SMED30010701

Overview
NameSMED30010701
Smed IDSMED30010701
Length (bp)1569
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30010701 (SMED30010701) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30010701 (SMED30010701) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010701

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30010701SMESG000025342.1 SMESG000025336.1 dd_Smed_v4_15857_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010701 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000012:3461..5032 -7420
v31.001019:23143..24714 +7339
Homology
BLAST of SMED30010701 vs. Planmine SMEST
Match: SMESG000025336.1 (SMESG000025336.1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 462/491 (94.09%), Postives = 478/491 (97.35%), Query Frame = 2
Query:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDGYIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKS-GTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSXXXXXXXXXXXXXXCLNIIMILTEEFSNSLNQVLHFNLYSNHNFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVKHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGISLFELIQNILLLVSSFEYLIEXXXXXXXXXFVLDGETIFFLENSWTFFFHTPINILILQLSIFSEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK 1471
            ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVY+I+P  +R DGYIEKINYSISFVKVVSIILICYNT+INHRFRNLRIKHKLEQPLIFYLICLP+L +SL+G+FV+I +YTFE+S    ++I Y +LVIFEYFLFI+LVIDINGFSDTGEEWFMNYFNSMTIIITMTSVIMQICLNIIMILTEEFSNSLNQVLHFNLYSNH+FTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFV HERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGI LFELIQNILLLVSSFEYLIETMLLTTLMLFVLDGETIFFLENSWTFFFHTPINILILQLSIFSEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK
Sbjct:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYRITPNENRNDGYIEKINYSISFVKVVSIILICYNTKINHRFRNLRIKHKLEQPLIFYLICLPILLMSLIGVFVVILYYTFERSVKNPSHITYCSLVIFEYFLFIVLVIDINGFSDTGEEWFMNYFNSMTIIITMTSVIMQICLNIIMILTEEFSNSLNQVLHFNLYSNHSFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVIHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGIGLFELIQNILLLVSSFEYLIETMLLTTLMLFVLDGETIFFLENSWTFFFHTPINILILQLSIFSEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK 492          
BLAST of SMED30010701 vs. Planmine SMEST
Match: SMESG000025344.1 (SMESG000025344.1)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 374/490 (76.33%), Postives = 429/490 (87.55%), Query Frame = 2
Query:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDGYIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKSGTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSXXXXXXXXXXXXXXCLNIIMILTEEFSNSLNQVLHFNLYSNHNFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVKHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGISLFELIQNILLLVSSFEYLIEXXXXXXXXXFVLDGETIFFLENSWTFFFHTPINILILQLSIFSEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK 1471
            ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPR DRKD Y++KINYSISFVK+VSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKSGTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSMTIIITMTSV++QICLNIIMILT++F+N++N+    +L+SNHNFT FDKT Y  ++FLKKR VITLSL FIPFLVIPLKRNL HLF+FK K+DLPED+ +LSMNKVSSITG  TVGV++T I IV L   +++     + + SRIIK  +  F   LL IMITEIK+SARLNSSQYLNVKNILIYLGAFGQFS+ I  IVV+IYNL+ NG  LFE  ++IL+L S+F YLIET+L+TTLMLFVLDG+ + F +NSW+ FF++PINILILQ+ +F+EYLTK  Y ++NSFQIR++E GT+ FAI LV LYR+ICF+IIL +L+PFK
Sbjct:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRGDRKDEYLDKINYSISFVKIVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKSGTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSMTIIITMTSVMIQICLNIIMILTDDFTNTMNRTTFVSLFSNHNFTIFDKTCYRTLVFLKKRAVITLSLVFIPFLVIPLKRNLTHLFRFKPKEDLPEDKTVLSMNKVSSITGGFTVGVFLTFIVIVHLLYVMQNVPQ--VIIASRIIKLLVSFFISCLLGIMITEIKISARLNSSQYLNVKNILIYLGAFGQFSVQITNIVVNIYNLQTNGNGLFESTKDILILTSNFVYLIETILMTTLMLFVLDGKAVSFPKNSWSIFFYSPINILILQIGVFTEYLTKSFYDEQNSFQIRMMEIGTMYFAIPLVILYRAICFIIILLILRPFK 489          
BLAST of SMED30010701 vs. Planmine SMEST
Match: SMESG000025342.1 (SMESG000025342.1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 310/340 (91.18%), Postives = 327/340 (96.18%), Query Frame = 2
Query:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDGYIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKS-GTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSXXXXXXXXXXXXXXCLNIIMILTEEFSNSLNQVLHFNLYSNHNFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVKHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSS 1018
            ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVY+ISP  +R DGYIEKINYSISFVKVVSIILICYNT+INHRFRNLRIKHKL+QPLIFYLICLP+L +SL+G+FV+I +YTFE+S    ++I Y +LVIFEYFLFI+LVIDINGFSDTGEEWFMNYFNSMTIIITMTSVIMQICLNIIMILT+EF NSLNQVLHFNLYSNH+FTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFV HERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSS
Sbjct:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYRISPMENRNDGYIEKINYSISFVKVVSIILICYNTKINHRFRNLRIKHKLKQPLIFYLICLPILLMSLIGVFVVILYYTFERSVKNPSHITYCSLVIFEYFLFIVLVIDINGFSDTGEEWFMNYFNSMTIIITMTSVIMQICLNIIMILTDEFFNSLNQVLHFNLYSNHSFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVIHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSS 341          
BLAST of SMED30010701 vs. Planmine SMEST
Match: SMESG000025346.1 (SMESG000025346.1)

HSP 1 Score: 377.096 bits (967), Expect = 8.517e-126
Identity = 247/495 (49.90%), Postives = 339/495 (68.48%), Query Frame = 2
Query:    2 ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDGYIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKS-GTSTNILYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSXXXXXXXXXXXXXXCLNIIMILTEEFSNSLNQVLHFNLYSNHNFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVKHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGISLFELIQNILLLVSSFEYLIEXXXXXXXXXFVLDGETIFFLENSWTFFFHTPINILILQLSI----FSEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK 1471
            E   +F N +KEI LK LIS+PL +  +V+VTNYG YVY ++   ++   Y   INYS+  VK+ SI+LICYN QIN+RFRNLRIKHKL QPL FYLICLPM+ +S++GL V+  H  F+++    +  +Y  LVI EYFL+I+L+IDI+GF DTGEEW MNY NSMTIIIT+TS+ MQIC NII++LT+ FS +LN+       +N  + F ++    +I+  KKR VITL   FIPFL+I L+ NLNHL +FK K +  +++ + ++N+++  TG LT+ +Y+ L   VDL + ++ +    I+   RIIK FL+LFSI LL IMI E+K+S+RL S  YL+VK+ILIYLG  GQF   I  I++ IY +    ++  +  +  L +V   E L+E  L TTL+L + DG++IFF  NSWTFFF++P+NILILQ+SI    F +   K VY   NSFQI +I+ GTL FAI LV+LYR IC +I + +L PFK
Sbjct:    2 EQNVHFNNHKKEIYLKLLISLPLLVMSLVFVTNYGLYVYMVTLEGNKNIAYDFMINYSMCLVKIFSIMLICYNRQINYRFRNLRIKHKLIQPLTFYLICLPMILVSIIGLVVLSLHEIFDRNLDDVSRFIYCCLVILEYFLYIVLIIDISGFRDTGEEWIMNYVNSMTIIITITSIAMQICYNIILLLTDCFSKTLNRP-----ENNKTYAFINRPLLVRIMDNKKRAVITLIAVFIPFLLISLQVNLNHLIRFKKKLESLKEEIVPNINQITFATGGLTIVIYLALTITVDLVHVLEKDHQRNIFAAGRIIKVFLVLFSIFLLVIMIIELKISSRLKSPNYLSVKSILIYLGTLGQFCSLIMNIMITIYKINAKEVNSEKRFETFLSIVLDTESLLEVTLTTTLVLLLSDGKSIFFSRNSWTFFFYSPVNILILQISICFQNFGKINNKNVY---NSFQIDLIKHGTLTFAIPLVFLYRLICIIIFISILPPFK 488          
BLAST of SMED30010701 vs. Planmine SMEST
Match: SMESG000025369.1 (SMESG000025369.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.553e-42
Identity = 140/481 (29.11%), Postives = 272/481 (56.55%), Query Frame = 2
Query:   44 LKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDGYIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICLPMLFISLMGLFVIIFHYTFEKSGTSTNI-LYFALVIFEYFLFIILVIDINGFSDTGEEWFMNYFNSXXXXXXXXXXXXXXCLNIIMILTEEFSNSLNQVLHFNLYSNHNF--TFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHLFQFKTKDDLPEDQPILSMNKVSSITGSLTVGVY----ITLIFIVDLCNFVKHERGNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIYLGAFGQFSISIAYIVVDIYNLEINGISLFE---LIQNILLLVSSFEYLIEXXXXXXXXXFVLDGETIFFLENSWTFFFHTPINILILQLSIF---SEYLTKPVYGKENSFQIRIIEQGTLDFAIYLVYLYRSICFMII 1447
            +KF+IS+ L +F +VY+TNY  ++ + +P +DR  G  + I  ++  VK+ +I+LI YN +IN+RFRNLRI++ +E+P+I YLICLP+L IS++ + +   + T +    S ++ + F   I      I+ ++DI+G  +TGEEW M+Y N   IIIT+ ++ M+    +   ++  +SN + +  + + Y  + F  +F   ++ N+I  +++ ++I L +   P+L++ L +++ ++F+  +K + P+   + ++  + S++G +TV V+    + LI       + +     +IY   R       +F +  +  MI EI++   +  +++ ++K + IY G FG    ++  +  +I+  +I   S+FE   L  N   ++   E +I+T+L+++L+L +LD E   FL+ SW++ F +PI +L+ +++     S Y+  P  GK   F+I +I  G+  FA  +V  Y   C +I+
Sbjct:   48 IKFMISIKLLIFSIVYLTNYSLFIVRFTPLKDRCIGIPKIITCAMVIVKLTNILLIIYNARINYRFRNLRIRNPVERPMILYLICLPLLVISIISISLSALNTTLKWLSDSIDMSVDFGCSILNLIAVILFILDISGCRNTGEEWLMSYVNFCIIIITICTIFMEAMKTLTFKMSSIYSNLIYKYFNISFYEENKFSKSFLTSSAINQIRVIEEDSIIMLLVVLFPYLIVCLDQHMKNMFKDVSKGNNPQTLSVRNLTFL-SLSGCITVVVFSIFELVLIIYTHGKPYTEWGCEEWIY---RGFDGLKFIFVVINIVSMIHEIRLWLTVEENRFYDLKKLFIYFGTFGNIIKAVILVFFNIF--QIVSQSVFENTTLSVNCSYIIMHVEDIIQTVLMSSLILLILDKEPKPFLKISWSYEFCSPILLLMNRVNEIIRCSLYMLIP-NGK--YFEINLILIGSYSFAQPIVIFYNVTCVIIL 519          
The following BLAST results are available for this feature:
BLAST of SMED30010701 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010701 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025336.10.000e+094.09SMESG000025336.1[more]
SMESG000025344.10.000e+076.33SMESG000025344.1[more]
SMESG000025342.10.000e+091.18SMESG000025342.1[more]
SMESG000025346.18.517e-12649.90SMESG000025346.1[more]
SMESG000025369.11.553e-4229.11SMESG000025369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010701 ID=SMED30010701|Name=SMED30010701|organism=Schmidtea mediterranea sexual|type=transcript|length=1569bp
GGAATCTGGAGGGTATTTTCTCAATCAAAGAAAAGAAATTTGTTTGAAAT
TTTTGATTTCGGTTCCTTTATTTTTATTTGGCATGGTATACGTGACGAAT
TACGGGTTCTATGTATACCAAATTAGCCCAAGAAGGGATAGAAAGGATGG
ATATATTGAAAAAATAAATTACTCAATAAGTTTTGTAAAAGTCGTGAGTA
TTATTCTGATCTGTTACAATACACAGATCAATCACCGGTTCAGAAATTTA
CGGATCAAACACAAGTTGGAACAACCGTTGATATTCTATTTGATATGCCT
GCCAATGCTATTCATATCGTTAATGGGATTATTTGTCATTATTTTTCATT
ATACATTTGAAAAGAGTGGGACAAGCACAAACATCTTATATTTTGCTCTT
GTGATCTTTGAATATTTCCTGTTCATTATTTTGGTGATTGACATAAACGG
GTTCAGTGACACCGGCGAAGAATGGTTCATGAACTACTTCAACTCGATGA
CGATCATCATAACTATGACTTCTGTCATAATGCAAATATGCCTTAATATT
ATTATGATTCTTACCGAGGAATTTTCCAATTCTTTGAACCAAGTCCTGCA
TTTTAATCTGTATTCAAATCATAACTTCACATTCTTCGATAAAACCTCTT
ACAACAAAATAATATTCCTTAAGAAACGTACAGTGATAACATTGTCTTTG
GCGTTTATTCCTTTCCTCGTTATTCCGCTGAAACGAAATTTAAATCACTT
ATTTCAATTCAAAACGAAAGACGATTTACCAGAAGATCAACCTATTTTGT
CAATGAACAAAGTTTCTTCAATTACTGGAAGTCTTACTGTTGGGGTATAC
ATCACACTTATTTTTATAGTAGACCTCTGTAATTTTGTAAAACATGAAAG
GGGAAATTATATATATTTGACTAGTAGAATTATAAAGGCTTTTCTCATTC
TCTTTTCCATTGGTCTGCTAGCCATTATGATAACGGAAATAAAGGTTTCC
GCCCGATTAAACTCATCGCAATATCTAAATGTGAAAAACATTCTCATCTA
TTTGGGAGCCTTTGGGCAATTTAGTATCTCAATTGCATATATTGTAGTAG
ACATATATAACCTTGAGATAAATGGGATCAGTTTGTTTGAATTGATCCAA
AATATTTTACTTTTAGTTTCTAGCTTTGAATATTTGATAGAGACAATGTT
GTTAACGACCTTAATGCTATTTGTCCTTGATGGTGAAACGATTTTTTTCC
TCGAGAATTCCTGGACATTTTTCTTTCATACTCCAATAAATATTCTAATT
CTTCAATTGAGCATCTTTTCAGAATATCTCACCAAACCAGTTTACGGAAA
GGAAAATTCATTTCAAATCAGGATAATTGAGCAAGGTACTCTGGACTTTG
CTATTTATCTAGTTTATCTTTATCGGTCAATTTGTTTCATGATAATTCTT
TTCCTTCTGAAACCATTCAAATGATCAAATGCCCCTGGAGCTTTGTGGTC
CTAACAATGGGATTTTTTTCAAATGATTTGTTATTTAGATTTTTTATTTA
ATAAATTATTATTGATCCG
back to top

protein sequence of SMED30010701-orf-1

>SMED30010701-orf-1 ID=SMED30010701-orf-1|Name=SMED30010701-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=491bp
ESGGYFLNQRKEICLKFLISVPLFLFGMVYVTNYGFYVYQISPRRDRKDG
YIEKINYSISFVKVVSIILICYNTQINHRFRNLRIKHKLEQPLIFYLICL
PMLFISLMGLFVIIFHYTFEKSGTSTNILYFALVIFEYFLFIILVIDING
FSDTGEEWFMNYFNSMTIIITMTSVIMQICLNIIMILTEEFSNSLNQVLH
FNLYSNHNFTFFDKTSYNKIIFLKKRTVITLSLAFIPFLVIPLKRNLNHL
FQFKTKDDLPEDQPILSMNKVSSITGSLTVGVYITLIFIVDLCNFVKHER
GNYIYLTSRIIKAFLILFSIGLLAIMITEIKVSARLNSSQYLNVKNILIY
LGAFGQFSISIAYIVVDIYNLEINGISLFELIQNILLLVSSFEYLIETML
LTTLMLFVLDGETIFFLENSWTFFFHTPINILILQLSIFSEYLTKPVYGK
ENSFQIRIIEQGTLDFAIYLVYLYRSICFMIILFLLKPFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 166..188
NoneNo IPR availableTMHMMTMhelixcoord: 348..367
NoneNo IPR availableTMHMMTMhelixcoord: 277..299
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 425..444
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
NoneNo IPR availableTMHMMTMhelixcoord: 57..74
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
NoneNo IPR availableTMHMMTMhelixcoord: 306..328
NoneNo IPR availableTMHMMTMhelixcoord: 465..487