P ++ +++  V PYLR  S+ N+ +FR  +QL++SLS Y +T+R+W+K++ DL  +  FFQ D  S   WK IID+ +T +K  FK+  +  + +            +  +Q AM +K+  F + S E+DQY + +P IQE+L+E++R+G  P +  Q++L FRVLL+RIS QHLTSLW I +  L      L +DL  ++     K+ K       +N             +YLSACK LD    +  D +P F  Y+WAFV  +D E     S  + N+Q   +P +  +++  +++           E   E+      E PL+   SI S+T L PFF T
Sbjct: 1194 MIEALFKHILLYLQPYDSKRVLYAFTVLEAILKTNPKEFI--------------ESVAATSMDTSSTAHLNLIYNLLARHQEALVGQSFYGKLQTQSPLMCPHSLLIELLTYLCLSFLRSYYP---CYLKVSHKDVLGNRDVQVKSVEVLIRIMSQLVNIAK-----------SAEGKKVEF---IRFLLERCKVQEFVLLSLSASMYTSQKKYELMSAG----GNRGIDLGFFEEGIINFGQDQIWSEHPLQIELLKL---LQVLIVLEHHLRQLQDDQDTHGDLTKEWQRGI-NFQQSINAMQYVQAH---SITSQGLFVSAVVKALRPDYGYGMHPQWVALVTSSLPFFGKSLGLTVAPFVVQICKNLDELVKQYENESFKISTT----SKRENVSP-DYPLTLLEGLTMIGHFCLLD-----HPTQSKKSSSSDPANLK-----------------------NARNALLEELPRIINTMSLLWSIISKQEREKRPSDLLGTIKASSSVYFKSTKTLKQKILDFLNPLTSHLGVQLIAAVAAVWKK-KRF---NKSLSKAKILP-------------VPSESQLIFVDLVCALKTLKTDTILHLV---KEVVKK----------PPQIKGDEKSSLVDIPMLQFSYTFIQRLSGSELQENSQSLLALLKESVPLNLAPPGFFLLLSMLNDFVTRTPNLESKKDQKELQEVTQKILEAVGNVAGSSLEQTSWLSRNLEVKAQPQISLDDAEAEEEDLNDDSVVA----------------------QSSMVSASA----------------PSMYSVQALSL--------LAEVLANLLDM--------VYRSDEKEKAVPLISRLLY-YVFPYLRNHSAYNIPSFRAGAQLLSSLSGYAYTKRAWKKEVLDLYMDPGFFQMD-TSCVHWKAIIDHFLTHEKTMFKDLMSMPSSS--------LKLYSSSEQKAMLLKRQGFAVLSGEVDQYHQYLPLIQERLTENIRMGQTPNMAAQMYLFFRVLLLRISPQHLTSLWPIMVTELIHTFVQLQEDLMDEVPTKSSKASKHKTATAEVNGTVYCEIQQSALELYLSACKFLDTALSIPPDKMPLFQLYRWAFVPEVDTEACSVPSEKVENYQEC-KPHVLRILE-LLRFRFG--------EKTTEDPKWKRTEFPLLNLHSICSVTQLTPFFRT 2220          

HSP 2 Score: 300.442 bits (768), Expect = 3.103e-80
Identity = 185/526 (35.17%), Postives = 306/526 (58.17%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLF-------------ALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWII-DNPTSSASER--ISSIKPFRIITTLMDRSEIG----GDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKAL--KQEVTPS-QFPSFQMTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+Q+   D ++RN+++ ++K L+ FE SSEWADLI++LGKL K LQ N+++ ++PR+ ++ KRL+QCLHPALP+GVH+KALE +++IF IIG + LA DLF+Y +G+FPLLS +AM ++  L  LYE YF+ L  ++ P+    + GLLPGLEEG+E Y R +++L++ +  V    FY  LW  +L + S+R   + F+++H N+ LS   Q Y LG    L + SL   + D  VLVQR  L+ +LF             ++ +HR     SD  ++ A  +  +LRRDMSLNRR ++WL+G+++   ++   + +S            + E    +F +YS+D+L+ A+  I+  N  +S +E+  +  +KPFRI+ +L+D+ EIG    G++  +++   I Y         +L+   N            + +  ++K   N   E +KT NL  ++L S F W+Y+   F  +   K   TP+  +     +I  +C L+ F+L  +P+E YS+V +++
Sbjct:    3 VEEQELLGDYRYRNYSSVIEKALRNFESSSEWADLISSLGKLNKALQTNLKYCLLPRRIIISKRLAQCLHPALPSGVHLKALETYEIIFKIIGTKCLAKDLFLYSSGLFPLLSHAAMSVRPILLGLYETYFIPLQRALLPSLQAFITGLLPGLEEGSEIYERTDQLLQRLSVVVGQNVFYGSLWGSVLVSSSIRLPASLFVVSHINKDLSAQSQSYMLGKDQELAIKSLCASVVDSNVLVQRNTLEILLFFFPFNTCLVPDECSMLLHR-----SDMVRILAGSIQTVLRRDMSLNRRLFAWLLGSDIKGRHMAPELKDSSG----------DEEYCNHFFARYSKDLLVEALMQILHQNTLASDTEQGLLVYLKPFRILVSLLDKPEIGPPVVGELFLEVMRAFIAYCRDALGTQMQLSYSQN-----------GAQLISAIKENKN-ASEIVKTVNLLISSLSSDFLWDYMTICFEDSFRRKDHDTPAGNYLGRAPSITEVCSLLVFLLDVIPLELYSEVQTQY 501          

HSP 3 Score: 65.855 bits (159), Expect = 6.709e-9
Identity = 71/317 (22.40%), Postives = 130/317 (41.01%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
            E     C ++++  ++P+Y +  E+ E + +    +   ++   P W   L+   C + +  I+++A+S LL++I        + +Q +S+   +  K   + G    F      +  I P            VS G              V++ + +KT F+      LW+ L+    + H   V L  RLH  APSA+ICEE+I Q +L ++    L++  RF ++W L  + + S    ++        R+FD+               N     +      WL +A       +I+  + L LL P T R S+
Sbjct:  735 EALAAACHVLLDCATFPVYMS-EEETEHLYSVLSQVPGSSDVSFPLWFKTLMMVCCCVKDCYIQNVAISTLLEVI--------NHSQSLSLVLADRMKRSKTPGFGEVFGKLQMVT--IPP------------VSPG--------------VLKLIADKTDFYPRVAHVLWNQLNIETREHHITCVELFYRLHCLAPSANICEEIICQTLLHNDKLTRLEALFRFSVIWHLTREIQGSRVTSHN--------RSFDR------SLFVVLDSLNCSDGAIGAAAQGWLVRALSLNDVARILEAVFLLLLHPKTQRNSI 1000          
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Match: sp|A1ZBE8|DOP1_DROME (Protein dopey-1 homolog OS=Drosophila melanogaster OX=7227 GN=CG15099 PE=1 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 9.476e-84
Identity = 188/514 (36.58%), Postives = 289/514 (56.23%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALK-----QEVTPSQFPSFQMTID---------RICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+R +   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH   L+  D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     LE   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F KA +     QE + +   S +   D          IC L +F+L  + +E Y++ 
Sbjct:    7 LVEEQKLMAEAKYRTYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYIMGHNREIMMSALCVCLNDSLILVQRNTLEFLLLGFPMHTVLLSEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDTSNAPLEEEPEP-----YFVKHSRHILIKALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNA--------------------------EALKSANLLFATFDPAYIWSYMTNMFEKACQQANSMQEKSQAGETSGKYACDVGSGDPCVLEICVLTEFLLETVSLEMYTET 475          

HSP 2 Score: 244.202 bits (622), Expect = 5.509e-63
Identity = 153/444 (34.46%), Postives = 242/444 (54.50%), Query Frame = 3
Query: 6207 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRP------FLTLVIDSYIQYYLSLG----IPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPI 7430
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  +  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS++ EY+Q AM +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N  N +  M       L ACKLL++  ++    +P F  Y+WAFVG     T +    D++ + V  P        TL    Y+ +   +     +   S   + +   N   +++ Q + SL +L  FF               T  GI+    ++  AD  N+      N   E+E +L N+F+E +
Sbjct: 2179 SLQAQSVLAAILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNAFFQMHLSCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSRDQEYEQRAMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERNQQLRLPSGIDVSWSAASGASNGYNSQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVG-----TEF----DVHEEEVCLPNGSLENLATLPSALYVPHVRRVARLMDMKYTSQSPILQRPSNRHLMLHFQQLQSLQELYAFF---------------TTLGISCPQPRNF-ADTENDVA----NCLKEIEEVLANDFLEKL 2592          

HSP 3 Score: 137.502 bits (345), Expect = 1.412e-30
Identity = 160/762 (21.00%), Postives = 327/762 (42.91%), Query Frame = 3
Query: 3771 HPLHSHMLLYCSIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSIT----QPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSY------QLQEEKGSSSEQSFLGALFN--------KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVS---ILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5951
            H  H+H+L+Y +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G  N+  D +                  R  + K  LHC+++S+     +    +   ++ ++  N+   DQ   D  Q+ L+RL+L V++L++ ++     +     +DS G ++       P         +  Y    P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   + +       +P  +          P DY +S L  L  +CH+ LLD   ++       Q   +  SS++ S  G L N         S+ +TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ +L  + P+   H S  L ++A  W              Q  +        A+  N    +EQF+   +L+         ++  ++++ R +   SF ++   ++ + PP      +  ++V+ LE    ++ +  + +L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1511 HLYHNHLLIYLAIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQKESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLANYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGLKGNTNSGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLAVIRLEHEVHQLRQDTPPAAGEDSAGNAS-------PTRLAEGATANVKYL---PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFSFGSLTNIVISVVHQLCSNLDRISKMG------LPQQRH--------FPPDYVVSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTGQLLNSIVHSFLSASESSTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLLEFLSPVSLHHGSNFLAAVAVTW-------------QQRGI--------ATNMNGLSIAEQFQRNSVLQ---ACPAQLSLVSLVSSIRVMPMDSFVMTLHHVVRSPPPIHRPPAQLSIEVSALELFYFYMKSAPAPQLADAWSSLLALIRDGLNLTPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSSVAGSCLEQTTWLRRNLAVKEDTD 2162          
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Match: sp|Q292H2|DOP1_DROPS (Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA13490 PE=3 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 1.424e-82
Identity = 186/519 (35.84%), Postives = 289/519 (55.68%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQ--------EVTP-----------SQFPSFQMTIDRICELVKFILIRLPIETYSDV 1520
            ++E+Q    + K+RN+   +DK L+ FEYSSEWADLI+ LGKL K + +N ++ +IPR+  + KRL+QC+HPALP+GVH+KALE + VIFS  GP +LA + FIY  G+FPLL  +AM+++  L  +YE YFV LG  +RPA  G L G+LPG + G + + R + +L+Q   +V P++FYT LW+ +    ++R     +LL HFN+RL   +Q+Y +G++  +M+++L   LND  +LVQR  L+F+L    MH + L   D  KL    L  +LRRDMSLNRR +SWL+G+ + + N   +   S +     L+   E      YF K+SR ILI A+   +      A      +KP+RI+ +L+D++EIG  +++ +L ++I    +  +I     S  N                           E LK+ANL FA  D ++ W+Y+  +F +A  Q        ++ P            +  S    +  IC L +F+L  + +E Y++ 
Sbjct:    7 LMEEQKLMAEAKYRNYMTNIDKALRNFEYSSEWADLISALGKLSKAISSNTQYQVIPRRLKIAKRLAQCMHPALPSGVHLKALETYSVIFSKTGPERLATE-FIYSAGLFPLLGYAAMNVRPALLAIYETYFVPLGDKLRPALSGFLNGVLPGYDCGLDHFERISALLKQVCNAVNPMHFYTVLWESVANNAAIRLPAITYLLEHFNKRLDMQEQIYVMGHNREIMMSALCACLNDSLILVQRNTLEFLLLGFPMHTALLAEDDLVKLVTNGLNTILRRDMSLNRRLFSWLLGSEVAK-NSPTYDTLSLDASATPLDEPPEP-----YFVKHSRHILIRALITTLRLSLECAP---MDLKPYRIMLSLLDKAEIGSAVLDYVLHDII----RAMYI-----SSGNP--------------------------EALKSANLLFATFDPAYIWSYMTNMFERACHQANSSDKQDKLLPQASAEGGDKFACEVGSGDPCVLEICVLTEFLLETVSLEMYTET 480          

HSP 2 Score: 243.047 bits (619), Expect = 1.248e-62
Identity = 126/302 (41.72%), Postives = 190/302 (62.91%), Query Frame = 3
Query: 6207 TLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRL-GMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ-------------------NDINKRLNM------YLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN 7034
            +LQA ++L   L++++DV Y S+EK+KV   +T +++ N+ PYL+  ++ N+  F   S L+ASLS YQ+TR++WRKD+ DLL ++ FFQ  I  L  W++I+D+LMT D  TF+E  T+++++Q G LN+FTS+E E++Q  M +K+LAF+IY SE DQ+ K MP+IQE+L+ SLRL  M P ++  +FLCFRVLL+R+S  H+TSLW I I  +  V   +  +LK + +   Q                   N IN +  M       L ACKLL++  ++    +P F  Y+WAFVG 
Sbjct: 2209 SLQAQSVLATILSNLLDVAYGSQEKDKVVNIVTPLLY-NITPYLKNHTARNVPFFYACSALLASLSGYQYTRKAWRKDMLDLLLDNSFFQMHISCLPFWRMIMDSLMTYDNTTFRELMTRVSLSQAGSLNIFTSREQEFEQRGMLLKRLAFVIYCSEFDQHNKYMPDIQEQLANSLRLVPMGPSVQAAVFLCFRVLLLRMSPDHVTSLWPIIIAEMVQVFLQMEQELKSESEERSQQMRLPSSIDVSWSNNSGASNGINAQTPMQHWRSVQLEACKLLELGCVLPATKLPHFQMYRWAFVGT 2509          

HSP 3 Score: 124.79 bits (312), Expect = 9.789e-27
Identity = 159/753 (21.12%), Postives = 313/753 (41.57%), Query Frame = 3
Query: 3804 SIYDSNGVLYSLSKLRTIF----RSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQN-PTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFK---VSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQ--PEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWG-KSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE----AL-----KSYQLQEEKG---------SSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSI--LANSPPKLTEKEEG-QVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSIS--DEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSD 5951
            +IYD+   LY+L  LR I     R+   + +                        + +F    + ++L RH  ++ G  F  +    E  Q ++    LE+++ +C ++    +       +    + +DI  N+++Q+ + E+L  I  E++ I++    G   +  D +                  R  + K  LHC+++S+        T   ++ ++  N+   DQ   D  Q+ L+RL+L+V++L++ +   + L         D  + N +  +L   +     +        P   +S+Q + L +++  +   +LRHLH      + SSL  +   S + +++ +V +LC N+   A L                 +    P DY LS L  L  +CH+ LLD     AL     ++Y                +S   SFL A  N+S   TS     +P   +  ARN ++  + R + S+  +W+                    +G+   VRQ ++  + P+   H    L ++A  W                   Q    + AS  +    S+QF+    L+   G     ++  ++++ R +   SF +++  +  SPP +        ++V+ LE    ++ +   T+L+     L  L+++ ++  PP A F LL +L++F+ +       +K+E RE+ D+  +++++++ +AGS LEQ +W RR   +K D+D
Sbjct: 1549 AIYDTRQTLYALQTLRNIICCDKRTFLCLSI------------------------TTSFSSASLKQLLVRHRKSISGKGFDGSVGNSEYAQGYRGCMQLELLVTLCLFYARGYFQRESLDAQRQSPTLQDIVNNRRIQLESIELLTLICSELIEIVKGMGRGLACYIADLLA-----------------RAKLQKVMLHCLNSSVCSYGRRAPTGSYAEQVLSFNDPQDDQLHADCFQLQLLRLLLSVIRLEHEV---HQLRQDTPPAAGDDSTGNTSPTRLAEGAAANVKYL-------PNCLISQQPMFLAAVLGALQQERLRHLHRNWTDLVTSSLNCFTFGSLTNIVISVVHQLCNNLDRMARL--------------GLQQQRHFPPDYVLSQLEALTILCHYCLLDNTQQTALSHLFNQAYPQTSSSAQSSSTSQLLNSFVHSFLSA--NESSTGTSAPAPRNP--QLQAARNAVLSHLPRIMSSVAAIWDSE------------------LGQLRPVRQQLMEFLSPVSLHHGCNFLAAVAVTW-------------------QQRGSSNASNGSGLSISDQFQRNSTLQACPG---QLSLVSLVSSIRVMPMDSFVMTLHQVVRSPPPIHRPPAHLSIEVSALELFYFYMKSAPGTQLADAWSSLLALIRDGLNLSPP-AQFALLMLLNEFVQRCPQMPFQDKKEVRELHDVTSRLVDSLSGVAGSCLEQTTWLRRNLAVKEDTD 2191          
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Match: A0A2C9KC14 (Dopey_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052647 PE=4 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 4.091e-142
Identity = 375/1222 (30.69%), Postives = 605/1222 (49.51%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI---------TQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE---------ALKSYQLQEEKGSSSE-QSFLGALFN---KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTE--KEEGQVKVNLLEFLQCFLITGSSTKLSLISG--CLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNL-------IDDLKCDIKSIKQ---------NDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-------LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            IH LH HMLLY   +D +  LY+L+ LRT+  + P +VV  +                +++   +A +  K+  +L RH  ++ G NF+ +   E + S++S   +EI++ +C +F+   YP      K+S E++  NK V IL  EIL  +V E+L+I++     ++++  D ++                 RC + K  LHC+  S+         +  +  +  L++ I+  NESGLD  V DA Q+ L++LVL           + +L + I+L      S      +  L S   +L + HY  S P I   +Q + L+++ + +    L HLH +    + S+L   G++ +  +M +V +LC+N+           +II        + +  +P D+ +S L  L  +CH+ LLD          A  S  +  E  S+ +  + L  +FN     K+ +   DS  P   +LDAR +++ ++ R +  +  LW+  ++  + N+     P   T+G    VRQ IL ++ P+   H + +L + A  W               +D  Q    N+ S +   +  +Q   + ++EL   +K    +  +I T + +I++           P LTE  K+   ++VNLL+F   + +  ++T   L+     L  LL+E +  +L P A F+LL+IL +F+ K    +EK+ Q+++QD+CQK LE+++ IAGSSLEQ +W RR   +K         PG                                     FG   +E     + +  + +  SA K A I  R   S    ++QAL L+    A I+DV Y SEEK+KV PFLT++++ NV PYLR+ SS N+ +++  SQ+++S+S YQ+TRR+WRK+ F+LL E+ FFQ D  S+  W VIIDNLMT DK TFK+   ++++ Q G LNLF+SKE EY+Q    +K+LAF ++ SE DQY ++MP+IQE+L+E LRL  +  + + +FLCFRVL++R+S QHLTSLW   I  L  VL  +        D+ K  I+ I           N +N       L +YLS CKLLD+  +M  D VPQF  Y+WAFVG        +DE+ + +R N     P+F P + + +   +   +     L   E         +PL+    + SL DL  FF+T
Sbjct: 1405 IHELHMHMLLYTQQFDYHRTLYALTTLRTMLHNCPRLVVTAMAT--------------TSISSVRAPHLAKLQSLLGRHRKSVFGKNFFGDLPQEVVSSYRSNMLVEIVISLCLYFVRGYYPNLMVN-KLSHEELLGNKMVHILGVEILTLMVSELLSIMKESGKNFVSYISDLLS-----------------RCKLQKSLLHCLLASVYNQGLGPTSSGGKSESRKLTELIIEFNESGLDPSVNDAFQMKLLQLVL----------VTVMLEDQIRLVQGTADSQTGPTERAHLTS---SLLNVHYNASLPII---QQEMFLSAVWSALKQHHLCHLHRHWVGLVTSALPYMGRAMARTVMCVVLQLCRNL-----------EIIALDLSKKKSTMQRVPPDHVVSMLEGLTTLCHYCLLDNTSPVSIGQPAPTSTNISTETASAGQILTNLIHVFNPVTSGKEPSPARDS-PPVAPVLDARTRLLGILPRIMACMATLWKAVAIVNEDNVYITSHP---TVGEFKAVRQHILELLSPISLPHGTNLLAAFAVAW---------------NDRRQTPKKNQVSPT---ICEDQ---LLLVELVSAIK-VLPMDTLIQTVKQVIKQ-----------PPLTELTKKGVPLEVNLLQFFFAY-VRNTTTIAQLLDSWPSLLSLLRECLQMNLTPPALFLLLQILHEFVQKTPTMEEKKNQKDLQDICQKALESISAIAGSSLEQTTWLRRNFAVK---------PGPQ----------------------------------NFGEEDLETHEDAD-MSEVKKEASAVK-APIR-RSQASDSKYSVQALGLMAELTAPILDVIYSSEEKDKVAPFLTTLLY-NVFPYLRHHSSHNVPSYKACSQMLSSISGYQYTRRAWRKEAFELLMETSFFQMDAKSISYWHVIIDNLMTHDKTTFKDLMGRVSITQTGSLNLFSSKEQEYEQRTQMIKRLAFTLFCSETDQYQRAMPDIQERLAEGLRLPSVANVMSSVFLCFRVLILRMSPQHLTSLWPTIITELVQVLLQIEQELSTETDEFKTQIQRIAALDSSWAHLGNGLNAHNNPAWLQLYLSVCKLLDMCIVMPADQVPQFQLYRWAFVGTAGEDEYPMDEDCDGWRPN-----PLFTPHI-IRLSRLLNNRMKKKPTLMKTE-------PGRPLLTMPKLQSLADLQSFFYT 2469          

HSP 2 Score: 381.333 bits (978), Expect = 2.021e-102
Identity = 223/516 (43.22%), Postives = 324/516 (62.79%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSE-NELQLRYFKKYSRDILIAAIKWIIDNPT-----SSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQ-------MTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+ +   D+K+R++  QV+K L+ FEY+SEWADLI+ LGKL K+L +++++ +IP+K  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG ++LA DLFIYC G+FPLLS +AM +K  L  +YEK+FV LG  I+P   GLL GLLPGLEEGAE+Y R N++LE F+++V P +FYT +W+ ML  PSVR  G  +LLNH N+R + +DQL+ +G  I LM+  +   L D  VLVQR  LDF+L A  MH  QLT  D  K+  A + V+LRRDMSLNRR Y+WL+G           VV+S   H++  +S S  +E+   YF+ YS+D+L+ A+K  +   T     SSA    + +KPFRI+ +L+D+ EIG  IIE++L +          +  +L  EA      H  N  +S  + ++   + L  E LKTANL F + +  F W+Y+ R+F  A +Q+         Q       ++I+ +C LV F+L  + ++ Y +  + H
Sbjct:    6 VEECELLTDSKYRSYITQVEKALRSFEYTSEWADLISALGKLNKVLLSHLKYPVIPKKVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTQRLAHDLFIYCAGLFPLLSHAAMSVKPVLLTVYEKHFVALGRHIKPGLNGLLLGLLPGLEEGAEYYERTNQLLEDFSDAVGPPFFYTGIWECMLSYPSVRLSGATYLLNHLNKRQTMEDQLHMIGLDIDLMVAGICSCLQDSSVLVQRSMLDFLLLAFPMHNGQLTRGDMAKVVEAGVNVVLRRDMSLNRRLYAWLLGTA--TTATTATVVDS---HRQRTDSSSTISEMDNSYFQTYSKDLLVTALKAKLLEETSPSTISSADGSYNMLKPFRILISLLDKPEIGPVIIENVLLS----------VFRRLKMEA----TLHGNN--ESVKQITLPPDSKLPLETLKTANLLFGSFEPYFLWDYIARMFSFACEQKQKEKLDSEKQNESSADVVSIEEMCSLVGFLLDVISLDVYPETTTEH 500          

HSP 3 Score: 130.568 bits (327), Expect = 4.792e-26
Identity = 122/456 (26.75%), Postives = 210/456 (46.05%), Query Frame = 3
Query: 1782 VMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKS-------------RVEKLNK----AEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPN 3098
            +M   + +F++F  +F +  +  S +      N++ + +T  S             RV K +K     EME   L             Y + C+L+++  S+P+Y      Y++I +  E   K  +  LP WL   +  +C+++ F ++S ++S LLDLI+ T+ V   +                          ENK           T  +  + +S+G+ ++ ++ +LL   +I  ++ +T F+ +    LW+YL   +   HQ +V L + LH+  P+A+ICE++I Q +++D+  E + + ++F +LW L             N S   S RTFD+ + V+LDSL   S       + +TL  +WL    Q G   +++ PLL  LL PDTARIS+  +          +  +  + E+ E       E +IYAIS+E GNV YHL  N
Sbjct:  761 LMQLCVQSFQQFFHRFCLLKMLKSEEFCQSAMNNIMTDSTPHSCLTDEHDVCDSNLRVHKHSKLVLDGEMEEVKL------------AYKQACRLLLDFASFPIYCT---DYQAILD--EMGSKEESSTLPHWLQDFLMCSCYVDCFEVQSASISTLLDLIHLTQSVQTER--------------------------ENK-----------TRNNGRQSISEGNVSVVILPALLPSHLIY-INTRTHFYQVVASELWEYLCEKHNFHHQRSVELFHTLHQVTPNANICEDVIGQALISDSEVERISAFKKFSVLWHLTRS-----IKTEPNPSR--SPRTFDRSMFVVLDSLKEESS------ITKTLATTWLTHVIQRGDTSRVLQPLLFMLLHPDTARISIQHV-------SVHKAKKVSVSEKGEEDI----ESKIYAISSEGGNVIYHLSQN 1137          
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Match: A0A2C9KBX0 (Dopey_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052647 PE=4 SV=1)

HSP 1 Score: 505.368 bits (1300), Expect = 6.919e-141
Identity = 373/1228 (30.37%), Postives = 603/1228 (49.10%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI---------TQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE---------ALKSYQLQEEKGSSSE-QSFLGALFN---KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTE--KEEGQVKVNLLEFLQCFLITGSSTKLSLISG--CLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ----------------------NDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-------LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            IH LH HMLLY   +D +  LY+L+ LRT+  + P +VV  +                +++   +A +  K+  +L RH  ++ G NF+ +   E + S++S   +EI++ +C +F+   YP      K+S E++  NK V IL  EIL  +V E+L+I++     ++++  D ++                 RC + K  LHC+  S+         +  +  +  L++ I+  NESGLD  V DA Q+ L++LVL           + +L + I+L      S      +  L S   +L + HY  S P I   +Q + L+++ + +    L HLH +    + S+L   G++ +  +M +V +LC+N+           +II        + +  +P D+ +S L  L  +CH+ LLD          A  S  +  E  S+ +  + L  +FN     K+ +   DS  P   +LDAR +++ ++ R +  +  LW+  ++  + N+     P   T+G    VRQ IL ++ P+   H + +L + A  W               +D  Q    N+ S +   +  +Q   + ++EL   +K    +  +I T + +I++           P LTE  K+   ++VNLL+F   + +  ++T   L+     L  LL+E +  +L P A F+LL+IL +F+ K    +EK+ Q+++QD+CQK LE+++ IAGSSLEQ +W RR   +K         PG                                     FG   +E     + +  + +  SA K A I  R   S    ++QAL L+    A I+DV Y SEEK+KV PFLT++++ NV PYLR+ SS N+ +++  SQ+++S+S YQ+TRR+WRK+ F+LL E+ FFQ D  S+  W VIIDNLMT DK TFK+   ++++ Q G LNLF+SKE EY+Q    +K+LAF ++ SE DQY ++MP+IQE+L+E LRL  +  + + +FLCFRVL++R+S QHLTSLW   I  L  VL  +  +L  +    K                       N +N       L +YLS CKLLD+  +M  D VPQF  Y+WAFVG        +DE+ + +R N     P+F P + + +   +   +     L   E         +PL+    + SL DL  FF+T
Sbjct: 1405 IHELHMHMLLYTQQFDYHRTLYALTTLRTMLHNCPRLVVTAMAT--------------TSISSVRAPHLAKLQSLLGRHRKSVFGKNFFGDLPQEVVSSYRSNMLVEIVISLCLYFVRGYYPNLMVN-KLSHEELLGNKMVHILGVEILTLMVSELLSIMKESGKNFVSYISDLLS-----------------RCKLQKSLLHCLLASVYNQGLGPTSSGGKSESRKLTELIIEFNESGLDPSVNDAFQMKLLQLVL----------VTVMLEDQIRLVQGTADSQTGPTERAHLTS---SLLNVHYNASLPII---QQEMFLSAVWSALKQHHLCHLHRHWVGLVTSALPYMGRAMARTVMCVVLQLCRNL-----------EIIALDLSKKKSTMQRVPPDHVVSMLEGLTTLCHYCLLDNTSPVSIGQPAPTSTNISTETASAGQILTNLIHVFNPVTSGKEPSPARDS-PPVAPVLDARTRLLGILPRIMACMATLWKAVAIVNEDNVYITSHP---TVGEFKAVRQHILELLSPISLPHGTNLLAAFAVAW---------------NDRRQTPKKNQVSPT---ICEDQ---LLLVELVSAIK-VLPMDTLIQTVKQVIKQ-----------PPLTELTKKGVPLEVNLLQFFFAY-VRNTTTIAQLLDSWPSLLSLLRECLQMNLTPPALFLLLQILHEFVQKTPTMEEKKNQKDLQDICQKALESISAIAGSSLEQTTWLRRNFAVK---------PGPQ----------------------------------NFGEEDLETHEDAD-MSEVKKEASAVK-APIR-RSQASDSKYSVQALGLMAELTAPILDVIYSSEEKDKVAPFLTTLLY-NVFPYLRHHSSHNVPSYKACSQMLSSISGYQYTRRAWRKEAFELLMETSFFQMDAKSISYWHVIIDNLMTHDKTTFKDLMGRVSITQTGSLNLFSSKEQEYEQRTQMIKRLAFTLFCSETDQYQRAMPDIQERLAEGLRLPSVANVMSSVFLCFRVLILRMSPQHLTSLWPTIITELVQVLLQIEQELSTETDEFKSRLSKWTQIQRIAALDSSWAHLGNGLNAHNNPAWLQLYLSVCKLLDMCIVMPADQVPQFQLYRWAFVGTAGEDEYPMDEDCDGWRPN-----PLFTPHI-IRLSRLLNNRMKKKPTLMKTE-------PGRPLLTMPKLQSLADLQSFFYT 2475          

HSP 2 Score: 381.333 bits (978), Expect = 2.388e-102
Identity = 223/516 (43.22%), Postives = 324/516 (62.79%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSE-NELQLRYFKKYSRDILIAAIKWIIDNPT-----SSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQ-------MTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+ +   D+K+R++  QV+K L+ FEY+SEWADLI+ LGKL K+L +++++ +IP+K  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG ++LA DLFIYC G+FPLLS +AM +K  L  +YEK+FV LG  I+P   GLL GLLPGLEEGAE+Y R N++LE F+++V P +FYT +W+ ML  PSVR  G  +LLNH N+R + +DQL+ +G  I LM+  +   L D  VLVQR  LDF+L A  MH  QLT  D  K+  A + V+LRRDMSLNRR Y+WL+G           VV+S   H++  +S S  +E+   YF+ YS+D+L+ A+K  +   T     SSA    + +KPFRI+ +L+D+ EIG  IIE++L +          +  +L  EA      H  N  +S  + ++   + L  E LKTANL F + +  F W+Y+ R+F  A +Q+         Q       ++I+ +C LV F+L  + ++ Y +  + H
Sbjct:    6 VEECELLTDSKYRSYITQVEKALRSFEYTSEWADLISALGKLNKVLLSHLKYPVIPKKVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTQRLAHDLFIYCAGLFPLLSHAAMSVKPVLLTVYEKHFVALGRHIKPGLNGLLLGLLPGLEEGAEYYERTNQLLEDFSDAVGPPFFYTGIWECMLSYPSVRLSGATYLLNHLNKRQTMEDQLHMIGLDIDLMVAGICSCLQDSSVLVQRSMLDFLLLAFPMHNGQLTRGDMAKVVEAGVNVVLRRDMSLNRRLYAWLLGTA--TTATTATVVDS---HRQRTDSSSTISEMDNSYFQTYSKDLLVTALKAKLLEETSPSTISSADGSYNMLKPFRILISLLDKPEIGPVIIENVLLS----------VFRRLKMEA----TLHGNN--ESVKQITLPPDSKLPLETLKTANLLFGSFEPYFLWDYIARMFSFACEQKQKEKLDSEKQNESSADVVSIEEMCSLVGFLLDVISLDVYPETTTEH 500          

HSP 3 Score: 130.568 bits (327), Expect = 5.086e-26
Identity = 122/456 (26.75%), Postives = 210/456 (46.05%), Query Frame = 3
Query: 1782 VMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKS-------------RVEKLNK----AEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPN 3098
            +M   + +F++F  +F +  +  S +      N++ + +T  S             RV K +K     EME   L             Y + C+L+++  S+P+Y      Y++I +  E   K  +  LP WL   +  +C+++ F ++S ++S LLDLI+ T+ V   +                          ENK           T  +  + +S+G+ ++ ++ +LL   +I  ++ +T F+ +    LW+YL   +   HQ +V L + LH+  P+A+ICE++I Q +++D+  E + + ++F +LW L             N S   S RTFD+ + V+LDSL   S       + +TL  +WL    Q G   +++ PLL  LL PDTARIS+  +          +  +  + E+ E       E +IYAIS+E GNV YHL  N
Sbjct:  761 LMQLCVQSFQQFFHRFCLLKMLKSEEFCQSAMNNIMTDSTPHSCLTDEHDVCDSNLRVHKHSKLVLDGEMEEVKL------------AYKQACRLLLDFASFPIYCT---DYQAILD--EMGSKEESSTLPHWLQDFLMCSCYVDCFEVQSASISTLLDLIHLTQSVQTER--------------------------ENK-----------TRNNGRQSISEGNVSVVILPALLPSHLIY-INTRTHFYQVVASELWEYLCEKHNFHHQRSVELFHTLHQVTPNANICEDVIGQALISDSEVERISAFKKFSVLWHLTRS-----IKTEPNPSR--SPRTFDRSMFVVLDSLKEESS------ITKTLATTWLTHVIQRGDTSRVLQPLLFMLLHPDTARISIQHV-------SVHKAKKVSVSEKGEEDI----ESKIYAISSEGGNVIYHLSQN 1137          
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Match: A0A2C9KBX3 (Dopey_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052647 PE=4 SV=1)

HSP 1 Score: 504.982 bits (1299), Expect = 9.368e-141
Identity = 371/1227 (30.24%), Postives = 601/1227 (48.98%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI---------TQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE---------ALKSYQLQEEKGSSSE-QSFLGALFN---KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTE--KEEGQVKVNLLEFLQCFLITGSSTKLSLISG--CLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKR--------------------------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-------LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            IH LH HMLLY   +D +  LY+L+ LRT+  + P +VV  +                +++   +A +  K+  +L RH  ++ G NF+ +   E + S++S   +EI++ +C +F+   YP      K+S E++  NK V IL  EIL  +V E+L+I++     ++++  D ++                 RC + K  LHC+  S+         +  +  +  L++ I+  NESGLD  V DA Q+ L++LVL           + +L + I+L      S      +  L S   +L + HY  S P I   +Q + L+++ + +    L HLH +    + S+L   G++ +  +M +V +LC+N+           +II        + +  +P D+ +S L  L  +CH+ LLD          A  S  +  E  S+ +  + L  +FN     K+ +   DS  P   +LDAR +++ ++ R +  +  LW+  ++  + N+     P   T+G    VRQ IL ++ P+   H + +L + A  W               +D  Q    N+ S +   +  +Q   + ++EL   +K    +  +I T + +I++           P LTE  K+   ++VNLL+F   + +  ++T   L+     L  LL+E +  +L P A F+LL+IL +F+ K    +EK+ Q+++QD+CQK LE+++ IAGSSLEQ +W RR   +K         PG                                     FG   +E     + +  + +  SA K A I  R   S    ++QAL L+    A I+DV Y SEEK+KV PFLT++++ NV PYLR+ SS N+ +++  SQ+++S+S YQ+TRR+WRK+ F+LL E+ FFQ D  S+  W VIIDNLMT DK TFK+   ++++ Q G LNLF+SKE EY+Q    +K+LAF ++ SE DQY ++MP+IQE+L+E LRL  +  + + +FLCFRVL++R+S QHLTSLW   I  L  VL  +  +L  +       D   +                          L +YLS CKLLD+  +M  D VPQF  Y+WAFVG        +DE+ + +R N     P+F P + + +   +   +     L   E         +PL+    + SL DL  FF+T
Sbjct: 1405 IHELHMHMLLYTQQFDYHRTLYALTTLRTMLHNCPRLVVTAMAT--------------TSISSVRAPHLAKLQSLLGRHRKSVFGKNFFGDLPQEVVSSYRSNMLVEIVISLCLYFVRGYYPNLMVN-KLSHEELLGNKMVHILGVEILTLMVSELLSIMKESGKNFVSYISDLLS-----------------RCKLQKSLLHCLLASVYNQGLGPTSSGGKSESRKLTELIIEFNESGLDPSVNDAFQMKLLQLVL----------VTVMLEDQIRLVQGTADSQTGPTERAHLTS---SLLNVHYNASLPII---QQEMFLSAVWSALKQHHLCHLHRHWVGLVTSALPYMGRAMARTVMCVVLQLCRNL-----------EIIALDLSKKKSTMQRVPPDHVVSMLEGLTTLCHYCLLDNTSPVSIGQPAPTSTNISTETASAGQILTNLIHVFNPVTSGKEPSPARDS-PPVAPVLDARTRLLGILPRIMACMATLWKAVAIVNEDNVYITSHP---TVGEFKAVRQHILELLSPISLPHGTNLLAAFAVAW---------------NDRRQTPKKNQVSPT---ICEDQ---LLLVELVSAIK-VLPMDTLIQTVKQVIKQ-----------PPLTELTKKGVPLEVNLLQFFFAY-VRNTTTIAQLLDSWPSLLSLLRECLQMNLTPPALFLLLQILHEFVQKTPTMEEKKNQKDLQDICQKALESISAIAGSSLEQTTWLRRNFAVK---------PGPQ----------------------------------NFGEEDLETHEDAD-MSEVKKEASAVK-APIR-RSQASDSKYSVQALGLMAELTAPILDVIYSSEEKDKVAPFLTTLLY-NVFPYLRHHSSHNVPSYKACSQMLSSISGYQYTRRAWRKEAFELLMETSFFQMDAKSISYWHVIIDNLMTHDKTTFKDLMGRVSITQTGSLNLFSSKEQEYEQRTQMIKRLAFTLFCSETDQYQRAMPDIQERLAEGLRLPSVANVMSSVFLCFRVLILRMSPQHLTSLWPTIITELVQVLLQIEQELSTETDEFNPGDEGTQIQRIAALDSSWAHLGNGLNAHNNPAWLQLYLSVCKLLDMCIVMPADQVPQFQLYRWAFVGTAGEDEYPMDEDCDGWRPN-----PLFTPHI-IRLSRLLNNRMKKKPTLMKTE-------PGRPLLTMPKLQSLADLQSFFYT 2474          

HSP 2 Score: 381.333 bits (978), Expect = 2.083e-102
Identity = 223/516 (43.22%), Postives = 324/516 (62.79%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSE-NELQLRYFKKYSRDILIAAIKWIIDNPT-----SSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQ-------MTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+ +   D+K+R++  QV+K L+ FEY+SEWADLI+ LGKL K+L +++++ +IP+K  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG ++LA DLFIYC G+FPLLS +AM +K  L  +YEK+FV LG  I+P   GLL GLLPGLEEGAE+Y R N++LE F+++V P +FYT +W+ ML  PSVR  G  +LLNH N+R + +DQL+ +G  I LM+  +   L D  VLVQR  LDF+L A  MH  QLT  D  K+  A + V+LRRDMSLNRR Y+WL+G           VV+S   H++  +S S  +E+   YF+ YS+D+L+ A+K  +   T     SSA    + +KPFRI+ +L+D+ EIG  IIE++L +          +  +L  EA      H  N  +S  + ++   + L  E LKTANL F + +  F W+Y+ R+F  A +Q+         Q       ++I+ +C LV F+L  + ++ Y +  + H
Sbjct:    6 VEECELLTDSKYRSYITQVEKALRSFEYTSEWADLISALGKLNKVLLSHLKYPVIPKKVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTQRLAHDLFIYCAGLFPLLSHAAMSVKPVLLTVYEKHFVALGRHIKPGLNGLLLGLLPGLEEGAEYYERTNQLLEDFSDAVGPPFFYTGIWECMLSYPSVRLSGATYLLNHLNKRQTMEDQLHMIGLDIDLMVAGICSCLQDSSVLVQRSMLDFLLLAFPMHNGQLTRGDMAKVVEAGVNVVLRRDMSLNRRLYAWLLGTA--TTATTATVVDS---HRQRTDSSSTISEMDNSYFQTYSKDLLVTALKAKLLEETSPSTISSADGSYNMLKPFRILISLLDKPEIGPVIIENVLLS----------VFRRLKMEA----TLHGNN--ESVKQITLPPDSKLPLETLKTANLLFGSFEPYFLWDYIARMFSFACEQKQKEKLDSEKQNESSADVVSIEEMCSLVGFLLDVISLDVYPETTTEH 500          

HSP 3 Score: 130.568 bits (327), Expect = 4.520e-26
Identity = 122/456 (26.75%), Postives = 210/456 (46.05%), Query Frame = 3
Query: 1782 VMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKS-------------RVEKLNK----AEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPN 3098
            +M   + +F++F  +F +  +  S +      N++ + +T  S             RV K +K     EME   L             Y + C+L+++  S+P+Y      Y++I +  E   K  +  LP WL   +  +C+++ F ++S ++S LLDLI+ T+ V   +                          ENK           T  +  + +S+G+ ++ ++ +LL   +I  ++ +T F+ +    LW+YL   +   HQ +V L + LH+  P+A+ICE++I Q +++D+  E + + ++F +LW L             N S   S RTFD+ + V+LDSL   S       + +TL  +WL    Q G   +++ PLL  LL PDTARIS+  +          +  +  + E+ E       E +IYAIS+E GNV YHL  N
Sbjct:  761 LMQLCVQSFQQFFHRFCLLKMLKSEEFCQSAMNNIMTDSTPHSCLTDEHDVCDSNLRVHKHSKLVLDGEMEEVKL------------AYKQACRLLLDFASFPIYCT---DYQAILD--EMGSKEESSTLPHWLQDFLMCSCYVDCFEVQSASISTLLDLIHLTQSVQTER--------------------------ENK-----------TRNNGRQSISEGNVSVVILPALLPSHLIY-INTRTHFYQVVASELWEYLCEKHNFHHQRSVELFHTLHQVTPNANICEDVIGQALISDSEVERISAFKKFSVLWHLTRS-----IKTEPNPSR--SPRTFDRSMFVVLDSLKEESS------ITKTLATTWLTHVIQRGDTSRVLQPLLFMLLHPDTARISIQHV-------SVHKAKKVSVSEKGEEDI----ESKIYAISSEGGNVIYHLSQN 1137          
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Match: A0A2C9KBU5 (Dopey_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052647 PE=4 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 2.245e-140
Identity = 372/1230 (30.24%), Postives = 603/1230 (49.02%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI---------TQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE---------ALKSYQLQEEKGSSSE-QSFLGALFN---KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTE--KEEGQVKVNLLEFLQCFLITGSSTKLSLISG--CLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQ------------------------NDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-------LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            IH LH HMLLY   +D +  LY+L+ LRT+  + P +VV  +                +++   +A +  K+  +L RH  ++ G NF+ +   E + S++S   +EI++ +C +F+   YP      K+S E++  NK V IL  EIL  +V E+L+I++     ++++  D ++                 RC + K  LHC+  S+         +  +  +  L++ I+  NESGLD  V DA Q+ L++LVL           + +L + I+L      S      +  L S   +L + HY  S P I   +Q + L+++ + +    L HLH +    + S+L   G++ +  +M +V +LC+N+           +II        + +  +P D+ +S L  L  +CH+ LLD          A  S  +  E  S+ +  + L  +FN     K+ +   DS  P   +LDAR +++ ++ R +  +  LW+  ++  + N+     P   T+G    VRQ IL ++ P+   H + +L + A  W               +D  Q    N+ S +   +  +Q   + ++EL   +K    +  +I T + +I++           P LTE  K+   ++VNLL+F   + +  ++T   L+     L  LL+E +  +L P A F+LL+IL +F+ K    +EK+ Q+++QD+CQK LE+++ IAGSSLEQ +W RR   +K         PG                                     FG   +E     + +  + +  SA K A I  R   S    ++QAL L+    A I+DV Y SEEK+KV PFLT++++ NV PYLR+ SS N+ +++  SQ+++S+S YQ+TRR+WRK+ F+LL E+ FFQ D  S+  W VIIDNLMT DK TFK+   ++++ Q G LNLF+SKE EY+Q    +K+LAF ++ SE DQY ++MP+IQE+L+E LRL  +  + + +FLCFRVL++R+S QHLTSLW   I  L  VL  +  +L  +     +                        N +N       L +YLS CKLLD+  +M  D VPQF  Y+WAFVG        +DE+ + +R N     P+F P + + +   +   +     L   E         +PL+    + SL DL  FF+T
Sbjct: 1405 IHELHMHMLLYTQQFDYHRTLYALTTLRTMLHNCPRLVVTAMAT--------------TSISSVRAPHLAKLQSLLGRHRKSVFGKNFFGDLPQEVVSSYRSNMLVEIVISLCLYFVRGYYPNLMVN-KLSHEELLGNKMVHILGVEILTLMVSELLSIMKESGKNFVSYISDLLS-----------------RCKLQKSLLHCLLASVYNQGLGPTSSGGKSESRKLTELIIEFNESGLDPSVNDAFQMKLLQLVL----------VTVMLEDQIRLVQGTADSQTGPTERAHLTS---SLLNVHYNASLPII---QQEMFLSAVWSALKQHHLCHLHRHWVGLVTSALPYMGRAMARTVMCVVLQLCRNL-----------EIIALDLSKKKSTMQRVPPDHVVSMLEGLTTLCHYCLLDNTSPVSIGQPAPTSTNISTETASAGQILTNLIHVFNPVTSGKEPSPARDS-PPVAPVLDARTRLLGILPRIMACMATLWKAVAIVNEDNVYITSHP---TVGEFKAVRQHILELLSPISLPHGTNLLAAFAVAW---------------NDRRQTPKKNQVSPT---ICEDQ---LLLVELVSAIK-VLPMDTLIQTVKQVIKQ-----------PPLTELTKKGVPLEVNLLQFFFAY-VRNTTTIAQLLDSWPSLLSLLRECLQMNLTPPALFLLLQILHEFVQKTPTMEEKKNQKDLQDICQKALESISAIAGSSLEQTTWLRRNFAVK---------PGPQ----------------------------------NFGEEDLETHEDAD-MSEVKKEASAVK-APIR-RSQASDSKYSVQALGLMAELTAPILDVIYSSEEKDKVAPFLTTLLY-NVFPYLRHHSSHNVPSYKACSQMLSSISGYQYTRRAWRKEAFELLMETSFFQMDAKSISYWHVIIDNLMTHDKTTFKDLMGRVSITQTGSLNLFSSKEQEYEQRTQMIKRLAFTLFCSETDQYQRAMPDIQERLAEGLRLPSVANVMSSVFLCFRVLILRMSPQHLTSLWPTIITELVQVLLQIEQELSTETDEFNEYLRTRSRTQIQRIAALDSSWAHLGNGLNAHNNPAWLQLYLSVCKLLDMCIVMPADQVPQFQLYRWAFVGTAGEDEYPMDEDCDGWRPN-----PLFTPHI-IRLSRLLNNRMKKKPTLMKTE-------PGRPLLTMPKLQSLADLQSFFYT 2477          

HSP 2 Score: 381.333 bits (978), Expect = 2.124e-102
Identity = 223/516 (43.22%), Postives = 324/516 (62.79%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSE-NELQLRYFKKYSRDILIAAIKWIIDNPT-----SSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQ-------MTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+ +   D+K+R++  QV+K L+ FEY+SEWADLI+ LGKL K+L +++++ +IP+K  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG ++LA DLFIYC G+FPLLS +AM +K  L  +YEK+FV LG  I+P   GLL GLLPGLEEGAE+Y R N++LE F+++V P +FYT +W+ ML  PSVR  G  +LLNH N+R + +DQL+ +G  I LM+  +   L D  VLVQR  LDF+L A  MH  QLT  D  K+  A + V+LRRDMSLNRR Y+WL+G           VV+S   H++  +S S  +E+   YF+ YS+D+L+ A+K  +   T     SSA    + +KPFRI+ +L+D+ EIG  IIE++L +          +  +L  EA      H  N  +S  + ++   + L  E LKTANL F + +  F W+Y+ R+F  A +Q+         Q       ++I+ +C LV F+L  + ++ Y +  + H
Sbjct:    6 VEECELLTDSKYRSYITQVEKALRSFEYTSEWADLISALGKLNKVLLSHLKYPVIPKKVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTQRLAHDLFIYCAGLFPLLSHAAMSVKPVLLTVYEKHFVALGRHIKPGLNGLLLGLLPGLEEGAEYYERTNQLLEDFSDAVGPPFFYTGIWECMLSYPSVRLSGATYLLNHLNKRQTMEDQLHMIGLDIDLMVAGICSCLQDSSVLVQRSMLDFLLLAFPMHNGQLTRGDMAKVVEAGVNVVLRRDMSLNRRLYAWLLGTA--TTATTATVVDS---HRQRTDSSSTISEMDNSYFQTYSKDLLVTALKAKLLEETSPSTISSADGSYNMLKPFRILISLLDKPEIGPVIIENVLLS----------VFRRLKMEA----TLHGNN--ESVKQITLPPDSKLPLETLKTANLLFGSFEPYFLWDYIARMFSFACEQKQKEKLDSEKQNESSADVVSIEEMCSLVGFLLDVISLDVYPETTTEH 500          

HSP 3 Score: 130.568 bits (327), Expect = 4.796e-26
Identity = 122/456 (26.75%), Postives = 210/456 (46.05%), Query Frame = 3
Query: 1782 VMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKS-------------RVEKLNK----AEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPN 3098
            +M   + +F++F  +F +  +  S +      N++ + +T  S             RV K +K     EME   L             Y + C+L+++  S+P+Y      Y++I +  E   K  +  LP WL   +  +C+++ F ++S ++S LLDLI+ T+ V   +                          ENK           T  +  + +S+G+ ++ ++ +LL   +I  ++ +T F+ +    LW+YL   +   HQ +V L + LH+  P+A+ICE++I Q +++D+  E + + ++F +LW L             N S   S RTFD+ + V+LDSL   S       + +TL  +WL    Q G   +++ PLL  LL PDTARIS+  +          +  +  + E+ E       E +IYAIS+E GNV YHL  N
Sbjct:  761 LMQLCVQSFQQFFHRFCLLKMLKSEEFCQSAMNNIMTDSTPHSCLTDEHDVCDSNLRVHKHSKLVLDGEMEEVKL------------AYKQACRLLLDFASFPIYCT---DYQAILD--EMGSKEESSTLPHWLQDFLMCSCYVDCFEVQSASISTLLDLIHLTQSVQTER--------------------------ENK-----------TRNNGRQSISEGNVSVVILPALLPSHLIY-INTRTHFYQVVASELWEYLCEKHNFHHQRSVELFHTLHQVTPNANICEDVIGQALISDSEVERISAFKKFSVLWHLTRS-----IKTEPNPSR--SPRTFDRSMFVVLDSLKEESS------ITKTLATTWLTHVIQRGDTSRVLQPLLFMLLHPDTARISIQHV-------SVHKAKKVSVSEKGEEDI----ESKIYAISSEGGNVIYHLSQN 1137          
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Match: A0A2C9KBX2 (Dopey_N domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052647 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 1.388e-139
Identity = 374/1235 (30.28%), Postives = 605/1235 (48.99%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI---------TQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDE---------ALKSYQLQEEKGSSSE-QSFLGALFN---KSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTE--KEEGQVKVNLLEFLQCFLITGSSTKLSLISG--CLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDL--------------------KCDIKSIKQ---------NDINKR-----LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGN-------LDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            IH LH HMLLY   +D +  LY+L+ LRT+  + P +VV  +                +++   +A +  K+  +L RH  ++ G NF+ +   E + S++S   +EI++ +C +F+   YP      K+S E++  NK V IL  EIL  +V E+L+I++     ++++  D ++                 RC + K  LHC+  S+         +  +  +  L++ I+  NESGLD  V DA Q+ L++LVL           + +L + I+L      S      +  L S   +L + HY  S P I   +Q + L+++ + +    L HLH +    + S+L   G++ +  +M +V +LC+N+           +II        + +  +P D+ +S L  L  +CH+ LLD          A  S  +  E  S+ +  + L  +FN     K+ +   DS  P   +LDAR +++ ++ R +  +  LW+  ++  + N+     P   T+G    VRQ IL ++ P+   H + +L + A  W               +D  Q    N+ S +   +  +Q   + ++EL   +K    +  +I T + +I++           P LTE  K+   ++VNLL+F   + +  ++T   L+     L  LL+E +  +L P A F+LL+IL +F+ K    +EK+ Q+++QD+CQK LE+++ IAGSSLEQ +W RR   +K         PG                                     FG   +E     + +  + +  SA K A I  R   S    ++QAL L+    A I+DV Y SEEK+KV PFLT++++ NV PYLR+ SS N+ +++  SQ+++S+S YQ+TRR+WRK+ F+LL E+ FFQ D  S+  W VIIDNLMT DK TFK+   ++++ Q G LNLF+SKE EY+Q    +K+LAF ++ SE DQY ++MP+IQE+L+E LRL  +  + + +FLCFRVL++R+S QHLTSLW   I  L  VL  +  +L                    +  I+ I           N +N       L +YLS CKLLD+  +M  D VPQF  Y+WAFVG        +DE+ + +R N     P+F P + + +   +   +     L   E         +PL+    + SL DL  FF+T
Sbjct: 1405 IHELHMHMLLYTQQFDYHRTLYALTTLRTMLHNCPRLVVTAMAT--------------TSISSVRAPHLAKLQSLLGRHRKSVFGKNFFGDLPQEVVSSYRSNMLVEIVISLCLYFVRGYYPNLMVN-KLSHEELLGNKMVHILGVEILTLMVSELLSIMKESGKNFVSYISDLLS-----------------RCKLQKSLLHCLLASVYNQGLGPTSSGGKSESRKLTELIIEFNESGLDPSVNDAFQMKLLQLVL----------VTVMLEDQIRLVQGTADSQTGPTERAHLTS---SLLNVHYNASLPII---QQEMFLSAVWSALKQHHLCHLHRHWVGLVTSALPYMGRAMARTVMCVVLQLCRNL-----------EIIALDLSKKKSTMQRVPPDHVVSMLEGLTTLCHYCLLDNTSPVSIGQPAPTSTNISTETASAGQILTNLIHVFNPVTSGKEPSPARDS-PPVAPVLDARTRLLGILPRIMACMATLWKAVAIVNEDNVYITSHP---TVGEFKAVRQHILELLSPISLPHGTNLLAAFAVAW---------------NDRRQTPKKNQVSPT---ICEDQ---LLLVELVSAIK-VLPMDTLIQTVKQVIKQ-----------PPLTELTKKGVPLEVNLLQFFFAY-VRNTTTIAQLLDSWPSLLSLLRECLQMNLTPPALFLLLQILHEFVQKTPTMEEKKNQKDLQDICQKALESISAIAGSSLEQTTWLRRNFAVK---------PGPQ----------------------------------NFGEEDLETHEDAD-MSEVKKEASAVK-APIR-RSQASDSKYSVQALGLMAELTAPILDVIYSSEEKDKVAPFLTTLLY-NVFPYLRHHSSHNVPSYKACSQMLSSISGYQYTRRAWRKEAFELLMETSFFQMDAKSISYWHVIIDNLMTHDKTTFKDLMGRVSITQTGSLNLFSSKEQEYEQRTQMIKRLAFTLFCSETDQYQRAMPDIQERLAEGLRLPSVANVMSSVFLCFRVLILRMSPQHLTSLWPTIITELVQVLLQIEQELSTETDEFNPGDEGEYLRTRSRTQIQRIAALDSSWAHLGNGLNAHNNPAWLQLYLSVCKLLDMCIVMPADQVPQFQLYRWAFVGTAGEDEYPMDEDCDGWRPN-----PLFTPHI-IRLSRLLNNRMKKKPTLMKTE-------PGRPLLTMPKLQSLADLQSFFYT 2482          

HSP 2 Score: 381.333 bits (978), Expect = 2.284e-102
Identity = 223/516 (43.22%), Postives = 324/516 (62.79%), Query Frame = 3
Query:   24 IEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSE-NELQLRYFKKYSRDILIAAIKWIIDNPT-----SSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQ-------MTIDRICELVKFILIRLPIETYSDVHSRH 1532
            +E+ +   D+K+R++  QV+K L+ FEY+SEWADLI+ LGKL K+L +++++ +IP+K  +GKRL+QCLHPALP+GVH+KALE +D+IF  IG ++LA DLFIYC G+FPLLS +AM +K  L  +YEK+FV LG  I+P   GLL GLLPGLEEGAE+Y R N++LE F+++V P +FYT +W+ ML  PSVR  G  +LLNH N+R + +DQL+ +G  I LM+  +   L D  VLVQR  LDF+L A  MH  QLT  D  K+  A + V+LRRDMSLNRR Y+WL+G           VV+S   H++  +S S  +E+   YF+ YS+D+L+ A+K  +   T     SSA    + +KPFRI+ +L+D+ EIG  IIE++L +          +  +L  EA      H  N  +S  + ++   + L  E LKTANL F + +  F W+Y+ R+F  A +Q+         Q       ++I+ +C LV F+L  + ++ Y +  + H
Sbjct:    6 VEECELLTDSKYRSYITQVEKALRSFEYTSEWADLISALGKLNKVLLSHLKYPVIPKKVTIGKRLAQCLHPALPSGVHLKALETYDIIFKCIGTQRLAHDLFIYCAGLFPLLSHAAMSVKPVLLTVYEKHFVALGRHIKPGLNGLLLGLLPGLEEGAEYYERTNQLLEDFSDAVGPPFFYTGIWECMLSYPSVRLSGATYLLNHLNKRQTMEDQLHMIGLDIDLMVAGICSCLQDSSVLVQRSMLDFLLLAFPMHNGQLTRGDMAKVVEAGVNVVLRRDMSLNRRLYAWLLGTA--TTATTATVVDS---HRQRTDSSSTISEMDNSYFQTYSKDLLVTALKAKLLEETSPSTISSADGSYNMLKPFRILISLLDKPEIGPVIIENVLLS----------VFRRLKMEA----TLHGNN--ESVKQITLPPDSKLPLETLKTANLLFGSFEPYFLWDYIARMFSFACEQKQKEKLDSEKQNESSADVVSIEEMCSLVGFLLDVISLDVYPETTTEH 500          

HSP 3 Score: 130.568 bits (327), Expect = 4.563e-26
Identity = 122/456 (26.75%), Postives = 210/456 (46.05%), Query Frame = 3
Query: 1782 VMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKS-------------RVEKLNK----AEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPN 3098
            +M   + +F++F  +F +  +  S +      N++ + +T  S             RV K +K     EME   L             Y + C+L+++  S+P+Y      Y++I +  E   K  +  LP WL   +  +C+++ F ++S ++S LLDLI+ T+ V   +                          ENK           T  +  + +S+G+ ++ ++ +LL   +I  ++ +T F+ +    LW+YL   +   HQ +V L + LH+  P+A+ICE++I Q +++D+  E + + ++F +LW L             N S   S RTFD+ + V+LDSL   S       + +TL  +WL    Q G   +++ PLL  LL PDTARIS+  +          +  +  + E+ E       E +IYAIS+E GNV YHL  N
Sbjct:  761 LMQLCVQSFQQFFHRFCLLKMLKSEEFCQSAMNNIMTDSTPHSCLTDEHDVCDSNLRVHKHSKLVLDGEMEEVKL------------AYKQACRLLLDFASFPIYCT---DYQAILD--EMGSKEESSTLPHWLQDFLMCSCYVDCFEVQSASISTLLDLIHLTQSVQTER--------------------------ENK-----------TRNNGRQSISEGNVSVVILPALLPSHLIY-INTRTHFYQVVASELWEYLCEKHNFHHQRSVELFHTLHQVTPNANICEDVIGQALISDSEVERISAFKKFSVLWHLTRS-----IKTEPNPSR--SPRTFDRSMFVVLDSLKEESS------ITKTLATTWLTHVIQRGDTSRVLQPLLFMLLHPDTARISIQHV-------SVHKAKKVSVSEKGEEDI----ESKIYAISSEGGNVIYHLSQN 1137          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Cavefish
Match: dop1b (DOP1 leucine zipper like protein B [Source:ZFIN;Acc:ZDB-GENE-040426-1195])

HSP 1 Score: 302.753 bits (774), Expect = 7.415e-82
Identity = 187/517 (36.17%), Postives = 300/517 (58.03%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLF-------------ALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLR-YFKKYSRDILIAAIKWIIDNP-TSSASERISS-IKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSR 1529
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+++ ++PR+ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL+ +AM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEG E Y R + +L + +  V    FY  LW  +L +P VR   + F++ HF+R  S+ +Q Y LG    L + ++   L D  VLVQR +L+ +L+             A+ + R Q+       + +A    LLRRDMSLNRR Y+WL+G ++ +  ++            DL   S  E  +  YF  YSR++L+ A+  I+         + +S  ++PFRII +L+D+SEIG  ++ D+L  +I       +  E L  EA  ++      +  + +   VK   N   E +KT N+    + S + W+Y+ + F   L+ +  PS+  S   ++  +  L+ F+L  +P+E Y+++ ++
Sbjct:    4 EEAELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLKYSLLPRRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLAHAAMSVKPVLLTLYERYFLPLQKALLPSLQAFITGLLPGLEEGLEVYDRTDALLLKLSLLVGQSVFYGALWGSVLVSPLVRLPASLFIVTHFDRMASSCEQKYMLGTDHRLTVKAMCLSLQDSNVLVQRNSLEILLYFFSFGTCLDPEKSAIPLRREQMIT-----VVSAASLTLLRRDMSLNRRLYAWLLGLDI-KGGMVA----------PDLSQYSTVEEHVEYYFNTYSRELLVQALVNILQQKDIEKDPDNVSDYLRPFRIIISLLDKSEIGPLVLSDVLLEVIRAFYS--YCREMLGEEALNSS------LSGNQLNSKVKENKN-ASEIIKTVNMLVGAISSEYLWDYMTKHFQTCLRYKAPPSKAWSPPPSMTELSTLIIFLLDVIPLELYAEIQTQ 495          

HSP 2 Score: 207.223 bits (526), Expect = 1.019e-52
Identity = 124/352 (35.23%), Postives = 198/352 (56.25%), Query Frame = 3
Query: 6255 DVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKR---------------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEET-NYFRSNDMNFQPVFRPFLTLVIDS-YIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++ +L  +  FF  +      WK I+D+L+T +K  FK+    L   Q   L LF S E    Q  M +K+ AF ++S E DQY   +P IQE+L+E+LR+G  P +  Q+FL FRVLL+RIS QHLTSLW    PI+ + L  +   L+  +   K N  NKR               L+MYLSACK LD       + +P F  Y+WAFV  +D ++ +   +  +  +   +P +  +++  + +Y L+  +  +++E +      E PL+  +S+ S+T L PFF T
Sbjct: 1820 DMVYRSDEKEKAVPLISRLMY-YVFPYLKNHSAYNMPSFSAGAQLLSSLSGYAYTKRAWKKEVLELFMDPMFFTMEPACACHWKSIVDHLLTHEKTMFKD----LMSMQSSSLKLFNSAE----QRPMLLKRQAFAMFSGETDQYHLYLPLIQERLTENLRVGQTPAMAAQMFLMFRVLLLRISPQHLTSLW----PIMVTELIRIYARLEKTLLEEKDNSKNKRGGQEKNGLLTFPQAELDMYLSACKFLDTAVSFPPERMPLFQMYRWAFVPEVDVDSYDGPGTTLLEGEQECKPHVVRILEGLHHRYGLNGTVGESTLESI------EFPLLTLRSLSSITQLVPFFQT 2152          

HSP 3 Score: 95.1301 bits (235), Expect = 8.661e-19
Identity = 106/464 (22.84%), Postives = 207/464 (44.61%), Query Frame = 3
Query: 4629 KNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKV-RQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRR----AAQLKLDSDTGDERPGSNEINTDGVI 6002
            +++ +  Y +S P +A   Q + +++    +       +H      +  +L   G+S + ++ PI+ ++CKN+      +E  ++ I  +  +   E N  P DY L+ L  L  + H+ LL++                                K+ + S  T + +A N +++     I ++ +LW     ++  + +     P+    +  K+ +Q IL  + PL + + S ++ S+A VW         +   S+    ++  L   S S           + I++L + L    T   I++  +++++K  P  I      K  +++   V V +L+F   ++ +  +  L      L  LL+ES+  +L P   F+LL IL+DF++++   D KR+ RE+Q++ Q++LE V  +AGSSLEQ SW  R     AQ ++     +E P  N+ N  G +
Sbjct: 1399 QSIKAVRYVSSQPIMA---QGMFVSAAARALCPQYGFAMHPAWVTLLCGTLPFLGRSLAIIVAPIIAQICKNLDELVKQHE--HKSIKSSHSILKRE-NIAP-DYPLTLLEGLTTITHYCLLEQ--------------------------------KKSAGSDATDMRNACNAILEEFPHMISTMAMLWGVVKGADSSHSSSSRSSPASVYFKSTKILKQKILGFLMPLTQLYGSQVMASMAAVW---------NSRRSRKRRSKNKILPAVSDSQ----------MTIVDLVKSLNTLHT-DAILHLVKEVVKK--PNQI------KGDQQKPILVDVPMLQFCYAYIQSLPAQALQDNIMPLLCLLRESVQLNLTPPGHFLLLGILNDFVNRLPNMDNKRDSRELQEVTQRILEAVGGVAGSSLEQTSWLSRNLEVKAQPQICLQEDEEEPEGNDCNGGGAM 1795          

HSP 4 Score: 71.2478 bits (173), Expect = 1.572e-11
Identity = 81/337 (24.04%), Postives = 143/337 (42.43%), Query Frame = 3
Query: 1989 EVYHEICQLVVEMTSYPLYFNVSEKYE----SITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATR---LVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTL----------CISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSL 2948
            + +   C L++E T++P+Y+   E  E      TN+  T         P +L  L+T  C   ++ ++ +A+S+L++LI  ++   LV   KNQ          ++ +S+   LS   +      I P                             +V++ ++ +T F+      LW  L +   + H   V L  RLH  APSA+ICE++I   +L+ +    L+   RF +LW L   +EV   N +++++     R+FD+ +                 VVL +L            SWL +A       +I+ P+LL L+ P T R ++ S+
Sbjct:  678 QAFTAACHLLLECTTFPVYYTEEESQELHSSMFTNTTGTQLYTGCSS-PIYL-SLMTLCCISKDYKVQHVAISSLMELINHSQSLALVIQDKNQ----------RYKSSEANPLSGQLQMVTLPPIYP-----------------------------SVLKTVERQTNFYQRVAQVLWAQLDTERREHHISCVELFYRLHCLAPSAAICEDIICMALLSRDKVVRLEGLHRFSVLWHL--TREVQT-NRSTSLN-----RSFDRSL----------------FVVLDSLNSQDGSVSAAGQSWLVRALSLNDVIRILEPVLLLLVDPRTQRTAIHSV 949          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Cavefish
Match: dop1a (DOP1 leucine zipper like protein A [Source:ZFIN;Acc:ZDB-GENE-050309-65])

HSP 1 Score: 255.373 bits (651), Expect = 2.814e-68
Identity = 130/309 (42.07%), Postives = 191/309 (61.81%), Query Frame = 3
Query: 6240 LASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD----------IKSIKQN-----------DINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFL 7103
            LA ++D+ + S+EKE+V P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   LNLFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQE+L ESLRL  +P +  Q+FL FRVLL+R+S QHLTSLW   I  L  V   +  +L  D          I  ++             +  + LN+YLSACKLLD+   +  +S+PQF  Y+WAF+    +++          Q  F+P++
Sbjct:  776 LAHLLDMVFYSDEKERVIPLLVNIMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDSSCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLNLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQERLVESLRLPQVPILHAQVFLFFRVLLLRMSPQHLTSLWPTMITELVQVFLLMEQELTADEDITRTSGPSIAGLETTYSGGNGFSTSYNSQRWLNLYLSACKLLDLALALPSESLPQFQMYRWAFIPEASDDSGLEVRRQGTHQREFKPYV 1083          

HSP 2 Score: 148.673 bits (374), Expect = 3.783e-35
Identity = 173/773 (22.38%), Postives = 316/773 (40.88%), Query Frame = 3
Query: 3726 NLNDSEYTPSNHYLIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFY-QNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKS-----------------------NNKNDFKLPLPSV-----YKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKIN----LNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            N + S  +PS  + +HPL+ H+LLY  +YDS+  L++LS +  + R+ P   V  +               N+      +  QN    +L+RH  ++ G +FY   P      SF+S   LEI++ +C +F+ S Y         + +D+  N+ +Q+ + E+L  +  E+               VT    K     I  V F +C V K  LHC+ +SI   +K                 DQRVR +          NV  ++ G+    +++  +     DG S                         +  F+L    V      + + S  Y    P   ++ Q + L +++  +       +H      I ++L   G+    V+  +  +LC+N+    NL +        T          +P D  L+ L  + A+ H+ LLD + + +QLQ     S +Q                        H+ +AR  ++ ++   + S+ +LW    L++  +        C   +  +G    +RQ IL ++ P+   H +  + ++A VW    Q                    +A   N  + +     + +++L R +    T T ++ T ++++++          PP +  EK+   ++V +L+F   ++     + L      L  LLK+S+   LP    F+LL +L++FI K    + K++QRE+QD+  K++E +  IAGSSLEQ +W RR  ++K
Sbjct:  100 NASRSCTSPSR-FNVHPLYQHVLLYLQLYDSSRTLHALSAIAAMLRTAPASFVSAIST----------TSINNTYTPQLSLLQN----LLARHRVSVMGKDFYCPIPQDSHSHSFRSAMYLEIVISLCLYFLRSYY---SAHVAATTQDLAGNRSMQLTSVEVLTLLFCELAK-------------VTGASAKGFASFISDVLF-KCKVQKVTLHCLLSSIFSAQKWH---------------DQRVRGS----------NVAAVEEGMTEESIIN--LSEDQLDGCSAVQSQLLRLLQSLVVLEHHVMVPGEEGGFELLGGEVEHVNPQQPMASLQYLPGQP---ITAQGMFLCAVIRALHQHHACKMHPQWISLITATLPYMGRVLRRVVASVTLQLCRNLD---NLIQQYRYETGLTDARPQWMALCIPPDLILTVLEGVTAIIHYCLLDPSSQYHQLQ----VSVDQK-----------------------HLAEARAGILSILHTIMSSVTLLWSVLYLADSSDRPAGAAAACSSSNINLGSTKNLRQQILELLGPISMNHGTHFMAAIAYVWNERKQV-------------------KAPARNKVIPTASEEQLLLVDLVRSVNAMRTET-VMQTVKEVLKQ----------PPAIAKEKKHLSLEVCMLQFFYAYVQRIPVSSLVDSWPSLLALLKDSVQLGLPAPGQFLLLGVLNEFILKNPTLESKKDQRELQDVTHKIVEAIGTIAGSSLEQTTWLRRNLEVK 750          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Cavefish
Match: ENSAMXT00000058128.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:22379001:22384436:-1 gene:ENSAMXG00000030154.1 transcript:ENSAMXT00000058128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 4.695e-52
Identity = 79/141 (56.03%), Postives = 109/141 (77.30%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAF 449
            E+ +   D+K+RN+   VDK LK FEYSSEWADLI+ LGKL K+LQ N ++ ++P+K  +GKRL+QCLHPALP+GVH KALE +++IF IIGP++LA DLF+Y +G+FPLLS +AM +K  L  LYE Y++ LG +++P  
Sbjct:    4 EELELLGDSKYRNYVAAVDKALKNFEYSSEWADLISALGKLNKVLQNNAKYQVVPKKLTIGKRLAQCLHPALPSGVHRKALETYEIIFKIIGPKRLAKDLFLYSSGLFPLLSNAAMSVKPVLLGLYETYYLPLGKTLKPGL 144          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Cavefish
Match: ENSAMXT00000037483.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:22364275:22375882:-1 gene:ENSAMXG00000030687.1 transcript:ENSAMXT00000037483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.495e-13
Identity = 54/210 (25.71%), Postives = 97/210 (46.19%), Query Frame = 3
Query: 1992 VYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKML 2621
             +   CQL +E +S+P+Y  V+E     ++++E      +   P WL  L+ + C   +FSI+++A+S ++DL+  T+ V           +    + +AS                +SP+           ++QG              +++ +  KT FF    L LW+ L  + PQ HQ +V L  +LH   PS+SICE++I Q+++
Sbjct:  295 AFTAACQLFLECSSFPVY--VAEGNMKSSSTREEQADGESILPPAWLQTLMDACCSATDFSIQAVAISLVMDLVGLTQSV-----------AMVTAERVASP----------DSGQPMSPSQGRVAVVIRPPLTQG--------------ILKYIAEKTNFFKSVALILWEQLGESTPQHHQRSVELFYQLHNLVPSSSICEDVISQQLM 467          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Yeast
Match: DOP1 (Golgi-localized, leucine-zipper domain containing protein; involved in endosome to Golgi transport, organization of the ER, establishing cell polarity, and morphogenesis; detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000002548])

HSP 1 Score: 119.783 bits (299), Expect = 3.463e-27
Identity = 134/501 (26.75%), Postives = 208/501 (41.52%), Query Frame = 3
Query:   48 DNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQA------NVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFV-----TLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESV-EPIYFYTCLWQVMLQAPSVRTYGTAFLL-------------------------------NHFNRRLSTDDQLYFLGNSI--------SLMLNSLTQILNDQ-QVLVQRQALDFVLFALSMHRSQLTV----SDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYL 1382
            D+K + F   V++ L+ F+  +EWAD I +LG L+K LQ+      NVR+  +P    V +RL+  L PALPAGVH K LE +  IF  IG   LA +  I+  GI PL++ ++M +++ L  LY+ Y +     TL + IRP        L    +E  +F     K++E   E++ +   F+  L+ VM      R  G  +L                                +H +R+   ++    L  +          L++  L   L D+  +L++R  LD +L  L +    L V     D++ L  +C    L +DMSLNRR ++WL+G               +          S NE    YF KY    L+  +  ++       SE  S +  FRI   +MDR EIG  +I ++   L+                                   S K K N  E+ +KTA  FF N +++  W  L
Sbjct:   18 DSKQKKFRANVERALERFDSVTEWADYIASLGTLLKALQSWSPKFQNVRY-YVPSPYQVSRRLTSSLSPALPAGVHQKTLEVYTYIFEHIGLETLATECNIWIPGILPLMTYASMSVRSHLIELYDNYILLLPQTTLRLLIRPLI---SSLLPGIDDESNDFLPLTLKLIETLQENLDDDSLFWQTLFLVMTANKGRRLGGLTWLTRKFPSLNAVPHLVNKIKMEAEENPSETETNDSHLDRKKRKEEAFKVLLPAAKDLVTPEPGLLIRCLVGCLEDENDILIKRSVLDLLLQRLRLDSPVLNVLITSEDKKLLIMSCCRTTLSKDMSLNRRIWNWLLGPTAGGMLNNNGGNSMEYTTSVK----SANEESNVYFTKYGLSALLEGLSDLL-------SEEESVLTAFRISMAVMDRWEIGSLVIPELFIPLLY---------------------------------SSEKFKQN--EQIMKTARTFFDNTETNIIWGKL 468          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Nematostella
Match: EDO38329 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDA1])

HSP 1 Score: 253.832 bits (647), Expect = 9.136e-69
Identity = 141/369 (38.21%), Postives = 212/369 (57.45%), Query Frame = 3
Query: 6213 QALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLT-VNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDI-------------------NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYN--EKPLIYRQSIHSLTDLAPFF 7253
            QAL +L+  LAS++D+ + SEEK++V   LTSV++ NV PY++     N+ NFR    L+++LS YQ+ RR+WRK++ + + +  FFQ DI  + SW+ IIDNLMTQD+ +FK+   K+    Q   +N+F +KE E +Q A  +KKLAF I+ SE DQY   +PEIQE+L+ESLRL  +P +  Q+FL  RVLL+R+S QHLTSLW + +  +  VL  +  DL  + KS     +                   +K L +YL+ACKLLD+   ++ +++P F  Y+WAF G     T   RS       VF+P +  +      + L       + + + +NL    ++PL+    I S+  L PFF
Sbjct:  689 QALTVLSEVLASLLDMVFGSEEKDRVTTILTSVMY-NVTPYMKNHGPRNVPNFRACCALVSALSGYQYMRRAWRKEVMEQVLDPVFFQMDITCIASWRTIIDNLMTQDRTSFKDLMAKVAGFGQSAAINIFANKEQEIEQRASLLKKLAFAIFCSETDQYQDCLPEIQERLAESLRLAQVPVLHEQVFLALRVLLLRMSPQHLTSLWPVMVSEVVHVLLQMESDLSSEGKSTSSQRLMTSEALFGNNVVHNVTYSQDKWLGLYLAACKLLDLALCLSSEALPHFQMYRWAFEGGDSNATMVTRSKAEKIS-VFKPHIARL------WKLLRKRSRRTADDI-DNLLRAPDRPLLTMYQIKSMDQLLPFF 1048          

HSP 2 Score: 151.754 bits (382), Expect = 1.356e-36
Identity = 170/738 (23.04%), Postives = 323/738 (43.77%), Query Frame = 3
Query: 3750 PSNHY---LIHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQ---IGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYI---AVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPS---WTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRA 5927
            PS+H     +HPL  H L+Y   YD    LY+ + + ++ RS P   V          S++               +Q K+ E+L+RH   L G  FY  P  +   +      LEI++ VC +F+ S Y     G      D+  N +VQ+ ++E+L  IV +++ +++    G+    G F++               F RC V K  LHC+ +++ +    T I   +    N   L +R+      + +R +   L     L   +VL + I+L +S     N +   +P         ST + ++  YI    ++RQS+LL++++  +       LH    QF+I+ L     S S  ++ + +++ + +      Y+   +     KD     + +LP DY  S L  +  +CHF LLD A  S                           +  D   P   +L AR  ++ ++   + ++  +W   S  +      + +P     + +G P  VR  ++ ++ P+   H  + L SLA VW    Q    D     ++    V + +       ++ EQ   + ++++  GLK + +  + I+  + I+R+      +  +  K T    G ++VN+L+F   ++   + ++L+   G L  L+KE +    P A F++L IL  ++ ++ + ++K+ ++E+QD+ Q+++E    +AGSSLE+ +W  R+
Sbjct:    2 PSDHAPKPQVHPLDQHKLVYVLRYDWKLTLYAFNTILSVLRSAPHQFVCAASAHSVSSSNTP--------------HQVKMKELLARHRKCLLGKGFY-GPLYDSPTASAPGMYLEILISVCLYFIRSEY---GVGLDRDAADVDGNAQVQMTSAEVLTSIVWQLVEVVRETGAGF----GPFISD-------------LFTRCKVQKALLHCLVSTLYE---RTGINVPTAGADNGPHL-KRIDGGKTASQLRGLQVKLLKL--LQAIFVLESNIELSES---ITNDSITNVPASPAKLESESTIHQSAQRYIPGRTLARQSMLLSAVLHGL-KYDDYDLHHEWLQFVITCLPHMKGSLSTWVVRVTEQVGRMLEFQTTAYQPLWKHGKTGKD-QIQSMPSLPPDYIASLLEHIGTICHFCLLDGAPSS--------------------------PASVDGPKP---LLGAREGLLSILPSLLSAVFTVWNAWS-PQTFETTGQRLPSESYLYLIGTPKMVRHHVMQLLTPVAMHHTIVFLASLADVW---HQRRRGDSQVQTANKTSKVVVPQ-------ISEEQ---VVVVDIVYGLK-ALSFDNTIDNIKQIVRQ------VVTNKDKSTVTHTG-LEVNILQFFYYYMQRATQSQLTNSRGSLISLMKEGLQLNQPPALFLMLVILQSYVQRLPLQEDKKARKELQDITQRLIEACNTVAGSSLEKAAWLSRS 642          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Nematostella
Match: EDO38328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDA0])

HSP 1 Score: 203.756 bits (517), Expect = 4.200e-56
Identity = 114/226 (50.44%), Postives = 154/226 (68.14%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLN 704
            E+ D  +D+K+R F + VDK LK FEYSSEWADLI+ LGKL K LQ + +F  IPRK  +GKRLSQC HPALP+GVH+KALE +D+IF  +G + L  DLFIY  G+FPLL  +AM +K  L  LYE++F++LG ++ P   GLL GLLPG+EEG+E+  R   +LE  + + +   FYTCLW   L + SVR     F+L+  +R+ S +   Y LG+ I LM++
Sbjct:    4 EELDLLSDSKYRQFISAVDKALKSFEYSSEWADLISALGKLNKALQGHPKFKAIPRKLTIGKRLSQCTHPALPSGVHLKALETYDLIFKRLGKKGLGQDLFIYGAGLFPLLGNAAMSVKPVLMGLYEEHFLSLGKALLPGLQGLLLGLLPGIEEGSEYTERTISLLEAISHNTDRPAFYTCLWSCFLSSSSVRLPAVTFILSRLSRKTSLNKD-YILGDDIPLMVS 228          

HSP 2 Score: 62.7734 bits (151), Expect = 1.374e-9
Identity = 37/115 (32.17%), Postives = 62/115 (53.91%), Query Frame = 3
Query: 1065 TSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRE-----SVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLF 1394
            TS+ ++R ++++PFRI+ +L+DR E+G  I+ED+L  +     +  ++  K+  E             +S   E     S  SKT L +E +KTANL F   +  F W+YL++L 
Sbjct:  275 TSNGAKRSNALRPFRILISLLDRPEVGSAILEDVLIEVF----RALYVQCKVIKEKTPIEELGSYESIESLTAEFENPSSSSSKTKLTDEVVKTANLLFNAFEPYFMWDYLSKLL 385          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Medaka
Match: dop1b (DOP1 leucine zipper like protein B [Source:NCBI gene;Acc:101172207])

HSP 1 Score: 308.916 bits (790), Expect = 8.876e-84
Identity = 317/1217 (26.05%), Postives = 542/1217 (44.54%), Query Frame = 3
Query: 3768 IHPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLIXXXXXXXXXXXXXXXXXXXAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFKSFNNL-EIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSI--------TQPEKTTNILS----DSIMLLNES-GLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKN--LF-----STHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDK----------VRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCD-----IKSIKQNDINKR---------LNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDE------ETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSL-GIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFT 7259
            I  L  HMLLY +      +L  LS L ++FRS      P++E L           S+++L  S A + N +  +L RH  A  G +FY              + L E+++ +C  F+ S YP   +   ++  D+  N++VQ+ +  +L  IV ++                 + K    +++I K+    C + +YAL  +S S+         +P K+   L     +S++ L ++ G +Q      Q+ L++L+  ++ L+Y +    V+S G   +  +  + +      PL   ++   LF     +  Y  S P   ++ Q + +++    +       +H +    + SSL   G+S   ++ P + ++C+N+     L+E        T    S +   +  DY L+ L  L A+ H+ LLD                           +K +    D++     + +ARN +I+ +   + S+  LW    + E++       P    M R             +RQ IL  + PL R H   ++ SL  VW H                      ++    N  L       + I+EL + L    T T I++  +++++K   +           E++   V + +L+F   ++ +  +  L      L  LL++S+  +L P   F+LL IL+DF++++   D K++ +++Q++ Q++LE V  IAGSSLEQ SW  R+ ++K+ S    +    +E   DG                                   E R            ESA   +T+     PS    ++QAL LL   LA ++D+ Y+S+EKEK  P ++ +++  V PYL+  S+ N+ +F   +QL++SLS Y +T+R+W+K++F+L  +  FF  +     SWK I+D+L+T +K  FK+    L   Q   L LF+S E    Q  M +K+ AF ++S ELDQY   +P IQE+L+E+LR+        Q+FL FRVLL+RIS QHLTSLW I +  L      L   L+ +     +  + +  +++          L+MYLSACK LD       + +P F  Y+WAFV  +DE      ET      +        P +  V++   Q Y ++ G+   S E   E L  E PL+ ++S+ S+T L PF  T
Sbjct: 1186 IDSLFRHMLLYPAAGGWRHLLQGLSLLDSLFRS--SAECPLVEAL-----------SSTSLDTSLAPHLNLVSNLLQRHQQAQDGKSFYGGLLSPSSTPSAPPSLLIELLVSLCLLFLRSHYP---SYLSLTPLDLQGNREVQVKSVTVLTRIVNQLCC-------------TAREKEGRNLESIRKI-LSGCKLQQYALLSLSASMYASQKGADREPSKSAEELGGPPEESLVNLGDARGQEQY---PLQIELLKLLHALIVLEYHVWPGGVVSAGQASEPREASTPST-----PLAREWQTAVLFQQSIKAAQYVHSHP---ITAQGMFVSAAARALQPQYGYAMHPHWVSLLCSSLPYLGRSLGIIVTPFISQVCRNLDDLVKLHEHDGG---KTNQSFSGKRENIAPDYPLTLLEGLTAITHYCLLD---------------------------NKKSLVSSDAVD----VRNARNAVIEALPSMLSSMASLW-GVVMREEVKRRPSDSP---QMSRHTSTSVYFKSNKILRQRILEFLLPLTRPHGVQLMASLGVVWSHRR--------------------SKRKHKNQVLPVASEPRMTIVELVKSLNTMQTET-ILHLVKEVVKKPHQIK---------GEQKSTLVDIPMLQFSYAYIQSIPAQALQENVAALLSLLRDSVQLNLAPPGHFLLLGILNDFVNRLPNLDSKKDTKDLQEVTQRILEAVGGIAGSSLEQTSWLSRSLEVKVQSQVCQDAEELDESYVDG-----------------------------------EHR------------ESAAPESTMVSSSAPS--VYSVQALILLAEILAPLLDMVYQSDEKEKAVPLISRLMY-YVFPYLKNHSAYNIPSFEAGAQLLSSLSGYAYTKRAWKKEVFELFMDPLFFTMNSTCAYSWKSIVDHLLTHEKTMFKD----LMSMQSSSLKLFSSAE----QKPMLLKRQAFALFSGELDQYHLYLPLIQERLTETLRMNPTAASSAQMFLMFRVLLLRISSQHLTSLWPIMVTELIRTFTRLEKALQAEKDVSKLAKVVRGALDRNGPVNFSQADLDMYLSACKFLDTSLAFPPERMPLFQMYRWAFVPEVDESCYSGPETTLIEGEEG-----CSPHVVRVLERIEQRYRTINGL---SEESSTERL--EFPLLTQRSLTSITQLLPFLRT 2225          

HSP 2 Score: 308.531 bits (789), Expect = 1.438e-83
Identity = 190/514 (36.96%), Postives = 298/514 (57.98%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVL----FALSMHRSQLTVS----DREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWII--DNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPS----QFPSFQMTIDRICELVKFILIRLPIETYSDVHS 1526
            E+ +  ND ++R++A  ++K L+ FE SSEWADLI++LGKL K LQ+N+R+ ++P++ ++GKRL+QCLHPALP+GVH+KALE ++VIF IIG + LA DLFIY +G+FPLL  SAM +K  L  LYE+YF+ L  ++ P+    + GLLPGLEEG E Y R + +L + +  V    FY  LW  M+  P+VR   + F++ H++R    D Q + LG     ++  +   L D  VLVQR  L+ +L    FA  +  +Q+  +    D   + +A L  +LRRDMSLNRR Y+WL+GA++    +      S  V  +D  S         YF  YS+D+L+ A+  I+   +  ++A   +  +KPFRII +L+D+ EIG  ++  IL +L+       +  E L  E N       + +  + +   +K   N   E +KT N+  ++++S F W Y+ + F  AL ++  P+    Q     ++   + EL+ F+L  LP+E ++D+ S
Sbjct:    4 EELELQNDYRYRSYAAVIEKALRNFESSSEWADLISSLGKLNKALQSNLRYSLLPKRLIIGKRLAQCLHPALPSGVHLKALETYEVIFKIIGTKWLAKDLFIYSSGLFPLLGQSAMAVKPVLLTLYERYFLPLQRALMPSLQAFITGLLPGLEEGLEVYDRTDALLVKLSFLVGQQVFYCALWGSMVVTPTVRLPASTFIVTHYDRMTPLDRQTHMLGYGHHAVVKPICLALQDSNVLVQRNMLEVLLYFFPFATCLDPAQVAATLANEDLITVVSAALLTILRRDMSLNRRLYAWLLGADIKGGMVAPHPSLSTTV--EDHSSF--------YFNTYSKDLLVKAMINILKQKDVDTAAESVVCYLKPFRIIISLLDKPEIGPAVLNCILLDLVRAFHS--YCREALGEENN-------SKLSGNRLASKIKENKN-ASEIIKTVNMLVSSMNSEFLWEYMTQRFCIALSEKNPPASPEQQTALHALSATEMSELIIFLLEVLPLELHADIQS 497          

HSP 3 Score: 73.1738 bits (178), Expect = 4.097e-12
Identity = 80/310 (25.81%), Postives = 134/310 (43.23%), Query Frame = 3
Query: 2010 QLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISL 2939
             L++E T++P+Y++  E   ++          +   +P WL  L+   C   +  I+  A+++LL+LI                 SQ++   I  K R          SSDI+P S          +                 +++ ++  T F+      LW  L +   + H   V+L  RLH  AP+ SICE++I Q +L  +    LD+  RF +LW L   +EV   N   ++S     R+FD+ + V+++SL  +     G +     C  WL +A       +I+ P+LL LL P T R S+
Sbjct:  759 HLMLECTTFPVYYS-EEDTLALHTDMFGPAGSSEASIPVWLRSLMILCCMSRDCFIQHTAVASLLELIN---------------HSQSLALVIQDKHR-------RYQSSDINPLSGRLQMVTMPPI--------------YPALLQAMEENTDFYQRVAHVLWSQLDTERREHHVSCVDLFYRLHCLAPTTSICEDIICQALLHKDKAVRLDALHRFTVLWHL--TREVQT-NRTMSVS-----RSFDRSLCVVVNSLSSA----DGSISAAAQC--WLVRALSLNDVLRILEPILLFLLHPSTQRRSI 1017          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Medaka
Match: ENSORLT00000002497.2 (pep primary_assembly:ASM223467v1:16:4428243:4432549:1 gene:ENSORLG00000002001.2 transcript:ENSORLT00000002497.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 4.191e-46
Identity = 86/181 (47.51%), Postives = 124/181 (68.51%), Query Frame = 3
Query: 6186 TPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSE 6728
            TPS    ++ AL LL   LA ++D+ + S+EKEKV P L +++   V+PYLR  S+ N  ++R   QL++SLS YQ+TRR+W+K+ FDL  +  FFQ D   +  W+ IID+LMT DK TF++  T++ V Q   L+LFT+++AE +Q AM +K+LAF IYSSE+DQY K +P+IQ K S 
Sbjct:  210 TPS--VYSVHALTLLAKVLAHLLDMVFYSDEKEKVIPLLINIMH-YVVPYLRNHSAHNAPSYRACIQLLSSLSGYQYTRRAWKKEAFDLFMDHTFFQMDASCVSHWRAIIDHLMTHDKTTFRDLMTRVAVAQSSSLSLFTNRDAELEQRAMLLKRLAFTIYSSEVDQYQKYLPDIQGKHSH 387          

HSP 2 Score: 75.485 bits (184), Expect = 2.619e-13
Identity = 49/154 (31.82%), Postives = 86/154 (55.84%), Query Frame = 3
Query: 5484 ICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLT-EKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESIS-SLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLK 5939
            + ++EL R +    T T +I T ++++++          PP +  +K+   ++V +L+F   ++     + L      L  LLK+S+   LP    F++L IL++FI K    + K++QRE+QD+  KV+E +  IAGSSLEQ +W RR  ++K
Sbjct:   38 LLLVELVRSVSAMRTET-VIQTVKEVLKQ----------PPAIAKDKKHLSLEVCMLQFFYAYVQRIPVSSLVDSWQPLLVLLKDSVQLGLPAPGQFLILGILNEFILKNPNLESKKDQRELQDVTHKVVEAIGTIAGSSLEQTTWLRRNLEVK 180          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Medaka
Match: ENSORLT00000002494.2 (pep primary_assembly:ASM223467v1:16:4414772:4422418:1 gene:ENSORLG00000022489.1 transcript:ENSORLT00000002494.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.493e-15
Identity = 75/308 (24.35%), Postives = 132/308 (42.86%), Query Frame = 3
Query: 1707 TSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREF-TRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISP--NSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKML 2621
            T  ST R       +S L       VM   + +F++F +R   ++++    DQ       L      +      + A +E        ++    V  +   CQL +E +S+P+Y  ++E     + + E  +      LP WL  L+ + C  N+FS++  A+S L+DLI  T+                          S++  T    +S IS   ++  T+PS  +          ++   L++ +++ +  +T FF    L LW  LS   PQ HQ +V L  +LH   PS+SICE++I Q+++
Sbjct:  213 TPPSTLRA---GARSSGLCQPLDKPVMQCCLEHFQQFLSRLIILYIIPGQVDQSEGQGGELMDPFPLEGSPYCDSHAALE--------TIPRDFVAAFTAACQLFLECSSFPVY--IAEGNLKSSPTLEEPFDTEEVRLPVWLQTLMDACCLANDFSLQGAAISLLMDLIGLTQ--------------------------SVAMVTAESVASGISSFDSTQTTSPSQGR-------VAVIIRPPLTQGILKHIAERTDFFKSVALILWHQLSEGTPQHHQRSVELFYQLHNLVPSSSICEDVISQQLM 474          
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Medaka
Match: ENSORLT00000040938.1 (pep primary_assembly:ASM223467v1:16:4408074:4435072:1 gene:ENSORLG00000025627.1 transcript:ENSORLT00000040938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 3.289e-6
Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = 3
Query:   27 EDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLIT 134
            E+ +  +D+K+RN+   VDK LK FEYSSEWADLI+
Sbjct:    4 EEVELLSDSKYRNYVAAVDKALKNFEYSSEWADLIS 39          
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Match: SMESG000074794.1 (SMESG000074794.1)

HSP 1 Score: 2281.91 bits (5912), Expect = 0.000e+0
Identity = 1227/1245 (98.55%), Postives = 1230/1245 (98.80%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSEPLVRSHXXXXXXXXXXXXXXXXXXXXPLDESEISSDSDGKVSIKDYNRKHMKLTIPEEEYDSCSDDELPLTFERINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPS 3755
            MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGI+IRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASK              DISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSE LVRSHLLKQSNLTNNKNLNVNLHINPLDESEISSDSDGKVSIKDYNRK+MKLTIPEEEYDSCSDDELPLTFERINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTP+
Sbjct:    1 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGIAIRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASK--------------DISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSESLVRSHLLKQSNLTNNKNLNVNLHINPLDESEISSDSDGKVSIKDYNRKYMKLTIPEEEYDSCSDDELPLTFERINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPA 1231          
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2251.09 bits (5832), Expect = 0.000e+0
Identity = 1114/1115 (99.91%), Postives = 1114/1115 (99.91%), Query Frame = 3
Query: 4095 MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7439
            MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1115          
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2248.4 bits (5825), Expect = 0.000e+0
Identity = 1113/1114 (99.91%), Postives = 1113/1114 (99.91%), Query Frame = 3
Query: 4098 MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7439
            MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1114          
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Match: SMESG000074793.1 (SMESG000074793.1)

HSP 1 Score: 2232.99 bits (5785), Expect = 0.000e+0
Identity = 1107/1108 (99.91%), Postives = 1107/1108 (99.91%), Query Frame = 3
Query: 4116 MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMXXXXXXXXXXXXXXXXSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 7439
            MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLD RVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP
Sbjct:    1 MCSCYPGTDTGFKVSFEDIFENKKVQILASEILDFIVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHCMSTSITQPEKTTNILSDSIMLLNESGLDHRVRDAAQVNLMRLVLNVLKLDYGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPYIAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMPIVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLKAVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPGTHILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRPDKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQDVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRKSFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLFGLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLENVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTNETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMATINIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFPNVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYFFQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAEYDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQIFLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDINKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSNDMNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQSIHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGRFFNFENEVEMILDNEFVEPINKP 1108          
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Match: SMESG000074794.1 (SMESG000074794.1)

HSP 1 Score: 1978.76 bits (5125), Expect = 0.000e+0
Identity = 1054/1070 (98.50%), Postives = 1055/1070 (98.60%), Query Frame = 3
Query:   21 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVXXXXXXXXXXXXXXXFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKXXXXXXXXXXRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHXXXXXXXXXXXXVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGXXXXXXXXXXXXETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCXXXXXXXXXXXXXXNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVXXXXXXXXXXXXXXEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSEPL 3230
            MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGI+IRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASK              DISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSE L
Sbjct:    1 MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQANVRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLADDLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGIAIRPAFVGLLQGLLPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTAFLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVLFALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRANLIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTSSASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKLTSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFFWNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDVHSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTFDVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFTRKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLSVDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDLPQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQNMKKHIASK--------------DISPNSYNTNPSANKDVSQGSSNLNVVLSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHKTAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNSNISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDGHAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENSAIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTFEVTRKSKSSNIVKGVNSESL 1056          

HSP 2 Score: 213.386 bits (542), Expect = 2.614e-55
Identity = 103/104 (99.04%), Postives = 104/104 (100.00%), Query Frame = 3
Query: 3444 RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPS 3755
            RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTP+
Sbjct: 1057 RINELNSENNWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYLEDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPA 1160          
The following BLAST results are available for this feature:
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOP1A1.216e-10926.83DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.216e-10926.83DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.590e-10926.83DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1B8.859e-8136.82DOP1 leucine zipper like protein B [Source:HGNC Sy... [more]
DOP1B5.530e-4751.06DOP1 leucine zipper like protein B [Source:HGNC Sy... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pad-14.540e-7424.39pep chromosome:WBcel235:I:12878595:12902806:1 gene... [more]
pad-14.540e-7424.39pep chromosome:WBcel235:I:12878639:12902806:1 gene... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG150999.453e-8536.58gene:FBgn0034400 transcript:FBtr0086628[more]
CG150991.107e-8436.58gene:FBgn0034400 transcript:FBtr0330054[more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dop1a1.725e-10039.42DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
dop1b3.710e-8634.77DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1b1.617e-7825.78DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1b1.613e-4853.19DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1a1.510e-4447.16DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOP1A4.455e-9939.49DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.459e-9739.14DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.813e-9739.14DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A2.798e-9738.99DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
DOP1A1.772e-9638.48DOP1 leucine zipper like protein A [Source:HGNC Sy... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1a9.076e-10926.89DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a9.076e-10926.89DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a5.157e-10639.06DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1a8.384e-9838.25DOP1 leucine zipper like protein A [Source:MGI Sym... [more]
Dop1b4.325e-8725.08DOP1 leucine zipper like protein B [Source:MGI Sym... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5JWR5|DOP1_HUMAN7.638e-10926.83Protein dopey-1 OS=Homo sapiens OX=9606 GN=DOP1A P... [more]
sp|Q8BL99|DOP1_MOUSE8.986e-9838.75Protein dopey-1 OS=Mus musculus OX=10090 GN=Dop1a ... [more]
sp|Q642P2|DOP2_XENLA5.892e-8725.87Protein dopey-2 OS=Xenopus laevis OX=8355 GN=dop1b... [more]
sp|A1ZBE8|DOP1_DROME9.476e-8436.58Protein dopey-1 homolog OS=Drosophila melanogaster... [more]
sp|Q292H2|DOP1_DROPS1.424e-8235.84Protein dopey-1 homolog OS=Drosophila pseudoobscur... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KC144.091e-14230.69Dopey_N domain-containing protein OS=Biomphalaria ... [more]
A0A2C9KBX06.919e-14130.37Dopey_N domain-containing protein OS=Biomphalaria ... [more]
A0A2C9KBX39.368e-14130.24Dopey_N domain-containing protein OS=Biomphalaria ... [more]
A0A2C9KBU52.245e-14030.24Dopey_N domain-containing protein OS=Biomphalaria ... [more]
A0A2C9KBX21.388e-13930.28Dopey_N domain-containing protein OS=Biomphalaria ... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dop1b7.415e-8236.17DOP1 leucine zipper like protein B [Source:ZFIN;Ac... [more]
dop1a2.814e-6842.07DOP1 leucine zipper like protein A [Source:ZFIN;Ac... [more]
ENSAMXT00000058128.14.695e-5256.03pep primary_assembly:Astyanax_mexicanus-2.0:17:223... [more]
ENSAMXT00000037483.11.495e-1325.71pep primary_assembly:Astyanax_mexicanus-2.0:17:223... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DOP13.463e-2726.75Golgi-localized, leucine-zipper domain containing ... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO383299.136e-6938.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383284.200e-5650.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dop1b8.876e-8426.05DOP1 leucine zipper like protein B [Source:NCBI ge... [more]
ENSORLT00000002497.24.191e-4647.51pep primary_assembly:ASM223467v1:16:4428243:443254... [more]
ENSORLT00000002494.21.493e-1524.35pep primary_assembly:ASM223467v1:16:4414772:442241... [more]
ENSORLT00000040938.13.289e-658.33pep primary_assembly:ASM223467v1:16:4408074:443507... [more]
back to top
BLAST of DOP1 leucine zipper like protein A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074794.10.000e+098.55SMESG000074794.1[more]
SMESG000074793.10.000e+099.91SMESG000074793.1[more]
SMESG000074793.10.000e+099.91SMESG000074793.1[more]
SMESG000074793.10.000e+099.91SMESG000074793.1[more]
SMESG000074794.12.614e-5598.50SMESG000074794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010714 ID=SMED30010714|Name=DOP1 leucine zipper like protein A|organism=Schmidtea mediterranea sexual|type=transcript|length=7506bp
CTATATAAATCTTATATGAAATGATTGAAGATCAAGATTTCTCAAATGAT
AATAAATTTCGTAATTTTGCAAATCAAGTGGATAAATGTTTAAAAGGATT
CGAATATTCATCTGAATGGGCAGATTTAATAACAAATTTAGGAAAATTAA
TTAAATTATTACAAGCTAATGTTCGGTTCGGAATTATTCCCCGAAAACAA
TTAGTTGGTAAAAGATTATCTCAATGTCTTCATCCAGCATTGCCTGCTGG
TGTTCACATAAAAGCACTAGAATGCTTTGATGTTATTTTTTCCATAATTG
GACCTCGCAAATTAGCGGATGATCTATTCATTTATTGCAATGGCATATTT
CCACTTTTGTCTCCATCCGCCATGCATATAAAAACTCCGTTGTTTAATCT
ATACGAAAAATACTTTGTTACTCTAGGAATATCCATTCGCCCGGCATTCG
TTGGATTGTTACAAGGACTACTACCAGGCTTGGAAGAAGGAGCTGAATTT
TACACTAGAGGAAATAAGATATTAGAACAATTTACCGAGTCTGTAGAACC
AATTTATTTTTATACTTGTCTGTGGCAAGTAATGTTACAGGCTCCAAGCG
TACGGACATACGGAACAGCGTTTCTGTTGAACCATTTCAATCGTAGGTTA
TCAACAGATGATCAATTATATTTCTTGGGTAATAGTATTAGTTTAATGTT
GAATTCCTTGACACAAATTTTGAATGATCAACAAGTTTTAGTGCAGCGAC
AAGCTTTAGATTTTGTTTTATTTGCTCTAAGCATGCATCGCAGTCAGCTG
ACTGTTTCTGACCGTGAAAAGCTTTGCGCTGCTTGTCTTGCAGTCTTATT
GAGAAGAGACATGTCACTTAACAGAAGGTTTTATAGCTGGTTAATGGGCG
CAAATCTTGATCGGGCTAATCTTATCAAATTTGTTGTTGAAAGTGACAAT
GTTCATCAAAAGGATCTAGAAAGTTTATCCGAAAATGAATTACAATTGAG
ATATTTCAAAAAGTATTCCAGAGATATTCTGATTGCCGCTATTAAATGGA
TCATCGACAACCCAACATCTTCCGCAAGTGAACGAATTTCTTCTATTAAA
CCGTTTCGTATCATTACAACACTAATGGATCGTTCCGAAATCGGCGGTGA
CATTATTGAAGATATACTTTTCAACTTGATCGTTTACCTGGAAAAAGAAT
ACTTCATATTAGAAAAACTAACTTCTGAGGCAAATAAAACAACCAATTTC
CATCCCACTAATATTCGAGATTCCACGATTCGTGAATCGGTCAAAAGTAA
GACAAATTTACAAGAGGAATTTCTGAAAACGGCAAATTTATTTTTTGCAA
ATCTCGATAGTAGTTTCTTTTGGAACTATTTAAATAGATTGTTTGTGAAA
GCTCTGAAACAAGAAGTAACCCCATCACAATTTCCTAGCTTTCAAATGAC
AATAGACCGAATTTGTGAGCTGGTGAAATTTATTTTAATAAGGCTTCCAA
TTGAAACTTATTCGGATGTCCATAGTCGCCATTTACCAGATTTATTGGCT
AGTTTAACAGATTTGTTAGTTGAACATGTTCCCAATTTAGGGATACACAA
TATAAAGATGATTCTGCAAGTCTATCGAATGATCTTTGAAAAAATATTTC
AGAACGCATCTCAGACTTTCGATGTGAGTACCTTACACAACCCGGTATCA
ATCCCTACTTCCAATTCCACCGCAAGAAAACCATCTTTGGCCATGTACAC
TTCCAACTTAACCAGTTACAATAGTTCAAAGGTCATGGTTCGTACAATTC
ATAATTTCCGAGAGTTTACTCGTAAATTCTTTGTTTTCGTTTTGGATTGT
TCCAATGATCAGATTTCTCAATGTGCAAACAGCCTATTTTCGCAGAATAC
TAAAAAAAGTCGAGTAGAAAAGTTAAACAAAGCCGAAATGGAGTACAATA
GTCTAAAGTTGCCGTTATCTGTTGATTTAATTGTCGTAGAGGTTTATCAC
GAAATCTGTCAGCTGGTCGTTGAAATGACTTCGTATCCACTTTATTTCAA
CGTGTCAGAAAAATATGAAAGTATTACAAACTCTCAAGAAACTATGTATA
AGGTAAATAATCACGATTTACCACAATGGCTTGTTTGTCTAATCACCTCA
GCTTGCTTCATAAATGAATTTTCTATCAAATCTATTGCGATGTCAGCCTT
GTTAGATTTGATTTACGCAACTCGATTAGTCTATGGCCATAAAAACCAAC
CAATTTCAATAAAATCACAAAATATGAAAAAACATATCGCCTCCAAAGGT
CGGTCACTATCATTTTCGACTGAAAATAAAGACAGTTCAGATATTTCACC
TAATTCATATAATACCAATCCCAGTGCAAATAAAGACGTTTCTCAAGGGT
CATCTAATCTCAATGTGGTTTTATCGCTTCTATCAGAAACAGTTATTGAA
GAATTGGACAATAAAACGAAATTTTTCACTCTTGCTGGCTTATCGCTATG
GGATTACTTGTCATCAAATTATCCTCAATGTCACCAAGTTACAGTTAATC
TAATAAATCGACTTCACAAAACCGCTCCATCCGCAAGCATATGTGAAGAA
TTAATTTTGCAGAAAATGCTCACTGATAACTTGGAAGAATGCTTGGATTC
GCATCGTCGATTTATTCTTTTGTGGCAATTACTGGCCAAACAGGAAGTTT
CAATATTCAATGATAACTCAAATATATCTTCACTGGGAAGCATGAGAACA
TTCGATAAATGCGTGCTGGTTCTCCTTGACAGTCTAGACCATTCATCAGA
TTCTAACCATGGGCTGGTTGTGTTGAGAACGCTGTGTATAAGCTGGCTTG
AAAAAGCATTTCAAGACGGGCATGCCCATAAAATTGTGAACCCATTATTA
TTGGCATTATTAAAACCGGACACCGCTAGAATTTCCTTGCCAAGTCTTGT
CAACTTATCATCATCAAAGAGATCAAAACAGTTATCACGAAATGAAATTT
GTGAAGAAGCTGAGAATTCTGCAATAGCCTTGGAAGAGAAAAGAATCTAT
GCGATCAGTAATGAGAATGGAAATGTCAAATATCATTTGAAACCGAATTC
AATTGGAACTCAATCAAATAACAGTGATTCTTCACAGAAAGTTCAACCGG
TATCTTTGATCCAAACCTTTGAAGTGACAAGAAAATCTAAATCATCAAAT
ATAGTTAAAGGTGTTAACTCGGAACCTCTTGTAAGATCTCATTTACTTAA
ACAATCTAACTTAACTAACAATAAAAATCTTAATGTTAATTTACACATAA
ATCCATTGGATGAGTCTGAGATTTCGTCGGACAGCGATGGGAAAGTGAGC
ATCAAAGATTATAATAGAAAACATATGAAATTGACTATACCTGAAGAAGA
ATACGATAGTTGTTCAGACGATGAGTTGCCATTAACATTTGAGCGTATCA
ATGAGCTGAATTCAGAAAACAACTGGTCAGACGCTAATTTTAATGGGAAC
TCGAAATTTCTCTCCAGCGATTCCATGGAATCAAATGTTAAAGTATCTAT
GGAAAAAGTCATTACAAATGTGCTATCTGGAAAAGAAACCTCAGGAAATC
TGGAAAACGATTCGTATTTGGAAGATGATGTGTTACACCAAGTCGAAAAT
TCGAATCCCGTGGATTTTGCAATAGACCCAACAGAATTATGTGAAGAAAT
AACAGAATCCGGGAATCAAGAAATTAATTTAAATGATAGTGAATATACTC
CCAGCAACCATTATTTAATACATCCTCTCCATAGTCATATGTTGCTCTAT
TGTTCCATTTATGACTCGAATGGGGTTTTATATTCTCTTTCAAAATTACG
AACTATTTTTCGTTCTTTGCCGGGAATCGTTGTTCCAGTTTTAGAAAATT
TGATATCTCTTGATTCTGATTCCGAAAGCAATAAATCTAATAGTAACTTA
CCGAAGTCAAAGGCGTTTTATCAAAATAAAATACTGGAAATTTTGTCGAG
ACATTCCAATGCTCTAAAAGGCAATAATTTTTATCAAAATCCAACATTGG
AAGAGATACAATCCTTCAAGAGCTTCAATAATTTGGAAATAATTATGATG
GTATGTACATGGTTTATGTGTTCCTGTTATCCGGGAACAGATACCGGATT
TAAAGTCTCATTTGAAGATATATTCGAAAATAAAAAGGTTCAAATTCTCG
CATCGGAAATTTTGGATTTTATCGTACAGGAAATGTTGACAATCCTTCAA
ATCGGCTACATTAACCACCGGGGTGATTTTGTAACTCAACCAAAAACTAA
ATTAGAAATAAAAAATATTTTCAAAGTCTCCTTTGATCGCTGTAATGTTG
CAAAATATGCGCTCCATTGCATGTCAACCTCAATCACTCAACCGGAAAAA
ACGACTAACATCTTATCGGATTCTATTATGTTATTAAATGAAAGTGGTCT
AGATCAAAGGGTCCGTGACGCAGCTCAAGTCAATTTGATGAGACTCGTTC
TTAATGTTTTGAAACTTGACTATGGACTCAATACAAGTTATGTTTTATCG
AATGGGATTAAATTAAAAGATTCTGATGGAAAATCCAATAATAAAAATGA
TTTCAAACTTCCATTACCTTCTGTATATAAAAACTTGTTTTCAACTCATT
ATACAACATCCAGTCCATACATAGCCGTTTCCAGACAATCTATATTGTTA
ACCTCAATTGTCGCTTGTATTGGAGCTATGAAACTGCGACACCTACATTC
CTATTGCTATCAATTCATTATCAGCTCTCTTGGAGTTTGGGGCAAAAGTA
CTAGTGCGGTGTTAATGCCAATTGTGAAAAAGTTGTGTAAAAATATCAGA
TTAGCAGCAAATCTTTATGAATCCTGCAATCAAATCATTCCATACACAAA
AGATGTTGACTCTAATGAAATAAATACTTTGCCCTTGGATTATTCCCTGA
GTACCTTATTATGTCTGAAAGCGGTTTGTCATTTTCTGTTATTGGACGAA
GCATTAAAAAGTTATCAATTACAAGAGGAAAAAGGATCTTCATCAGAACA
AAGTTTCCTTGGAGCGTTGTTTAATAAATCAAAAGACAACACATCGAAAG
AAGACTCCATGAGTCCTGGAACGCATATTCTTGATGCCAGGAATAAAATG
ATCAAGCTGATGTCTAGATTCATAGATAGCTTGTTGATATTATGGGAAAA
ATCTTCTCTATCTGAGAAAATCAACCTCAATCAAGAATGTATCCCACCAA
GCTGGACAATGGGACGCCCAGATAAAGTCAGACAAATGATTCTAAGCATC
ATCAAACCTCTTATGCGACAACACCCTTCAATAATTCTCATTAGTCTGGC
AAGAGTTTGGCCACATCTTGACCAATTCGTTTTAGTCGATGGGAATTTTT
CTCAGTCGGATCTAATTCAAGATGTTTGTTTAAATGAAGCGTCAACATCA
AATTCTAATTTGAATTCCGAGCAATTTCGAGTCATTTGTATATTGGAATT
GGCACGAGGTTTGAAAAAATCGTTCACAATAACGCATATAATTAACACAT
GCCGAGATATTATCCGCAAATCTTTCCCTGTAAGTATTTTAGCCAATTCT
CCACCCAAATTAACTGAAAAAGAAGAAGGACAAGTCAAAGTTAATTTGTT
GGAATTCCTTCAGTGTTTCTTGATCACCGGTTCATCGACGAAATTATCAT
TAATCAGTGGATGCTTATTCGGACTGTTAAAAGAAAGCATATCCAGTCTC
CCTCCAACCGCAGCCTTCATTCTATTAAAAATTCTCAGTGATTTTATCAG
TAAAGTTTCTATTTCCGATGAAAAAAGAGAACAAAGAGAAATCCAAGATC
TTTGTCAAAAGGTCTTAGAAAATGTTGCTTTAATCGCAGGTTCATCTTTG
GAACAACCGTCTTGGTTTAGAAGGGCAGCTCAATTGAAATTAGATAGTGA
TACTGGCGATGAACGGCCAGGAAGCAACGAAATCAACACCGATGGCGTTA
TTGCTCCGATGAACACCAATGAAACTACGGATATTACTAATGAAATAAAT
AATGTTACATCCGGTCAATTAAATGGGAGTCGATTCGGTTCAACCGCAAT
AGAGTTTCGAGGATCTCGTAATTCTTTACCCGCACTTGCTCAGAACGAAT
CTGCTTATAAAATGGCAACTATTAATATTAGATGTACACCTTCCTCGAAA
ACTCTGACTTTGCAAGCGTTAAATCTATTAACTATGCACCTTGCATCAAT
AATCGACGTGACATACAAAAGTGAAGAAAAAGAAAAAGTACAACCGTTTT
TGACGTCTGTGATATTCCCAAACGTTTTACCGTATCTGCGTTATCGAAGT
TCTGGAAATCTTCTTAATTTTCGGATTTCTAGCCAGCTAATGGCTTCCCT
TAGTAGTTATCAGCACACGAGAAGATCTTGGAGGAAAGATATTTTTGATT
TGCTTTTCGAATCATATTTCTTTCAATTTGACATTATTTCTTTGAAATCT
TGGAAGGTTATTATAGATAATCTGATGACTCAAGATAAAAATACTTTTAA
AGAAGCTTACACCAAGTTAACTGTGAATCAAGGAGGCGGCCTCAACCTTT
TCACCAGTAAAGAAGCAGAATACGACCAAACTGCGATGTGCATGAAGAAA
TTGGCATTTATCATATACAGTAGTGAACTAGATCAGTATGTCAAATCAAT
GCCTGAAATTCAAGAAAAATTGAGTGAATCATTGAGATTAGGAATGATTC
CTCAAATAGAAACTCAAATATTTCTCTGTTTTAGAGTTTTATTAATGCGA
ATTTCCCATCAACATTTGACATCATTGTGGCATATCTTTATACCAATACT
AACATCTGTCCTTCAAAATCTTATTGATGATCTCAAATGCGATATAAAAT
CTATTAAACAGAATGATATCAACAAACGATTGAATATGTATCTTTCAGCA
TGTAAACTGTTGGATATAATTTTTTTGATGAATGAAGACAGTGTTCCACA
ATTTTTATATTACAAATGGGCTTTCGTCGGAAATTTAGATGAAGAAACTA
ACTACTTCCGGTCAAATGATATGAATTTTCAGCCCGTTTTTAGACCATTC
TTAACGCTGGTTATAGATTCTTATATCCAATATTATTTGTCATTGGGCAT
TCCTCTAAATTCAATAGAAGTTGTGTACGAAAATTTATACAATGAAAAAC
CTTTGATTTATCGTCAGTCAATTCATTCATTAACGGATCTTGCCCCATTC
TTTTTCACAGCTTCTTTAAGAAATGATCTCAATCAAGAAGCAAGAGCTAC
TCAATACGGAATAACAGTTGTCAATGAAAAGGATATCAATGCTGATTGTA
ACAATAACTCTTGTGGCAGATTTTTCAATTTTGAAAATGAAGTGGAAATG
ATCCTTGACAATGAATTTGTTGAACCAATAAATAAACCCTGATTATGATG
CTGCAATTTTTCATTTTCAACTGATTTTATGCTTTATTTAATGTGTTAAT
ATCGTT
back to top

protein sequence of SMED30010714-orf-1

>SMED30010714-orf-1 ID=SMED30010714-orf-1|Name=SMED30010714-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2474bp
MIEDQDFSNDNKFRNFANQVDKCLKGFEYSSEWADLITNLGKLIKLLQAN
VRFGIIPRKQLVGKRLSQCLHPALPAGVHIKALECFDVIFSIIGPRKLAD
DLFIYCNGIFPLLSPSAMHIKTPLFNLYEKYFVTLGISIRPAFVGLLQGL
LPGLEEGAEFYTRGNKILEQFTESVEPIYFYTCLWQVMLQAPSVRTYGTA
FLLNHFNRRLSTDDQLYFLGNSISLMLNSLTQILNDQQVLVQRQALDFVL
FALSMHRSQLTVSDREKLCAACLAVLLRRDMSLNRRFYSWLMGANLDRAN
LIKFVVESDNVHQKDLESLSENELQLRYFKKYSRDILIAAIKWIIDNPTS
SASERISSIKPFRIITTLMDRSEIGGDIIEDILFNLIVYLEKEYFILEKL
TSEANKTTNFHPTNIRDSTIRESVKSKTNLQEEFLKTANLFFANLDSSFF
WNYLNRLFVKALKQEVTPSQFPSFQMTIDRICELVKFILIRLPIETYSDV
HSRHLPDLLASLTDLLVEHVPNLGIHNIKMILQVYRMIFEKIFQNASQTF
DVSTLHNPVSIPTSNSTARKPSLAMYTSNLTSYNSSKVMVRTIHNFREFT
RKFFVFVLDCSNDQISQCANSLFSQNTKKSRVEKLNKAEMEYNSLKLPLS
VDLIVVEVYHEICQLVVEMTSYPLYFNVSEKYESITNSQETMYKVNNHDL
PQWLVCLITSACFINEFSIKSIAMSALLDLIYATRLVYGHKNQPISIKSQ
NMKKHIASKGRSLSFSTENKDSSDISPNSYNTNPSANKDVSQGSSNLNVV
LSLLSETVIEELDNKTKFFTLAGLSLWDYLSSNYPQCHQVTVNLINRLHK
TAPSASICEELILQKMLTDNLEECLDSHRRFILLWQLLAKQEVSIFNDNS
NISSLGSMRTFDKCVLVLLDSLDHSSDSNHGLVVLRTLCISWLEKAFQDG
HAHKIVNPLLLALLKPDTARISLPSLVNLSSSKRSKQLSRNEICEEAENS
AIALEEKRIYAISNENGNVKYHLKPNSIGTQSNNSDSSQKVQPVSLIQTF
EVTRKSKSSNIVKGVNSEPLVRSHLLKQSNLTNNKNLNVNLHINPLDESE
ISSDSDGKVSIKDYNRKHMKLTIPEEEYDSCSDDELPLTFERINELNSEN
NWSDANFNGNSKFLSSDSMESNVKVSMEKVITNVLSGKETSGNLENDSYL
EDDVLHQVENSNPVDFAIDPTELCEEITESGNQEINLNDSEYTPSNHYLI
HPLHSHMLLYCSIYDSNGVLYSLSKLRTIFRSLPGIVVPVLENLISLDSD
SESNKSNSNLPKSKAFYQNKILEILSRHSNALKGNNFYQNPTLEEIQSFK
SFNNLEIIMMVCTWFMCSCYPGTDTGFKVSFEDIFENKKVQILASEILDF
IVQEMLTILQIGYINHRGDFVTQPKTKLEIKNIFKVSFDRCNVAKYALHC
MSTSITQPEKTTNILSDSIMLLNESGLDQRVRDAAQVNLMRLVLNVLKLD
YGLNTSYVLSNGIKLKDSDGKSNNKNDFKLPLPSVYKNLFSTHYTTSSPY
IAVSRQSILLTSIVACIGAMKLRHLHSYCYQFIISSLGVWGKSTSAVLMP
IVKKLCKNIRLAANLYESCNQIIPYTKDVDSNEINTLPLDYSLSTLLCLK
AVCHFLLLDEALKSYQLQEEKGSSSEQSFLGALFNKSKDNTSKEDSMSPG
THILDARNKMIKLMSRFIDSLLILWEKSSLSEKINLNQECIPPSWTMGRP
DKVRQMILSIIKPLMRQHPSIILISLARVWPHLDQFVLVDGNFSQSDLIQ
DVCLNEASTSNSNLNSEQFRVICILELARGLKKSFTITHIINTCRDIIRK
SFPVSILANSPPKLTEKEEGQVKVNLLEFLQCFLITGSSTKLSLISGCLF
GLLKESISSLPPTAAFILLKILSDFISKVSISDEKREQREIQDLCQKVLE
NVALIAGSSLEQPSWFRRAAQLKLDSDTGDERPGSNEINTDGVIAPMNTN
ETTDITNEINNVTSGQLNGSRFGSTAIEFRGSRNSLPALAQNESAYKMAT
INIRCTPSSKTLTLQALNLLTMHLASIIDVTYKSEEKEKVQPFLTSVIFP
NVLPYLRYRSSGNLLNFRISSQLMASLSSYQHTRRSWRKDIFDLLFESYF
FQFDIISLKSWKVIIDNLMTQDKNTFKEAYTKLTVNQGGGLNLFTSKEAE
YDQTAMCMKKLAFIIYSSELDQYVKSMPEIQEKLSESLRLGMIPQIETQI
FLCFRVLLMRISHQHLTSLWHIFIPILTSVLQNLIDDLKCDIKSIKQNDI
NKRLNMYLSACKLLDIIFLMNEDSVPQFLYYKWAFVGNLDEETNYFRSND
MNFQPVFRPFLTLVIDSYIQYYLSLGIPLNSIEVVYENLYNEKPLIYRQS
IHSLTDLAPFFFTASLRNDLNQEARATQYGITVVNEKDINADCNNNSCGR
FFNFENEVEMILDNEFVEPINKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000484secretory system
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR003582ShKT_dom
IPR007249Dopey_N
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005802trans-Golgi network
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006895Golgi to endosome transport
GO:0015031protein transport