Serine/threonine-protein kinase B-raf

Overview
NameSerine/threonine-protein kinase B-raf
Smed IDSMED30010702
Length (bp)2894
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase B-raf (SMED30010702) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase B-raf (SMED30010702) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase B-raf (SMED30010702) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase B-raf (SMED30010702) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010702

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010702SMESG000064517.1 SmedASXL_015671SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010702SMESG000064517.1 dd_Smed_v4_13233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010702SMESG000064517.1 dd_Smed_v4_13233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010702SMESG000064517.1 dd_Smed_v4_13233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010702SMESG000064517.1 dd_Smed_v4_13233_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010702SMESG000064517.1 dd_Smed_v6_13233_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30010702SMESG000064517.1 OX_Smed_1.0.13808ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30010702SMESG000064517.1 SMESG000004613.1 Contig45176newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30010702SMESG000064517.1 SMESG000004613.1 Contig45176uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30010702SMESG000064517.1 dd_Smed_v4_13233_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Zebrafish
Match: si:dkey-8l13.5 (si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-349])

HSP 1 Score: 67.781 bits (164), Expect = 4.133e-11
Identity = 85/391 (21.74%), Postives = 149/391 (38.11%), Query Frame = 3
Query:   78 RNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKF-EVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVAT--DYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRD 1241
            +N  + ++ S     +L  +KN +I TL +K+   DS+ FN+I F+     W   M PC+ + +  A  W+  +      +F  A+  A  +P   ++  + +  P+   + +  L   + R  P H        +I  +  +       ++  TRG+   + L+S   +  +    ++++STD     ++  E+  +   F +V        +  +  W    N     S +  +V   T   P    KRV A                                       R+  +G YYLG I  Q    L+ + F         F+ T    Q T   D+++L  A   SI+PGD VLAP       +  + RY  G V++G   RD
Sbjct:   22 KNISFVLDCSEGMSGVLGAVKNLIIQTLLTKASLRDSL-FNIISFSYKATPWSSRMLPCSPDVVYEALSWIHTLQTSSGRDFHTALALAFSDPACHSVHLVTSSVPDNPTQCLASLSTMVTR--PVHTFYISDKTSINSDTSD---FLQCLSSTTRGSCYIMALNSAGGVEEV----SLLHSTDDSIQKTTYAEDTLHSMDFNQVPYYNCTSCVCSIPYWCSPVNPFSTASCVSARVMQATELFPG---KRVLA---------------------------------------RREMDGFYYLGTIIHQGTGNLYMVEFDKSGMNGNTFMETLNIVQPTCQPDMVNLAIAHGHSIVPGDTVLAP------WEPEMRRYGPGRVIYGVEPRD 354          
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Zebrafish
Match: si:dkey-8l13.5 (si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-349])

HSP 1 Score: 55.4546 bits (132), Expect = 1.861e-7
Identity = 38/110 (34.55%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  918 AASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVAT--DYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRD 1241
            A  +  G+ VLAR+  +G YYLG I  Q    L+ + F         F+ T    Q T   D+++L  A   SI+PGD VLAP       +  + RY  G V++G   RD
Sbjct:    3 ATELFPGKRVLARREMDGFYYLGTIIHQGTGNLYMVEFDKSGMNGNTFMETLNIVQPTCQPDMVNLAIAHGHSIVPGDTVLAP------WEPEMRRYGPGRVIYGVEPRD 106          
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Match: K1QR88 (von Willebrand factor A domain-containing protein 3B OS=Crassostrea gigas OX=29159 GN=CGI_10014264 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 2.392e-49
Identity = 152/513 (29.63%), Postives = 243/513 (47.37%), Query Frame = 3
Query:   27 LISKMSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQH-PNQEIKEILDLFAYIGRKIPCH-IRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQL----------HIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSI-DHESYLLGKVYPETHYKPFQF-----WKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLY-KVPNYPLNSLPGYPTSG 1508
            LI K+  I TIF  V  RN  +CI+ S + +  L  +K H++ TL  +++  + M FN+I FNS+V +W   M  CT E +  AA W++ +  +   N  GA+++AL +  NC   +IVT   P+Q  ++ILD     G   P H I LC   NT    I+  E     +A E+ G+F  V L     +          H  +     MN T        N  +N  +    ++  EE   +        +P+ + D   Y     +    + P+++     W R   ++ ++       +  ++ M + S S  A ++++G++VLAR+  +G +Y+G ++ Q+ ++ F + FGP     G++  T YQ+T + D+ID  DA + +I  GDRVLA     P  +    R+  G V+ G                 E + +D P    ++  I  T    KTEKV  D  I+ PE  ++RL LE  MPK AR  L  + P+YP  +L GYPTSG
Sbjct:   36 LIPKIKGIPTIFGEVLERNVTFCIDTSGSMYKGLDVVKEHLVETLLKQANKPNCM-FNIIEFNSEVTQWADKMVKCTPETVAVAATWVKKLSAKTGTNTQGALLTALSD-RNCEAVYIVTDGLPDQHPQDILDQVGLAGHNRPIHCIYLCSEDNTDQVSIEFLED----LAVESFGSFHIVTLTVHGCVERITPIYRADHAHERIIRTMNGT------IHNSTKNCGVSTTLLVDPEESLRLTPRVSLLGHPHPVPDPLGYPYWDTWKNWFFHPYRYYYPHGWSRYRPARGWLKA----QDQMMSSMENSSVSPAAGALLIGKKVLARRIDDGYFYIGTVQSQILSDKFLVAFGPCK--HGKYNETKYQDTFIFDIIDYEDAKRHTIQTGDRVLA--TWEPEGE----RFCPGVVIEG----------------QEKRQVDGP----DDRQITVTFANGKTEKVPMDVAIWTPEQVYERLTLELKMPKEARLSLQNQEPHYPKENLEGYPTSG 504          
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Match: A0A3S1AFC3 (VWFA domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_001840 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.239e-47
Identity = 146/521 (28.02%), Postives = 243/521 (46.64%), Query Frame = 3
Query:   54 TIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGD-SMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQH-PNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKF--EVLREEEKKEIFKMS-----EWALNP--NSIDHESYLLG--------KVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYK-VPNYPLNSLPGYPTSGSKKIPDDFTFTNPNVL 1556
            T+F  V  +   +CI+ S +    LP +K H++ TL S S   D ++ FNLI FNS V +W   +  CT E +  A  W++ +  +   N   A+++A  +P  C   ++VT   P+Q ++E+LD           H    V G    + +         +A ET G+           LHI+  T  +    + +T +  +D  +E I +     LR   K      S     E  L P  NS+ +    LG           PE +Y P  +W R   ++++++    + +  +  ++  +G     SV+VG+ VLAR+  +G +Y+  ++ Q   E F + FGP     G++  T YQ+T + D++D  DA++ +I+ GDRVLA  P  P  +    RY  G VL G                 E ++ + P    ++L + F++   KTE+V  D  +++P   ++RL LE  MP+ AR+ L   V NYP+ +LPGYP SG    P ++    P+ +
Sbjct:   67 TMFGLVPEKRVTFCIDTSGSMFKSLPVVKEHLMETLHSLSKFRDETVMFNLIEFNSQVTQWADKLVQCTPETVAVAGQWVKALSAKTGTNTQDALLAAFADP-TCQSVYLVTDGPPDQYVEEVLDRVVAASGPRTVHCVYVVTGEAADEAVVE---FLEDLAVETFGS-----------LHIV--TLTLHGCVERVTPIYRSDHAHERIVRTVNNTLRPSVKACSVATSLQIDPEEILAPRLNSLVYPHPYLGYHVSPALVSTMPERYYYP-HYWSRYRPAKAWLEAQDKLVDPRLAGLSPAAG-----SVLVGKRVLARRIEDGYFYMATVQSQNLGEKFLVAFGPCK--HGKYKQTQYQDTYVFDIVDHQDALRHTILTGDRVLA--PWEPEGE----RYAPGIVLSG----------------QEKRHAEGP--EDQDLTVSFSN--GKTERVPRDVAVWLPSSLYERLSLELQMPQEARKTLLSAVDNYPIENLPGYPASGPVGNPPEYPTIEPSFV 536          
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Match: V3ZVM7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236029 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 3.732e-47
Identity = 169/616 (27.44%), Postives = 278/616 (45.13%), Query Frame = 3
Query:   57 IFETVSSRNKIYCIEASAATHSILPYIKNHVIHTL-KSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQH-PNQEIKEILDLFAYIGRKIPCHIRLCV-LGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQST-----KNIMNSTD-----------LITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCL-RNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPTSGSKKIPDDFTFTNPNVLKSRTLQIDXXXXXXXXXXXXVIEIFDKDDRTGNILTKSDWASGNVIKKSNMHKKNETLVPESIYTISELQLKVKDQLETFKDLPESRMNPEKPFLL 1844
            IF+ V   +  +C++ S + ++ L  +K  ++  L K   H   S  FN++ FNS + +W   M  CT E +  A+ W+  +  +   N + A++ A  +P  C   ++VT   P+Q  +EILD   Y+    P H   CV L     DE  +A      +A ET G+F    + +   +  +         N + STD           + T ++++  E+  +               ++    +NP       Y+   V    +Y P  +W R   ++ ++    + ++E+   +M     S  A ++++G+EVLAR+  +G +Y G ++ Q+    F + FGP     G++  T YQET + D++D  DA +R+++ GD+VL+P    P  D F      G V+ G   R+           +EG +        + + + F++   KTEKV  D  ++IPEP + RL LE  MP+S REKL   PNYPL +LPGYPTSG    P  +      VL+S    +         P  PV  I+ K        T        V+K  ++H     L+P +  T  EL+ +V  QL   K L + R N +   LL
Sbjct:   23 IFDNVVEESVTFCVDTSGSMYNCLHVVKEQLVEALYKHVKHSSGSPLFNIVEFNSQITQWSDKMVKCTPETVAVASKWIDELSAKTGTNTMDALLIAFGDP-ECKAVYLVTDGLPDQNPEEILDHVGYVDNDRPVH---CVYLMGEKADE--SATEFLEDLAIETYGSFFIASITTKGAIEKLTPVFKAEHSNYLKSTDNNLFSKIKQCNVSTTLAADPIESAYLNS-------------RLVSPVINP-------YVFPPVQGYRYYHP-SYWSRYRPAKGWLKMQDKLLDEAQALEM-----SPAAGALLIGKEVLARRNEDGYFYSGSVQSQIYENKFLVAFGPCK--HGKYKDTTYQETMVHDILDYVDAKRRTVVTGDKVLSP--WEPEGDKFG----PGVVIDGFEKRE-----------SEGPD-------DKGITVAFSN--GKTEKVAPDTAVWIPEPMYDRLKLELNMPRSTREKLASQPNYPLENLPGYPTSGPIAYPQKYPKPVSLVLES---DVPLNSFHRYPPYAPVYPIYLKRSEPKKHKT--------VVKSEDVH----ALIPGTQLTTKELEDRVSSQLMEHKLLLDERENEKNGRLL 563          
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Match: A0A2C9JKB2 (VWFA domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106057627 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.096e-45
Identity = 157/525 (29.90%), Postives = 257/525 (48.95%), Query Frame = 3
Query:   54 TIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQH-PNQEIKEILDLFAYI--GRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEE--KKEIFKMSEW--ALNPNSIDHESYLLGKVYP--------ETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVP-NYPLNSLPGYPTSGSKKIPDDFTFTNPNVLKSRTLQID 1580
            T+F  V   +  +CI+ S +    L  +K H++ TL S +       FNLI FNS V +W   M  CT E +  A  W++ +  +   N   A+++AL +PL C   ++VT   P+Q  +++LD    I   R++ C   + + G T  DE   A      +A ET G+F  V L +   +  +       +S + I + + N+    NIK+  +    +   +E   M  +  AL  N   H S L+G V P         + Y+P + W + S  QSFMD L  +             S  A S+++G++V+AR+  +G +Y   ++ Q  +E F + FGP     G+++ T+YQ+T + D++D +DA+  SII GD VLA  P  P+ +    R+  GTV+ G                +E ++ + P   +  L + FT  +  TEKV  +  ++IP   + RL LE  MPK AR+ L     NYP+++LPGYPTSG+   P ++   +P +++S +   D
Sbjct:   79 TMFGRVIENSVTFCIDTSGSMFKYLDVVKQHLMETLLSLAAREYQPMFNLIDFNSQVTRWADKMVKCTPETVAVAEKWIKELQAKTGTNTQDALLTALSDPL-CEAIYLVTDGLPDQYPEDVLDSIVGICGNRRVHC---IYITGET-ADE--TATEFLEDLAVETFGSFHIVTLTTHGCIERITPIYRSDHSHEKI-VQTVNNTLRPNIKRCSIATSLQINPEETLNMVPYTRALLYNWGPHISPLIG-VGPARYYYPYYWSRYRPAKAWLK-SQEQSFMDPLLGL-------------SPAAGSLLIGKKVVARRIDDGFFYRATVQSQNLDEKFLVAFGPCK--HGKYLQTEYQDTYVFDIVDYHDALHHSIITGDNVLA--PWEPDGE----RFAPGTVIEG----------------HEKRHAEGP--DNVQLTVLFTHGI--TEKVPLNTAVWIPPSVYDRLSLELQMPKEARKTLLSCSDNYPIDNLPGYPTSGTLGDPPEYPTADPFIVESNSFLWD 552          
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Match: A0A210Q6Z3 (von Willebrand factor A domain-containing protein 3B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07029 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.859e-45
Identity = 142/512 (27.73%), Postives = 240/512 (46.88%), Query Frame = 3
Query:   48 IETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQH-PNQEIKEILDLF--AYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIK-----KFEVLREEEKKEIFKMSEWALNP----NSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPTSGSKKIPDDFTFTNP 1547
            I TIF     +N  +C++ S +    L  +K H++ TL   +       FN+I FNS+V +W   M  C++E +  AA+W++ +  +   N L A+++AL E   C   ++VT   P+Q   +ILD    A  GR I C I LC      T  I+  E     ++ E+ G+F  V L     +  +       ++ + I    +    N   +       +V  EE      ++S +   P    N   H ++    + P  +Y P   W +   ++ ++       ES +  + +   S  A ++++ ++VLAR+  +G +YLG +K Q+  + F + FGP     G++  T YQ+T + DL+D  DA + +I   D+VLAP    P  +    R+  G V+ G                +E +  + P  H   + + F++   +TEK+  D  +++PE  ++RL LE  MP+ ARE L   P+YPL +LPGYPTSG    P  +   +P
Sbjct:    8 IPTIFGETFEKNVTFCVDTSGSMFKGLGVVKEHLVETLLKHARKSQPTSFNIIEFNSEVTQWADKMVKCSAETVEVAAEWVKRLSAKTGTNTLDALLTAL-EDRGCESVYLVTDGLPDQHPVDILDQVTNAVRGRPIHC-IYLCAEDAMDTSAIEFLED----LSVESYGSFHIVSLTQHGCVERVTPIYRADHAHERIVRTINGTLHNHGKQCSVATTLKVDPEESLALTPRVSSFNSYPGFPGNPYGHLAWGHWFMQPHRYYFP-NGWSQYRPARGWLKS----QESMMDHIENSGVSPAAGALLISKKVLARRIDDGYFYLGKVKSQILGDKFLVAFGPSK--PGKYKETTYQDTFVYDLVDYEDAKRHTINTSDKVLAP--WEPQGE----RFGPGVVIEG----------------HEKRGSEGPDDH--QITVTFSN--GRTEKIPSDMALWVPEEVYERLVLELKMPREARETLQTNPHYPLENLPGYPTSGPTAEPRVYEQPHP 480          
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Cavefish
Match: si:dkey-8l13.5 (chromosome 18 C11orf16 homolog [Source:NCBI gene;Acc:103047275])

HSP 1 Score: 52.7582 bits (125), Expect = 1.661e-6
Identity = 69/329 (20.97%), Postives = 115/329 (34.95%), Query Frame = 3
Query:   78 RNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQ---LDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQ------FWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNE--LFNIVF 1031
            RN    ++ S A  ++L  +KN ++ TL +K+   +S+ FN+I F+  V  W   M PC  + +  A  W+  +      + L A+ +A  +P  C    +VT                               N++ D  +N  +  S        TF   +   LDSD    +   T     S   + + S +  E     +  +L   E +              I   S+   +     HY P        +W  +    S   C+         ++  G      A    G  VLAR+  +G YYLG I  Q+ +    F + F
Sbjct:   16 RNVTLILDTSEAMTAVLGTVKNLIVQTLLAKASLRNSL-FNIITFSYKVTPWSDHMVPCAPDTVYEALGWIHTLTTSPGKDLLTALTTAFSDPA-CQSVHLVT-------------------------------NSLPDNPENCLSALSTCGTRPVHTFHIAEKQALDSDTLDFLKCLTSATRGSCYRLNLNSGSTAE-----QVALLHSAEHQ--------------IQEPSFSENRCCRALHYNPMHAVCLSPYWGSLRNPFSATPCIS-------ARLMRG------AEFYPGCRVLARREADGFYYLGTIVHQLQDRGGFFMVAF 279          
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Nematostella
Match: EDO41655 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3S3])

HSP 1 Score: 70.4774 bits (171), Expect = 5.840e-14
Identity = 44/168 (26.19%), Postives = 77/168 (45.83%), Query Frame = 3
Query:   54 TIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCH-IRLCVLGNTITDEIKNAETVYSQIAKETRGTF 554
            TIF  +  RN ++ ++ S + +  L  ++ H+I  L  ++  G    FN+I FN +V KW   M  CT   ++ A++W+  +    S N +GA++ A  +     I  +    P+Q    I++    + +  P H I LC     +      A      +AKET G+ 
Sbjct:   14 TIFGNILERNVVFLLDTSGSMYHCLDVVREHLIEILFFRATSGRDTMFNVIEFNEEVTKWADRMVQCTPRTVSVASEWINKLQCGTSTNTMGALLEAYDDDGMQAIYLVTDGMPDQRPGIIMENVRKLHKGRPIHAIYLCGAKADVA-----AVEFLEDLAKETNGSL 176          
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Match: SMESG000064517.1 (SMESG000064517.1)

HSP 1 Score: 1484.55 bits (3842), Expect = 0.000e+0
Identity = 746/751 (99.33%), Postives = 748/751 (99.60%), Query Frame = 3
Query:   39 MSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPTSGSKKIPDDFTFTNPNVLKSRTLQIDXXXXXXXXXXXXVIEIFDKDDRTGNILTKSDWASGNVIKKSNMHKKNETLVPESIYTISELQLKVKDQLETFKDLPESRMNPEKPFLLKGASKKVENDARVAKTVHIKSNEKLLTSPARKVQIDSEPLVEINAPKKSSSLQSLVIQEEYFEDLRKIRESVNEDKDYXXXXXXXXXXXXXXVAEDGVKRILVPQSGQLFQKSFTGKLEVQNSNVVYITDIGEKDKERETVEKIKLQRQ 2291
            MSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGA+VSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMA GSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPTSGSKKIPDDFTFTNPNVLKSRTLQIDYLMPPYCLPLYPVIEIFDKDDRTGNILTKSDWASGNVIKKSNMHKKNETLVPESIYTISELQLKVKDQLETFKDLPESRMNPEKPFLLKGA+KKVENDARVAKTVHIKSNEKLLTSPARKVQIDSEPLVEINAPKKSSSLQSLVIQEEYFEDLRKIRESVNEDKDYSSSSYSRRPSRNRSVAEDGVKRILVPQSGQLFQKSFTGKLEVQNSN VYITDIGEKDKERETVEKIKLQR 
Sbjct:    1 MSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGALVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQSTKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNSIDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAQGSGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGMGQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRYITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSKTEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPTSGSKKIPDDFTFTNPNVLKSRTLQIDYLMPPYCLPLYPVIEIFDKDDRTGNILTKSDWASGNVIKKSNMHKKNETLVPESIYTISELQLKVKDQLETFKDLPESRMNPEKPFLLKGANKKVENDARVAKTVHIKSNEKLLTSPARKVQIDSEPLVEINAPKKSSSLQSLVIQEEYFEDLRKIRESVNEDKDYSSSSYSRRPSRNRSVAEDGVKRILVPQSGQLFQKSFTGKLEVQNSNAVYITDIGEKDKERETVEKIKLQRH 751          

HSP 2 Score: 280.026 bits (715), Expect = 2.870e-80
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 2
Query: 2291 IERRLKEEQSRFCQEEMNKDRHVYFQKQKTAARIHKENLIRQSEQEAIDKAQSLKRSVLSEVENKVKSVEPLPPSYDDVDKKRIEGLKNRMAQRNNDMEKRNQDALKYIEKQELSKRNRSDERWWKAQNQMLKEYPA 2701
            IERRLKEEQSRFCQEEMNKDRHVYFQKQKTAARIHKENLIRQSEQEAIDKAQSLKRSVLSEVENKVKSVEPLPPSYDDVDKKRIEGLKNRMAQRNNDMEKRNQDALKYIEKQELSKRNRSDERWWKAQNQMLKEYPA
Sbjct:  755 IERRLKEEQSRFCQEEMNKDRHVYFQKQKTAARIHKENLIRQSEQEAIDKAQSLKRSVLSEVENKVKSVEPLPPSYDDVDKKRIEGLKNRMAQRNNDMEKRNQDALKYIEKQELSKRNRSDERWWKAQNQMLKEYPA 891          
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 52.373 bits (124), Expect = 4.785e-7
Identity = 35/147 (23.81%), Postives = 68/147 (46.26%), Query Frame = 3
Query:   27 LISKMSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKE-PLNCNICFIVTQ-HPNQEIKEILDLFAYI--GRKIPC 455
            L + +  ++TIF  ++ RN  +C + S + +    + + H++  L       +  KFN+I FNS V ++      C  + I     W+     E   + L AI+ + ++ P   ++ +++T    N+E   +L    +I  GR I C
Sbjct:   22 LRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFEDFP---DVVYLITDGFINKERATLLGNLPHISKGRPINC 165          
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.096e-6
Identity = 34/146 (23.29%), Postives = 67/146 (45.89%), Query Frame = 3
Query:   27 LISKMSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQ-HPNQEIKEILDLFAYI--GRKIPC 455
            L + +  ++TIF  ++ RN  +C + S + +    + + H++  L       +  KFN+I FNS V ++      C  + I     W+     E   + L AI+ + ++    ++ +++T    N+E   +L    +I  GR I C
Sbjct:   22 LRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFED--FPDVVYLITDGFINKERATLLGNLPHISKGRPINC 165          
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Match: SMESG000009195.1 (SMESG000009195.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.097e-6
Identity = 34/146 (23.29%), Postives = 67/146 (45.89%), Query Frame = 3
Query:   27 LISKMSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQ-HPNQEIKEILDLFAYI--GRKIPC 455
            L + +  ++TIF  ++ RN  +C + S + +    + + H++  L       +  KFN+I FNS V ++      C  + I     W+     E   + L AI+ + ++    ++ +++T    N+E   +L    +I  GR I C
Sbjct:   22 LRTSLKLVKTIFGEITERNVTFCFDYSGSMYRYFHHFREHLLEALFKMLLSKNGQKFNIILFNSSVHQFASRHVDCVQDNIVDVIRWMNKPSYESKTDILAAIIKSFED--FPDVVYLITDGFINKERATLLGNLPHISKGRPINC 165          
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Match: SMESG000047774.1 (SMESG000047774.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.698e-6
Identity = 55/246 (22.36%), Postives = 103/246 (41.87%), Query Frame = 3
Query:   57 IFETVSSRNKIYCIEASAATHSILPYIKNHVIHTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHILPEGSCNFLGAIVSALKEPLNCNICFIVTQ-HPNQEIKEILDLFAYIGRKIPCHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAF-------VQLDSDNQLHIMQS-------TKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPN 749
            +F T+        I+ SA+    + ++K+ +   ++ +  H    K N + FN+    W   +   T   + +A  WL  +  +GS N L A+  A+K+  NC   +++T   P+Q  K +L        +I    RL +   +       A T   ++A+ET G F +           ++N+L   +S       ++  +    L  +    DE ++   K EV+R++E+K   K      N N
Sbjct:  562 LFGTIMEDQVYILIDISASMEPHISFVKDKLYTLIQEQLRHKS--KINFVAFNTKALPWRDRLVDVTEANLKSAWQWLEGLTCQGSTNTLSALQFAIKD-RNCQGIYLLTDGRPDQPTKTVLS-------QIRLQYRLPIHTISFNCADLEANTFLCELARETGGRFHYFNEISGGADCTNENELEAWESEDIKLLKSEYRLGFDSLEKVTKLRDECHKLAWKSEVVRKKEQKSTRKTMAPGCNQN 797          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-8l13.54.133e-1121.74si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-34... [more]
si:dkey-8l13.51.861e-734.55si:dkey-8l13.5 [Source:ZFIN;Acc:ZDB-GENE-141216-34... [more]
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QR882.392e-4929.63von Willebrand factor A domain-containing protein ... [more]
A0A3S1AFC31.239e-4728.02VWFA domain-containing protein OS=Elysia chlorotic... [more]
V3ZVM73.732e-4727.44Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9JKB21.096e-4529.90VWFA domain-containing protein OS=Biomphalaria gla... [more]
A0A210Q6Z32.859e-4527.73von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-8l13.51.661e-620.97chromosome 18 C11orf16 homolog [Source:NCBI gene;A... [more]
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO416555.840e-1426.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein kinase B-raf vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064517.12.870e-8099.33SMESG000064517.1[more]
SMESG000009195.14.785e-723.81SMESG000009195.1[more]
SMESG000009195.11.096e-623.29SMESG000009195.1[more]
SMESG000009195.11.097e-623.29SMESG000009195.1[more]
SMESG000047774.11.698e-622.36SMESG000047774.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010702 ID=SMED30010702|Name=Serine/threonine-protein kinase B-raf|organism=Schmidtea mediterranea sexual|type=transcript|length=2894bp
TCCGTTTCTATGAATTGAAATTTTTATTGATTTCGAAAATGTCTTACATT
GAAACTATATTTGAAACTGTAAGTAGTAGAAACAAAATATACTGTATTGA
AGCATCGGCCGCTACTCACAGTATATTGCCATATATAAAAAATCATGTAA
TCCACACCTTGAAAAGCAAATCACATCACGGGGATAGTATGAAATTTAAT
TTAATATGTTTCAATAGCGATGTTGCAAAATGGTGTGTGTCAATGGCACC
TTGTACAAGTGAATACATTACAGCCGCAGCTGATTGGTTGCGACATATTC
TTCCAGAAGGATCATGTAATTTTCTTGGAGCCATTGTCAGTGCTTTAAAA
GAACCTCTGAATTGTAATATATGTTTTATCGTAACTCAACATCCCAATCA
AGAAATAAAAGAGATTTTGGATTTATTTGCATATATTGGTCGCAAAATTC
CTTGTCACATTAGATTATGTGTACTTGGAAATACTATAACTGACGAAATA
AAAAATGCTGAAACTGTATATAGTCAAATAGCTAAAGAAACTAGAGGAAC
ATTTGCATTTGTACAATTAGATTCAGACAATCAGCTTCATATAATGCAAA
GTACAAAAAATATAATGAATTCAACAGATCTAATAACAATCGTATCATCA
AATGATGAAGAAAATGAAAATATTAAAAAGTTCGAAGTGCTTCGAGAAGA
AGAGAAAAAAGAAATCTTTAAAATGTCAGAATGGGCTTTAAATCCCAATT
CAATTGACCATGAAAGTTATTTGCTTGGAAAGGTGTATCCAGAAACACAC
TATAAACCATTTCAATTCTGGAAACGGGTTTCAGCATCTCAATCTTTTAT
GGATTGCTTGCGCAACATCAATGAGTCTAATGTTACCAAAATGGCTCATG
GAAGTGGATCAAAATTAGCCGCATCAGTAATTGTTGGCCGAGAAGTATTA
GCAAGAAAATATACAAATGGCCAGTATTATCTTGGTTATATAAAGGATCA
GGTAAACAATGAATTGTTCAATATCGTATTTGGTCCATATAATTGGGGTA
TGGGGCAATTCGTAGCTACAGACTATCAAGAAACTAAATTACTCGATTTA
ATTGACTTAAATGATGCCATGAAGAGATCCATTATACCTGGAGATAGGGT
ATTGGCTCCTGACCCAACTTCACCCAACAAAGATGCGTTTCTTTGCAGAT
ACATCACAGGGACAGTTCTGCACGGGTCTGTAATCAGAGATTATTCAACA
GCGAGAATACCCGTTACAGATACTAATGAAGGAAAAAATATTGATGCTCC
AATAAAACATTCGGAAAATCTCATTATAGAATTCACTAGTCCTCTCAGTA
AAACTGAAAAGGTAGTTGGGGATAAAGTTATATACATTCCAGAACCATTT
TTCCAAAGACTTTGTTTGGAAAGTGCAATGCCAAAATCTGCTCGTGAAAA
ACTCTATAAAGTGCCAAATTATCCATTGAACTCTTTGCCCGGTTATCCCA
CATCAGGAAGCAAGAAAATCCCTGATGATTTCACTTTTACAAATCCAAAT
GTATTAAAAAGCAGAACCCTACAAATTGACTATCTAATGCCTCCATATTG
TTTGCCACTTTATCCGGTTATTGAAATTTTCGACAAAGATGATCGAACGG
GAAATATTTTGACAAAAAGTGATTGGGCCAGTGGAAATGTAATCAAAAAA
TCAAATATGCACAAAAAAAATGAAACCTTAGTCCCTGAATCCATTTATAC
GATCAGTGAACTTCAACTAAAAGTTAAAGATCAATTGGAAACTTTTAAAG
ATCTTCCTGAGTCCAGAATGAATCCAGAAAAACCTTTTCTTCTTAAAGGT
GCTAGCAAAAAGGTTGAAAATGATGCTCGAGTTGCAAAAACGGTCCATAT
CAAATCCAATGAGAAATTGCTGACATCTCCCGCTAGAAAGGTCCAGATTG
ACTCAGAGCCATTAGTAGAAATTAATGCGCCGAAGAAAAGTTCATCGCTT
CAATCGCTTGTGATTCAGGAGGAATATTTTGAAGATTTAAGGAAAATCCG
CGAAAGTGTAAACGAAGATAAGGATTACTCTAGTTCAAGTTATAGCAGAA
GGCCCAGCAGGAATAGGTCTGTTGCTGAAGATGGGGTCAAGAGAATATTA
GTGCCTCAATCTGGGCAATTATTTCAAAAATCATTTACCGGTAAACTTGA
GGTGCAAAATTCCAATGTAGTTTATATAACAGATATTGGAGAAAAGGATA
AAGAAAGAGAAACTGTTGAGAAGATTAAATTACAGAGGCAATTGAAAGGC
GATTAAAAGAAGAACAATCTCGGTTTTGTCAAGAAGAAATGAACAAAGAT
CGTCATGTATATTTCCAAAAGCAGAAAACTGCTGCAAGAATTCATAAAGA
AAACCTTATTCGGCAGTCAGAACAAGAAGCCATTGATAAGGCTCAGTCAT
TAAAACGATCCGTGTTATCGGAAGTAGAGAACAAAGTGAAATCTGTCGAG
CCGCTTCCTCCTTCATATGACGATGTCGATAAAAAACGAATTGAAGGTTT
AAAAAATCGAATGGCTCAAAGAAACAACGACATGGAAAAACGTAACCAGG
ATGCCTTGAAGTATATTGAAAAGCAAGAACTAAGCAAACGCAATCGGTCC
GATGAGCGATGGTGGAAAGCTCAAAATCAAATGCTTAAGGAGTATCCTGC
GTAGGCTTATTTAAACGGTGAAAAAAATTTCAAAAGATGTTCATATATTT
ATTTTACTTTTCATTCTTATATATTCTAAGGGCATTATCGATTTTTTCAG
ATATATTACCTTTGTCTTTGACTAATATTAGCAATTAAGATTTGATTAAA
TATTATATACCGTATTTCTATATTATTGTGAAATTATTTGCAAC
back to top

protein sequence of SMED30010702-orf-1

>SMED30010702-orf-1 ID=SMED30010702-orf-1|Name=SMED30010702-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=122bp
MNKDRHVYFQKQKTAARIHKENLIRQSEQEAIDKAQSLKRSVLSEVENKV
KSVEPLPPSYDDVDKKRIEGLKNRMAQRNNDMEKRNQDALKYIEKQELSK
RNRSDERWWKAQNQMLKEYPA*
back to top

protein sequence of SMED30010702-orf-2

>SMED30010702-orf-2 ID=SMED30010702-orf-2|Name=SMED30010702-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=768bp
RFYELKFLLISKMSYIETIFETVSSRNKIYCIEASAATHSILPYIKNHVI
HTLKSKSHHGDSMKFNLICFNSDVAKWCVSMAPCTSEYITAAADWLRHIL
PEGSCNFLGAIVSALKEPLNCNICFIVTQHPNQEIKEILDLFAYIGRKIP
CHIRLCVLGNTITDEIKNAETVYSQIAKETRGTFAFVQLDSDNQLHIMQS
TKNIMNSTDLITIVSSNDEENENIKKFEVLREEEKKEIFKMSEWALNPNS
IDHESYLLGKVYPETHYKPFQFWKRVSASQSFMDCLRNINESNVTKMAHG
SGSKLAASVIVGREVLARKYTNGQYYLGYIKDQVNNELFNIVFGPYNWGM
GQFVATDYQETKLLDLIDLNDAMKRSIIPGDRVLAPDPTSPNKDAFLCRY
ITGTVLHGSVIRDYSTARIPVTDTNEGKNIDAPIKHSENLIIEFTSPLSK
TEKVVGDKVIYIPEPFFQRLCLESAMPKSAREKLYKVPNYPLNSLPGYPT
SGSKKIPDDFTFTNPNVLKSRTLQIDYLMPPYCLPLYPVIEIFDKDDRTG
NILTKSDWASGNVIKKSNMHKKNETLVPESIYTISELQLKVKDQLETFKD
LPESRMNPEKPFLLKGASKKVENDARVAKTVHIKSNEKLLTSPARKVQID
SEPLVEINAPKKSSSLQSLVIQEEYFEDLRKIRESVNEDKDYSSSSYSRR
PSRNRSVAEDGVKRILVPQSGQLFQKSFTGKLEVQNSNVVYITDIGEKDK
ERETVEKIKLQRQLKGD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032770DUF4537
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0005057signal transducer activity, downstream of receptor
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 217..237
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 687..710
NoneNo IPR availablePANTHERPTHR14343FAMILY NOT NAMEDcoord: 17..571
IPR032770Domain of unknown function DUF4537PFAMPF15057DUF4537coord: 312..471
e-value: 2.6E-13
score: 50.0