coiled-coil domain-containing protein 170

Overview
Namecoiled-coil domain-containing protein 170
Smed IDSMED30010695
Uniprot Best hitCoiled-coil domain-containing protein 170 OS=Homo sapiens OX=9606 GN=CCDC170 PE=1 SV=3 (E=5.38122e-47)
Length (bp)2535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of coiled-coil domain-containing protein 170 (SMED30010695) t-SNE clustered cells

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30010695) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of coiled-coil domain-containing protein 170 (SMED30010695) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for coiled-coil domain-containing protein 170 (SMED30010695) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010695

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010695SMESG000048767.1 SmedASXL_008993SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010695SMESG000048767.1 dd_Smed_v6_7066_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30010695SMESG000048767.1 dd_Smed_v4_7066_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Match: CCDC170 (coiled-coil domain containing 170 [Source:HGNC Symbol;Acc:HGNC:21177])

HSP 1 Score: 182.956 bits (463), Expect = 1.121e-47
Identity = 150/511 (29.35%), Postives = 282/511 (55.19%), Query Frame = 1
Query:  715 KIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGD----LEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDN-------LKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLV-SIPHSGVTVAV 2211
            K++DL  EN  +KG+I  ++ T    E +   SRE+  ++   V++++       EE  ++ ++L   +E  +  ++ V+I    L       D   +E   +L +  ++L K     + S   ++    ++ +FRE IA LL   LS   S+E++I E++R + +  + +D  + QL+ ++  + EQ  +    +++   +A++ E     L+ ++  LE EL S  V RD+L  +K+K+  FL +L+  MK+D    E  F +  D +L R + +++ E+   I+      +L+R+++  K++L S++LH+ L+R+K+A  E+       E   R  LV   DN       L++K+ ++Q++++  RD +  LKA+L + +++KI    QTK +E L  +  +LE++++K  +K+  +   L+  + EA   K  + N ++ + SE++TL+ +LE A++ EK+L DFR VV ++LGL V  LA+P+Y+II+ LE+LV S  H  VT A 
Sbjct:  196 KLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVS-LLKKSSSELEKSL---KASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEE-------EKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLVHSHQHHFVTCAC 695          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Fly
Match: CG43338 (gene:FBgn0263079 transcript:FBtr0306922)

HSP 1 Score: 68.9366 bits (167), Expect = 1.532e-11
Identity = 98/407 (24.08%), Postives = 179/407 (43.98%), Query Frame = 1
Query: 1171 IKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMD----PYTQEHEFSLIFDGILDRAKAMIQN-----------------------------ENERN-----IDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNA-VQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTV-------AVPVQHYPLKAGFEDA 2253
            IK++LR ++ E +    ++  L  +L +   ++E+  E  + T  + R  E +  +L +R+ +   E+ +       LR D      FL+RLA  M       P     + +L+ + +L+RA+ +  +                               ER+     +  S ++ +L+RR+R L++Q+  RDLHLEL+R+K+A  ED  RG       R   V       +++ K+  ++   R +   +KA+L E  + KI+   + ++++ L   +  LE  + +   ++  L + L+    E+N  +   D A + S+  ++  L + L  A +    L  FR  V R L L   DL  P  D++ RL+ L S  H   T+       A PV  +P    F+D 
Sbjct:  353 IKDKLREILAENQAMHAQMHSLRDQLNS---EHEKLKETQQTTECRLRSGEAQKCELTERLEKCHAEIHT-------LRKDHMGLSEFLQRLALAMNWGECSAPPALGTDTNLMAENLLERAERLAAHCDHEAPHHHHHHHSPDKGCCDHGHGHGKLRRERSCHDIPLKESSSVYNLQRRVRVLREQVQRRDLHLELLRRKLAIIEDGARGKCMLQGERDEAVCRAKKAAKQVDKLSAQLADARSQIAEVKAQLAEAVEYKITSLERARKIDELTTQICDLEDEKTRLLSQLNALKERLK-SSCESNQNRRCRDEALINSMRDDVSRLSSQLSDANQRLSHLQSFRTSVARTLHL--RDL--PETDLLHRLQALCSA-HQEFTMLSKRYETASPVGDHPCPR-FDDP 742          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Fly
Match: CG43338 (gene:FBgn0263079 transcript:FBtr0306921)

HSP 1 Score: 68.5514 bits (166), Expect = 1.774e-11
Identity = 96/407 (23.59%), Postives = 178/407 (43.73%), Query Frame = 1
Query: 1171 IKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMD----PYTQEHEFSLIFDGILDRAKAMIQN-----------------------------ENERN-----IDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNA-VQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTV-------AVPVQHYPLKAGFEDA 2253
            IK++LR ++ E +    ++  L  +L +   ++E+  E  + T  + R  E +  +L +R+ +   E+ +       LR D      FL+RLA  M       P     + +L+ + +L+RA+ +  +                               ER+     +  S ++ +L+RR+R L++Q+  RDLHLEL+R+K+A  ED  RG       R   V       +++ K+  ++   R +   +KA+L E  + KI+   + ++++ L   +  LE  + +   ++  L + L+    E+N  +   D A + S+  ++  L + L  A +    L  FR  V R L L      +P  D++ RL+ L S  H   T+       A PV  +P    F+D 
Sbjct:  326 IKDKLREILAENQAMHAQMHSLRDQLNS---EHEKLKETQQTTECRLRSGEAQKCELTERLEKCHAEIHT-------LRKDHMGLSEFLQRLALAMNWGECSAPPALGTDTNLMAENLLERAERLAAHCDHEAPHHHHHHHSPDKGCCDHGHGHGKLRRERSCHDIPLKESSSVYNLQRRVRVLREQVQRRDLHLELLRRKLAIIEDGARGKCMLQGERDEAVCRAKKAAKQVDKLSAQLADARSQIAEVKAQLAEAVEYKITSLERARKIDELTTQICDLEDEKTRLLSQLNALKERLK-SSCESNQNRRCRDEALINSMRDDVSRLSSQLSDANQRLSHLQSFRTSVARTLHL----RDLPETDLLHRLQALCSA-HQEFTMLSKRYETASPVGDHPCPR-FDDP 715          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Match: ccdc170 (coiled-coil domain containing 170 [Source:ZFIN;Acc:ZDB-GENE-070112-162])

HSP 1 Score: 122.094 bits (305), Expect = 4.093e-28
Identity = 94/308 (30.52%), Postives = 163/308 (52.92%), Query Frame = 1
Query: 1336 DLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDE-------NKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGL-CVDDLAIPNYDIIRRLEKLV------SIPHSGVTVAVPV 2217
            +L DRI+ LE EL +  V +D +  DK+++  F+ +L+ ++K+D    E  F +  + IL RA+ + ++E    ++T     SL+R++++ K +  S+DL+LEL+R+K+   E++ R        R  L   +D+      K+Q++VD+L+ E       N  LKA+L   + ++I+V  Q + +E    NL KLE+ + K  +K+  +T       SE    +  + + +Q     L T  +A+     +EK+LLDF  VV ++LG+ C     IPNY+++RRLE L+      S  H       PV
Sbjct:  372 ELLDRIQSLEDELINARVCKDGMNQDKQQYLRFVEQLSEMLKVDDVAAELGFDMRLEVILTRAQQLSRHEGTALLETKTQTYSLQRKLKEQKSRSESKDLYLELLRRKVQQLEEEKRS-------RSTLALEKDDAALSCKKLQKRVDRLQAELSTLRFSNTELKAQLSHTNQLQITVMEQKQTIEEQNKNLGKLEKKKVKTEQKLTSVT-------SELKSQELKARDEIQQAHRLLDTQSSAIADLTHTEKQLLDFYTVVSQMLGVHCTG--CIPNYEVLRRLEVLIQSRQCHSTAHLHTCWNSPV 663          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: c1qtnf4 (C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-975450])

HSP 1 Score: 199.519 bits (506), Expect = 4.737e-54
Identity = 151/502 (30.08%), Postives = 279/502 (55.58%), Query Frame = 1
Query:  718 IKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLD-LKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMAN--QEDQIRGAL----DENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVT 2202
            I +L  +N  LKG I++++ T    E +   SRE+  +++  V K++     + +   +L   +E    +K+++E     L  RL+      + +++ L + +   +++ L  + +       +   E+F+E++A  LS         EE+I E++R + ++A+ +   I QL+ ++  +SEQ +   E+++E+  +AR+ E +YLD L  R++  E EL S DV RD+L  +K+K+  FL +L+  MK+D    +  F +  + IL RA  +++ E    I+       L+R+++  K+ + S++LH+EL+RKK+A   +E Q+R AL    DE +       T   L++K+ ++Q++++   D N  LKA L + +++KI    Q K +E L  ++ +LE+ + K  +K+  +   LE  + +A   K  S N ++ + SEL+TL+  LE   + EK+L+DFR VV R+LGL V+ LA+P+Y+II+RLE L+   H  + 
Sbjct:   82 INELYKDNTELKGSIASLEQTVNVHETESKGSRETIMRLVSEVSKEQKKASSFAKQLDSLQKNLESTSDDKESLEREIKILKDRLSASQRAWEASKQELGQVKKSSTELDLSLKSTRGEAKAAHSLHESFKETVAAALSHDSIAVKPKEEAILEKIRDMYHKAENRKTIISQLEERVFKLSEQLQTQTELHQESMSRARKAE-QYLDDLGGRLKLAEGELVSGDVMRDNLSHEKQKYMKFLEQLSEKMKIDRVATDVGFDMRLEAILGRADQLVKLETNAIIENKTRAQGLQRKLKAQKETIDSKELHMELLRKKIAQLEEEKQVRTALAVERDEANL------TVRRLQKKVDRLQKELNVALDSNTGLKARLSDTNELKIKTIEQHKTIEELNKSVDQLEKEKGKTQKKLVSVKSELEFTERDAQEEKERSANLLEVVTSELKTLKKTLEEVVKREKQLVDFREVVSRMLGLNVNVLALPDYEIIKRLEGLIHNHHHHIV 576          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Match: ENSXETT00000000426.1 (coiled-coil domain-containing protein 170-like [Source:NCBI gene;Acc:100488825])

HSP 1 Score: 105.145 bits (261), Expect = 1.498e-22
Identity = 117/531 (22.03%), Postives = 268/531 (50.47%), Query Frame = 1
Query:  673 LNLESDSEP-GVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHYPLKAGFEDANRL 2262
            +++E   +P  ++  K++ L  E+ + K ++S+++     R+ +Y  SRE+  Q++  +DK K  +       K++  E ++  + K++ E     L  ++ D        Q+ L  KE +L+++    R S+      +   ++F   +A +LS        +EE+IKER++ + +  +E      +L  K+  +++Q ++  ++  E   KA + E    + ++ ++ L+ +L+S ++ +D   ++++K   FL ++A  + +         +  ++ +L+RA+ + + +     D+   I +L+++I    +++  +   +E + KK+   E +    L  +    G + T   L++K+ ++Q ++ +++   + L A+L + SD+K     Q K +E L   L+KLE++++K A+K+  L   L+  + E    K    + V+++ +EL T + ALE   + EK+L+ FR  + R++G  ++ LA+P+++I  +L++++              H P   G  D ++L
Sbjct:  235 MDVEEQEDPLNILLTKVEKLIKEHFVQKSKLSSLEEVLAGRQVEYKASRETIVQLVSEIDKHKKTVAGLEAQLKSIKRERDETLLAKQSAEQEKELLLGKIKDNHKEWSSFQQELVRKEKKLNELDRTLRTSDYEAKASHSLHQSFIIQLATVLSNGFITVPRTEEAIKERIQEICSREQEWKVTTDELQEKVLKLTKQLDQQRDLYHEAVTKAYKAEEILQENQESLKHLKGKLTSEEMIKDGFNSERKKLKKFLLQMAEKLNVVQDISSGSLTSQYEVLLNRAEEVTERDKGFLKDSKTLIYNLQKKITSQAEKIELKSTKIEQLEKKIKQLEKEKEQQLLLSAENSGSL-TAQKLQKKVERLQGQLSEMKITTQTLTAQLVDMSDLKERNMQQKKTIEELSRALEKLEKIKEKAAKKVVSLKTELDYSEHEFRGDKERCQHMVEAVTNELHTAKRALEEVAKREKQLVYFREAITRMMGFNLNTLAVPDHEIFDQLKRVLRT------------HGPTDPGRADRSKL 752          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 143.28 bits (360), Expect = 9.316e-35
Identity = 149/538 (27.70%), Postives = 275/538 (51.12%), Query Frame = 1
Query:  649 FYQELNTYLNLESDSEPGV---VFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDK----GDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSF-VNREFET--------FRESIAGLLSTSLSRCMSSEESIKERLRILINE-------AKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMA--NQEDQIRGAL----DENDF--RKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLE 2169
            F  +L+  L+L+   E      +  K+++L  E   LKG+++ ++ T    E +   +RE+ R++   V +++       EE  ++ ++L   +E     ++ V+++   L   LA        +QR  D  + +L++  L KR    ++S   +RE  T        FRE +  LL +      S+E++I ER+R L  E       A + + +I +   KL N SE +++  +       +A   E +   L+ ++  LE EL S DV RD+L  +K+K+  FL +L   MK+     +  F +  D +L R + +++ E+   I+      +L+R+++  K++L S+++H+ L+R+K+A   QE + R AL    DE     RK        L++KL +MQ+++   ++ N  LKA+L + +++KI    QTK +E L  +  +LE++++   +K+  +   LE  + EA   +  S   ++  + EL+TLR +L+ A+R   +L DFR VV  +LGL +     P+Y+II+ LE
Sbjct:  174 FRAQLHDCLSLDKKHEEASDEDLILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERL---LA--------SQRAWDASKQELTQ--LRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEEESQRRMASQLEAQISEFVGKLGNESESHQKALQ-------RAHVAEKKLEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQLVRLESNAVIENKTMAHNLQRKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALAVERDEAHLAMRK--------LEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLE 683          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Match: Ccdc170 (coiled-coil domain containing 170 [Source:MGI Symbol;Acc:MGI:2685067])

HSP 1 Score: 142.895 bits (359), Expect = 1.200e-34
Identity = 149/538 (27.70%), Postives = 275/538 (51.12%), Query Frame = 1
Query:  649 FYQELNTYLNLESDSEPGV---VFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDK----GDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSF-VNREFET--------FRESIAGLLSTSLSRCMSSEESIKERLRILINE-------AKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMA--NQEDQIRGAL----DENDF--RKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLE 2169
            F  +L+  L+L+   E      +  K+++L  E   LKG+++ ++ T    E +   +RE+ R++   V +++       EE  ++ ++L   +E     ++ V+++   L   LA        +QR  D  + +L++  L KR    ++S   +RE  T        FRE +  LL +      S+E++I ER+R L  E       A + + +I +   KL N SE +++  +       +A   E +   L+ ++  LE EL S DV RD+L  +K+K+  FL +L   MK+     +  F +  D +L R + +++ E+   I+      +L+R+++  K++L S+++H+ L+R+K+A   QE + R AL    DE     RK        L++KL +MQ+++   ++ N  LKA+L + +++KI    QTK +E L  +  +LE++++   +K+  +   LE  + EA   +  S   ++  + EL+TLR +L+ A+R   +L DFR VV  +LGL +     P+Y+II+ LE
Sbjct:  168 FRAQLHDCLSLDKKHEEASDEDLILKLRELYKEPTFLKGQLATLEETVTVHEMEAKANRETIRRLAAEVSREQTKAASWAEEKDKLNQDLLSAVEGRTALEREVKLYQERL---LA--------SQRAWDASKQELTQ--LRKRCQELDVSLKASREATTASQSRNSCFREKLTALLCSRFDTAESTEDAILERIRELGIEEESQRRMASQLEAQISEFVGKLGNESESHQKALQ-------RAHVAEKKLEALQSQLSHLEGELLSGDVVRDNLFLEKQKYLKFLDQLTEKMKLGHVAADLGFDVCLDVVLARIEQLVRLESNAVIENKTMAHNLQRKLKTQKERLESKEVHMNLLRQKIAQLQQEKEARSALAVERDEAHLAMRK--------LEKKLERMQKELSACQEHNTELKAKLADTNELKIKTLEQTKAIEDLNQSRDELEKMKENAEKKLMLVMSELENTEQEARAHQERSRAMIELASLELKTLRKSLDEAERRGMQLADFREVVSSMLGLNMTSHDPPDYEIIKCLE 677          
BLAST of coiled-coil domain-containing protein 170 vs. UniProt
Match: sp|Q8IYT3|CC170_HUMAN (Coiled-coil domain-containing protein 170 OS=Homo sapiens OX=9606 GN=CCDC170 PE=1 SV=3)

HSP 1 Score: 182.956 bits (463), Expect = 5.381e-47
Identity = 150/511 (29.35%), Postives = 282/511 (55.19%), Query Frame = 1
Query:  715 KIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGD----LEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDN-------LKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLV-SIPHSGVTVAV 2211
            K++DL  EN  +KG+I  ++ T    E +   SRE+  ++   V++++       EE  ++ ++L   +E  +  ++ V+I    L       D   +E   +L +  ++L K     + S   ++    ++ +FRE IA LL   LS   S+E++I E++R + +  + +D  + QL+ ++  + EQ  +    +++   +A++ E     L+ ++  LE EL S  V RD+L  +K+K+  FL +L+  MK+D    E  F +  D +L R + +++ E+   I+      +L+R+++  K++L S++LH+ L+R+K+A  E+       E   R  LV   DN       L++K+ ++Q++++  RD +  LKA+L + +++KI    QTK +E L  +  +LE++++K  +K+  +   L+  + EA   K  + N ++ + SE++TL+ +LE A++ EK+L DFR VV ++LGL V  LA+P+Y+II+ LE+LV S  H  VT A 
Sbjct:  196 KLRDLRKENEFVKGQIVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVS-LLKKSSSELEKSL---KASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEE-------EKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLVHSHQHHFVTCAC 695          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: gnl|BL_ORD_ID|20309288 (tr|A0A1S3J8Y0|A0A1S3J8Y0_LINUN coiled-coil domain-containing protein 170 OS=Lingula unguis OX=7574 GN=LOC106171087 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 3.076e-88
Identity = 239/775 (30.84%), Postives = 424/775 (54.71%), Query Frame = 1
Query:  148 IELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSE------------------TNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLN---------LESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHY------PLKAGFEDANRLLG---RKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY 2364
            +EL++Q+K  KE+L+KKD+ I  LS++D    +   S+                     ++ E A+L +++ +   +  + +I+++ K D+++E+R       E    L ++   ++ ++   +  +  L  A  R E+ ISSLQKE  ++ D++V+LE  L++        E+     AA     YQE+ T++            S S   ++ +K KD+ +EN ++KG+++++    E+ E +   SRE+  +++  V++++    +Y     NL  E +   + K+ +E     L +RL         T+  LDE+E +LS +  E RES+ ++     ++  FRE++A +LS +      SE+SIK+++  L+   K+K++ I  L+ K+KN+ EQ++  Y++ KE+  +A R+E+E  D+ +R+ + E +L++ +V RD LR DKE +  F+ ++A VMKMD  + E  F +  + +L RA+ +++ E +   D S  I +L+R+I+ +K+QL S+DLH++L+RKK+   E+++ G  +    R G       L+++  K Q  + + R E   LKA+L + +++KI    Q KE+  L+  + +LE++R KQA+KIA L    E  ++E    K  S N VQ+L+SELRT +  LE   + E++L+D R V+ R+LGL V+ LAIP+Y+II RLEKL+   H+    A  ++            G++DA  +L    R+ RSP R       R RS+SP+   RD R Y
Sbjct:   90 MELQDQVKSYKEELLKKDQLISQLSTVDATNSSRGLSQRSIEIAKLETVFGAERMSAETARGEAAALHVKVEHLQAQNKDLQIQVESKDDKIKEIRKEVEKYKENDARLSSLVQSLRDRLHEAESQSGSLEAAAGRCEVTISSLQKENREAQDRIVELESRLRSHLSEREEAEQK----AAAAEKKYQEIWTHIGSALGEDGISPASSSSVDILVRKAKDIIAENAIMKGKLTSLHEALENTELETKASRETIMRLVSEVNREQNASSKYTVEMDNLRMERDNAIMSKRELEQEIKLLKERLDASQRAWNATRHELDEREKRLSHLDREARESSFSVRNYQTQYNAFRETLASILSDAFRTVPPSEDSIKDKIGQLLAANKDKESHIELLESKVKNLQEQFQNQYDLQKESEHRAHRLEVERRDIAERLHKYEADLAAGEVFRDGLRTDKENYLKFMEKMAEVMKMDRISSEIGFDMNGETLLTRAEQLVKLEADALADRSTHIYNLQRKIKTMKEQLESKDLHMDLLRKKIVALEEKLVGRSELEKERDGETIRVRKLQKQNEKYQVLLQEARVEITDLKAQLMDSTNLKIKTMEQEKELAGLEKTVSELEKIRHKQAKKIAGLKNDFEATENEFAEKKSSSLNTVQALSSELRTTKQLLEDTSKRERQLVDLRQVISRMLGLDVNTLAIPDYEIISRLEKLIQTHHAHTITAAGLESALEDMEDGFIRGYQDARVVLAATPRRSRSPTRA----KTRARSMSPVR--RDPRSY 854          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: gnl|BL_ORD_ID|23907699 (tr|K1Q8J9|K1Q8J9_CRAGI Coiled-coil domain-containing protein C6orf97 OS=Crassostrea gigas OX=29159 GN=CGI_10014879 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 2.635e-84
Identity = 237/775 (30.58%), Postives = 408/775 (52.65%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSETNN----------------SKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTED----NLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHY------PLKAGFEDANRLLGRK-----RRSPNRTIQQES-GRPRSVSPIHDLRDSRKY 2364
            R +  E++EQ+K+ +E+  KK+  I+ LSSMD        S  +                 +++ELA+LQ++      ++ ENE +L+ K  ++ EL++L     E    L AM    + ++   +  A        RSE  +S LQ+++ DS DK++                    E  + +  +  +   T +N +S  +    + ++ DL  EN +LKG+I  +  T    + +   SRE+  +++  V K++     +     NL  E +    EK+ +E   + + +RL      L+  +  LD K+++LS +  E R +++++  V+ E   FRE +A +LST   RC  S + I  R++ ++ + ++   K+  L+ ++K ++EQ E  YE++K    +AR+ E + +   +R+R  E EL++ DV RD  + DKEK+   L+RL   MKMD  + +    +  D ++ RA+ +++ E +  +D S  I +L+R+++ LK+QL S+DLHL+L+RKKM + E+++ G  +    R    DTE      L++ + K + ++  L+ EN  LKA+L   S++++    Q KE+E L   + +LE VR+KQ+ KI  L   +E+   +    + VSDNAVQ+L+SELRT +NAL   +  EK+LLDFR VV R+LGL ++ LA+P+Y+II RLEKL+   HS     + ++           +G+ED  R LG       RRS  R  ++ +  R RS+SP   + D R Y
Sbjct:   18 RRQMTEMQEQIKILREENQKKESLIQQLSSMDAVPKVHIRSSADTLRHDTIYLGDRHAVETARSELAALQVKTDKLIMQIRENEAQLESKEVKIRELKSLYETSKENESKLTAMLESYRQQILELESKAGSYETVVGRSEFTVSELQRQIRDSNDKIL--------------------ELESRIRKHLDERERTEMNFQSMEKK---YSEMTDLVQENALLKGKIVTLNETLNSTQLESKASRETIMRLVSEVGKEQKVATRFTSEIDNLRLERDTAITEKRNMEREMTMMRERLDANMRALEAARAELDLKQSRLSSLDREYRVNSEDIRKVHTEAHLFREQVASVLSTFDERCDISSDFILNRIKTILQDNRDLVVKVQSLEERIKTLTEQLETQYELHKTAAHRARKAENDLMSYDERLRSAEGELAAGDVLRDEFKTDKEKYLRALQRLGEKMKMDRISIDLGLDMTIDALISRAEQLVKLEQDTIVDKSTHIYNLQRKVKSLKEQLESKDLHLDLLRKKMTSLEEKLLGKTEIEKER----DTESFRIRKLEKLIEKFKLQITDLKHENTNLKAQLLGSSEIQMRTMEQRKEIEELVAQVDELENVRKKQSHKIKHLKDEVEMSSQQNQEKRLVSDNAVQALSSELRTSKNALNSIQNREKQLLDFRNVVARMLGLDINTLAVPDYEIISRLEKLIQAHHSHAFNTMSMEEALADMEDGFLSGYEDYRRTLGNTEASNYRRSRERVKRKAARCRARSMSPTRKV-DPRVY 764          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: gnl|BL_ORD_ID|22576002 (tr|A0A2C9LCU0|A0A2C9LCU0_BIOGL Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055479 PE=4 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.536e-77
Identity = 227/771 (29.44%), Postives = 419/771 (54.35%), Query Frame = 1
Query:  151 ELEEQLKVCKEDLIKKDEHIKVLSSMD--IKQCTSPNS------------ETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEP-----GVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHS-------------GVT-VAVPVQHYPLKAGFEDANRLLGRKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY 2364
            EL++Q++  +E+L KKD  I+ L S++   K   +P+S              + +++ELA++Q++L     ++ + + E++ +  +++EL++L  +  E    L +M   ++ K+A  +  A        R E  IS+LQ+E  +  DK+V LE  L+  T ++   E    +     +    ++++ L  E  ++P      +V +K+ D+  EN MLKG+I  +     + + +   SRE+  +++  V +++     Y    +NL  E +     ++ +E     L +RL      L+ T+  L  KE + S +  + RE   N+   + +F+ FRE +A LLS++    + SEE++KE +R L+ + KE   ++ + + ++K+++EQ +    I+++   + +R E+E  DL +R+   E EL++ D  RD  + DKEK+   L++L  +MKMD  + +    L  D ++ RA+ +++ E +   D +  + +L+R+I+ LK+QL S+DLH++L+RKKM N E+++ G +D    R+        L++ + K + ++   R E + LKA+L   S++K+    Q K++E L   +++LE +R++Q+ KI++L  +++  ++     K  S+NAVQ+L+SELRT +NAL+  K  EK+L+DFR VV R+LGL ++ LA+P+Y+II RLEKL+   H+             GV   + P+ H  + A     + ++ R R    R   +   R RSVSP+   RD R Y
Sbjct:   69 ELQDQVRNFREELKKKDNLIQHLVSLESAPKVPRAPDSYRLDSLYLGERSAVDMTRSELAAVQVKLDRAQAQIADFQREMESRDIKIKELQHLLDSSRETENRLGSMVASLRDKLAEYESRAGSYETVANRGEFTISTLQRENRELSDKIVDLEQRLRKKTEDHELAESKLVTEGRRHNELLSQISSLLYTEDLTDPYGPSVDIVIRKLNDIIQENAMLKGKIMTMNEHLNETQLETKASRETIMRLVSEVGREQKHATRYTSDIENLRLERDNALAARRDLEREIDLLKERLDASHRALEATKNELQLKENRFSSLDRDLREKTHNVRSASTQFDLFREQLANLLSSADINVVPSEENVKESVRRLVTDRKELTLRLDEYENRVKHLTEQLDNELTIHRDMAQRCKRFEVEAADLAERLHSAEAELAAGDCLRDGFKFDKEKYLRGLQKLGEIMKMDRISLDLGLDLTMDALIARAEQLMKLEADALADKTSHVYNLQRKIKALKEQLESKDLHIDLLRKKMTNLEERMHGRIDIEKQRESESIRVQKLEKLVEKYKLQLQDSRHEVQNLKAQLLGSSELKVRTLEQRKDIEELAKQIEELEEIRKRQSRKISELKSTVDNTETTFQEKKVASENAVQALSSELRTTKNALDTLKYREKQLVDFRTVVARMLGLDINTLAVPDYEIITRLEKLIQAHHATTFSTLSLEDALQGVHEGSAPLFHNTIDA----TDPVIARSRERSRRKAAKLRTRARSVSPMR--RDPRIY 833          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: gnl|BL_ORD_ID|23516482 (tr|A0A210PKU6|A0A210PKU6_MIZYE Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09803 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.877e-76
Identity = 223/728 (30.63%), Postives = 394/728 (54.12%), Query Frame = 1
Query:  151 ELEEQLKVCKEDLIKKDEHIKVLSSMD-IKQCTSPNSE---------------TNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSE-----PGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEK-KAVEIHNSE------LTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQH--YPLKAGF 2244
            EL +Q+K  KE+L KKD  I+ L SMD I + T  +                  + +++E+A+LQ++       + E   E + K  +++EL  L     E  + L ++ +  + ++   +  A     A  RSE  +S+LQ+++ +  +K+++LE  L+    +    E   +S+         +L + L +ES        P  + +++ DL  EN +LKG+I  +       E +   SRE+  +++  V K++       ++    T EI+ L++E+ +A+   N+       L +RL      ++ T+R LD +E ++S +  E R  + ++  ++ +  TF+E +A +LST   R   SEE+I ER++I+  E  E  N++  L  ++K ++EQ E  YE++K    +AR+ E +  +   R+R  E EL++ DV RDSLR D+EK+   L++L  +MKM+  + +    +  + ++ RA  +++ E +   D S  I +L+R+I+ LK+QL S+DLH++L+RKKM + E+++ G  +    R G       L++ + K + +   LR E   LKA L   S++KI    Q KE+E L   + +LE+ R +QA+KI+ L  S+   +SE+   + ++DNAV +L+SELRT +NAL   +  EK+LLDFR VV R+LGL +  LA+P+Y+II RLEKL+   H+     + ++     +++GF
Sbjct:   72 ELNDQVKSFKEELRKKDALIQQLVSMDAIPKVTVRSGADAYRHDAVFMGDRHAVDTARSEVATLQVKNEKLQIHISELRTEGESKDIKIKELMTLYNTSKENEQRLTSLLDSHRNQIIELEGKAGSYETAVGRSEFTVSALQQQIREGQEKILELEGRLRTHLDDREAAETKCQSVTKRNDELLFQLTSLLQVESMQSGCCLCPEDIVRRLTDLVQENAILKGKIVTMSECLNSTELETKASRETIMRLVSEVGKEQ-------KVATRYTSEIDNLRMERDEALSTRNTYEREIELLKERLEASHKSVEATRRELDLRETRISSLDREYRSHHHDVHVISTQLGTFKEKLAAILSTPDYRLEMSEEAIIERIKIIYQENCEFINRMESLQERVKTLTEQLESQYELHKSAASRARKAETDLSEYDSRLRSAEGELTAGDVLRDSLRGDREKYLRCLQQLGEIMKMERISIDLGLDMTMEALMARADQLVKMEKDALADKSTHIYNLQRKIKALKEQLESKDLHVDLLRKKMTSLEEKLLGKTEIMKERDGETYRVRKLEKVVEKYKLQNQDLRHELTNLKANLLGSSEMKIRTLEQRKEIEELAAQVDELEKSRSRQAQKISKLKNSVNYQESESQEKRVIADNAVHALSSELRTTKNALISLQNREKQLLDFRGVVSRMLGLDLSTLAVPDYEIISRLEKLIQAHHNHTFTTMSMEEALADMESGF 792          
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Match: gnl|BL_ORD_ID|18184108 (tr|A0A1I8G8S9|A0A1I8G8S9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 2.662e-75
Identity = 204/689 (29.61%), Postives = 366/689 (53.12%), Query Frame = 1
Query:  268 NSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALD---ENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHY--PLKAGFEDANRLLGRKRRSPNRTIQQESGRP 2319
            ++++E+A+L++++     KL E ++EL    +  +  R     L E     +A+N E+  ++   + T        +RS  A+  LQ++L  + D+      +L+    + +  +  R S    ++ F   L  +L +   +    +  +  +L  E   L+    + +      E +   +RE+ ++++  V+++      Y   +       EKL  E+  +      L  RL     +L+ T+  L EK++ ++KV    RE  +      ++  +  +S+A  LST  S   ++EE++KER+  L  + KE        + + +  ++Q E     ++E   +ARR E+E  D+ +R+R +E EL++ DV RD L AD++KFY ++++LA  MKMD    +  F ++ D +L RA+ + +  ++   D + T+ SL+R+++ LK+QL SRDLH++L+RKK+   E++  G ++   E D   G V     L+++L K Q +++Q R E  +LKA+L ECS++K++   Q +E+  L++ ++KLE+VRQKQA+KI+ L   +E    E       ++ A+ +L+SELRT ++ALE A+R E +LLD R VVGR+LGL V+ LA+P+Y+I+ RLE+L+    S V  AV        ++A F D      R + S     +QE  RP
Sbjct:   54 SARSEVAALRVKVDGLQAKLREKQLELDSALESAQRHRAEADRLREDNARQLALNAELSRQIDCCEATRGSYEEVKSRSGQAVFELQEQLRRAQDRT----RDLEAKLADRDVRDAGRSSSERRLTEFAASLAYHLEVSESASLDTLINRASNLAQEAATLRARSRSQEEQLAAHEAEARANRETIQRLLAEVNREHRAAAAYQTHQSEFRTGTEKLTAERDDLARQVELLEARLESNRRVLEATKAELAEKDSHVAKVDSTSRELQRRAEDSEQQLASLLQSLASTLSTQFSHVTATEEAVKERVCALCRDYKELSEASAAHEERSRKAAKQLEAQVSNSREREAQARRAEVELRDMHERLRAMESELAAGDVVRDGLAADRQKFYKYMQQLAEAMKMDQVGADIGFDMLGDALLARAQQLARLSDDAAHDKASTVYSLQRKVKALKEQLESRDLHMDLLRKKIGQLEERAAGRVEVERERDNENGRV---RRLQKQLEKSQAQLEQARAEIVSLKAQLLECSNLKLAALEQDRELAALENTMEKLEQVRQKQAKKISLLKSEVETRQRELGDKSTAAEGALSNLSSELRTTKSALEEARRREHQLLDLRAVVGRMLGLDVESLAVPDYEIVNRLERLIQAHQSNVYTAVSANEAMQDMQASFLDGYTDAQRHQLSLTAASKQEPKRP 735          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Cavefish
Match: CCDC170 (coiled-coil domain containing 170 [Source:HGNC Symbol;Acc:HGNC:21177])

HSP 1 Score: 85.5001 bits (210), Expect = 9.647e-17
Identity = 78/269 (29.00%), Postives = 143/269 (53.16%), Query Frame = 1
Query: 1432 FLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMA--NQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLA-IPNYDIIRRLEKLV--SIPHSGVTVAVPVQH 2223
            FL +L+  MK++    +  F +  + IL RA  + + E    ++    + SL++++++ K  L S+DLH++L+R+K+A  +++ + R AL     R+ +  T   L++K+ ++Q ++  +R  N  LKA+L + +++KI V  Q + +E    +L  LE+ + K  +K+  +   L+  +  A      ++  + S A  +  L      A R EK+LLDF  VV ++LG  VD  A + N + I+RLE L+  S PH  +     V H
Sbjct:  350 FLEKLSEKMKIEHIATDLGFDMRLEAILARADQLTRQEGTALVENKTLVYSLRKKVKEQKVMLESKDLHMDLLRRKVAQLDEDKRSRSALAVE--REDVTLTNRKLQKKVERLQAELSVMRFSNTELKAQLADTNELKIRVMEQKQAIEKQSKSLGTLEKNKAKVEKKLNTVKTELQNQELRARDELHQANKLLHSQAGTMAEL------AHR-EKKLLDFCTVVSQMLG--VDMPATLLNSEAIKRLEALIHSSHPHFPIDCHCAVPH 607          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006087.1 (pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 gene:ENSPMAG00000005504.1 transcript:ENSPMAT00000006087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 6.515e-37
Identity = 87/271 (32.10%), Postives = 152/271 (56.09%), Query Frame = 1
Query: 1420 KFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRG-----ALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPV 2217
            ++  FL  L   +K++    +    L  + +L RA  + + E++   D    + SL+R+++  K++L S++LHLE++RKK++  E++ RG     A++ +D    L      L+ +  ++Q+++D  R  N  LKA+L +   +KI    Q K +  +  ++ +LE+V+ K A K+A L   L++    A      +   +++   ELRT++ ALE   R EK+LLDFR VVGR LGL V  LA+P+Y+++ RLE+LV   H+ V  A  +
Sbjct:    1 QYMRFLEDLGRRLKVEELGVDVGLDLQLEAMLTRADHLAKLESDSTADGKTLLYSLQRKVKAQKEKLQSKELHLEMLRKKLSQLEEE-RGTRTALAVERDDANAAL----HKLRRRSERLQQQLDAARTANTELKAQLADAHGLKIQTLEQNKTIAEMGRSIDRLEKVKDKAARKVASLRGQLDMTAEGAQEEMERTRVLLEATTGELRTVKRALEEVARREKQLLDFREVVGRTLGLDVGSLAVPDYEVVARLERLVRAQHASVATAAAL 266          
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Match: EDO48576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIV6])

HSP 1 Score: 175.637 bits (444), Expect = 2.957e-47
Identity = 128/415 (30.84%), Postives = 229/415 (55.18%), Query Frame = 1
Query: 1096 FETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQI--RGAL----DEND--FRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHY------PLKAGFEDANRLLGRKRRSPNRTI 2298
             + F   +A ++S      +  E++I  R+  +I   ++       L ++L+N+S++ +    +++ T  +A + E +  + ++R+  LE EL S DV RD L+ DK KF  F  ++A  MK+D    +  F +  + ++ RA+ +++ E +   D   TI +L+RR++  K Q+ S+DLH  L++KK+ + E+ +  +G +    DEN   +RK +   E        K+QR++   + E   LKA+L E S++K++   Q K +E L+  L KL R +QK  E++  +   L + +SEA  T+  +    Q L SEL T + ALE ++  EK+LL+FR V+ R+LGL V++L++P+YDII RLE+LV   H+       ++          ++G++DA  +L  +  SP +T+
Sbjct:  101 LQGFIRQVAQMVSEVNEEMLHDEQTILNRVDAMIKGYRDFKTTSESLHVRLRNLSDELDSQRNLHRTTLKRATQAEEQLKEAQERVTGLEGELLSSDVERDGLKEDKRKFVAFCEKMARTMKLDEIADDVGFDVNGEALVARAEQLVKLETDALDDRKTTIYNLQRRLKWAKQQIESKDLHQGLLKKKVTSLEELLHDKGRVEVERDENSIKYRKLVKHNE--------KLQRELLDYKQEVTNLKAKLMEISELKVTTIEQCKTIEGLEQALNKLARSKQKTKEQLDGIKSELGVAESEARETRSKASMTQQQLRSELETTKLALEESRIREKQLLNFRQVLARLLGLDVNNLSVPDYDIISRLERLVQAHHAHSITTHSLEGSLQDLENGFRSGYDDAIAIL--RTPSPMKTM 505          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000048767.1 (SMESG000048767.1)

HSP 1 Score: 1424.07 bits (3685), Expect = 0.000e+0
Identity = 742/743 (99.87%), Postives = 743/743 (100.00%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHYPLKAGFEDANRLLGRKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY 2364
            RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVEELRNLNRNLNEQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVKLEDELKNLTLNN+TTEKSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHYPLKAGFEDANRLLGRKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY
Sbjct:    7 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVEELRNLNRNLNEQIESLVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVKLEDELKNLTLNNSTTEKSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPVQHYPLKAGFEDANRLLGRKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY 749          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.075e-44
Identity = 189/718 (26.32%), Postives = 358/718 (49.86%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTS--------PNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCAN-------ARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEI----HNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYER-----------NYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGV 2199
            R++  +L+EQLK  ++++++KD+ I  LS +++K C          PN      + E+A+L ++L N  N+L E   ELK K   VE ++ +N  L E+I  L       Q+ + + ++  N+   A         R+ + ISSLQ ELT++   +V+ +   K L    +    +R+ L   I +    + T    E       V  K+K L  EN+  K +I +++   + R+ +   SR++  +++  +  ++           NLT E+++ +V K  +E     +  +LT    +I+ +L +   I  ++  ++S      +++++  + +N     F  S+  +LS +     +   +I E +   +         +LQ    +KN++E               N  I+ E   + R   L   DL  R++  E +L S  +  D L  DK K++  L  LA VM M+   ++  F +I + +  RA  + + E +   D   T  SL R++++LK+++HS+DLH++L+ KK+A+ E + +        R   + +   L +   K+Q +V+ LR E   LK  L   + +K++  S  +E+++L   + KLE +RQKQ++ +++   S    + E N  K  +D A+ SL +ELR ++++L   KR E ++++ R V+ ++LGL +D+LAIP+++II RLE+L++  HS +
Sbjct:   43 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARL-------QVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSI-TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIE-LLTQDNEIKSKRIQEISATAKTNQQTDEQQALINH----FINSLISILSENYKTPKNDSLTIFEWIIGCVK-------SLLQNKGDVKNLNETINSLRSDIIDIEKLNSRISSEEDPQLR---LTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 737          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.196e-44
Identity = 189/718 (26.32%), Postives = 358/718 (49.86%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTS--------PNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCAN-------ARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEI----HNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERLRILINEAKEKDNKILQLDMKLKNVSEQYER-----------NYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGV 2199
            R++  +L+EQLK  ++++++KD+ I  LS +++K C          PN      + E+A+L ++L N  N+L E   ELK K   VE ++ +N  L E+I  L       Q+ + + ++  N+   A         R+ + ISSLQ ELT++   +V+ +   K L    +    +R+ L   I +    + T    E       V  K+K L  EN+  K +I +++   + R+ +   SR++  +++  +  ++           NLT E+++ +V K  +E     +  +LT    +I+ +L +   I  ++  ++S      +++++  + +N     F  S+  +LS +     +   +I E +   +         +LQ    +KN++E               N  I+ E   + R   L   DL  R++  E +L S  +  D L  DK K++  L  LA VM M+   ++  F +I + +  RA  + + E +   D   T  SL R++++LK+++HS+DLH++L+ KK+A+ E + +        R   + +   L +   K+Q +V+ LR E   LK  L   + +K++  S  +E+++L   + KLE +RQKQ++ +++   S    + E N  K  +D A+ SL +ELR ++++L   KR E ++++ R V+ ++LGL +D+LAIP+++II RLE+L++  HS +
Sbjct:   39 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARL-------QVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSI-TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIE-LLTQDNEIKSKRIQEISATAKTNQQTDEQQALINH----FINSLISILSENYKTPKNDSLTIFEWIIGCVK-------SLLQNKGDVKNLNETINSLRSDIIDIEKLNSRISSEEDPQLR---LTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 733          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 171.785 bits (434), Expect = 3.465e-44
Identity = 188/716 (26.26%), Postives = 360/716 (50.28%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTS--------PNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCAN-------ARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEI----HNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERL-----RILINEAKEKDNKILQLDMKLKNVSEQY----ERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGV 2199
            R++  +L+EQLK  ++++++KD+ I  LS +++K C          PN      + E+A+L ++L N  N+L E   ELK K   VE ++ +N  L E+I  L       Q+ + + ++  N+   A         R+ + ISSLQ ELT++   +V+ +   K L    +    +R+ L   I +    + T    E       V  K+K L  EN+  K +I +++   + R+ +   SR++  +++  +  ++           NLT E+++ +V K  +E     +  +LT    +I+ +L +   I  ++  ++S      +++++  + +N     F  S+  +LS +     +   +I E +      +L N+   K+     L+  + ++        + N  I+ E   + R   L   DL  R++  E +L S  +  D L  DK K++  L  LA VM M+   ++  F +I + +  RA  + + E +   D   T  SL R++++LK+++HS+DLH++L+ KK+A+ E + +        R   + +   L +   K+Q +V+ LR E   LK  L   + +K++  S  +E+++L   + KLE +RQKQ++ +++   S    + E N  K  +D A+ SL +ELR ++++L   KR E ++++ R V+ ++LGL +D+LAIP+++II RLE+L++  HS +
Sbjct:   43 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARL-------QVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSI-TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIE-LLTQDNEIKSKRIQEISATAKTNQQTDEQQALINH----FINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLR---LTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 742          
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Match: SMESG000074429.1 (SMESG000074429.1)

HSP 1 Score: 171.785 bits (434), Expect = 3.823e-44
Identity = 188/716 (26.26%), Postives = 360/716 (50.28%), Query Frame = 1
Query:  136 RSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTS--------PNSETNNSKAELASLQLQLSNTFNKLDENEIELKCKADQVXXXXXXXXXXXXQIESLVAMNNEMQMKMASTDQTANDLSCAN-------ARSELAISSLQKELTDSLDKVVXXXXXXXXXXXXXXXXXXSRESLAAVISNFYQELNTYLNLESDSEPGVVFQKIKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDLEEYIRMKKNLTFEIEKLQVEKKAVEI----HNSELTKRLADIDGILKETQRILDEKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEESIKERL-----RILINEAKEKDNKILQLDMKLKNVSEQY----ERNYEINKETGLKARRVELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMDPYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQLHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQRKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQKQAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRSEKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGV 2199
            R++  +L+EQLK  ++++++KD+ I  LS +++K C          PN      + E+A+L ++L N  N+L E   ELK K   VE ++ +N  L E+I  L       Q+ + + ++  N+   A         R+ + ISSLQ ELT++   +V+ +   K L    +    +R+ L   I +    + T    E       V  K+K L  EN+  K +I +++   + R+ +   SR++  +++  +  ++           NLT E+++ +V K  +E     +  +LT    +I+ +L +   I  ++  ++S      +++++  + +N     F  S+  +LS +     +   +I E +      +L N+   K+     L+  + ++        + N  I+ E   + R   L   DL  R++  E +L S  +  D L  DK K++  L  LA VM M+   ++  F +I + +  RA  + + E +   D   T  SL R++++LK+++HS+DLH++L+ KK+A+ E + +        R   + +   L +   K+Q +V+ LR E   LK  L   + +K++  S  +E+++L   + KLE +RQKQ++ +++   S    + E N  K  +D A+ SL +ELR ++++L   KR E ++++ R V+ ++LGL +D+LAIP+++II RLE+L++  HS +
Sbjct:   39 RAQLYKLQEQLKTFQDEIMRKDKLIDQLSKIELKNCPENFLEPKLLPNRNICVEREEVAALNVKLDNMRNELSEAMCELKQKETIVESMKRINCELREEIARL-------QVALGNCNKDVNEFGEAKEAFETMRQRNNILISSLQDELTETQQGLVENKVYAKELEDQISDISAARDELQRQIQDIKLSI-TEATSEEIYNVSEVINKVKTLIFENDSSKNKILSLEEKLKSRDCEQQASRQTITRLVAKLSAEETKNANNDEKIANLTREVDQYKVSKTIIETDINSYECQLTSLRKEIE-LLTQDNEIKSKRIQEISATAKTNQQTDEQQALINH----FINSLISILSENYKTPKNDSLTIFEWIIGCVKSLLQNKGDVKNTPSSPLNETINSLRSDIIDIEKLNSRISSEEDPQLR---LTVEDLNKRLKNAETDLLSSSLIIDGLNCDKTKYFRILSELARVMNMNEINKDIGFDMISEALYARATQLQKLEYDVKTDHRLTEHSLNRKVKELKEKVHSKDLHIDLLHKKLASTEGRQQSVELIGKERDKELLSNKKLAKHNQKLQEEVENLRAEVIELKGSLINYNKLKVNALSLDQEVKSLTAKVNKLESIRQKQSKLLSESKSSQINKEQELNEIKETADAAIASLNTELRVVKDSLNDCKRKENQMIEMRTVIAKLLGLDLDNLAIPDFEIINRLERLITAHHSNI 738          
The following BLAST results are available for this feature:
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1701.121e-4729.35coiled-coil domain containing 170 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG433381.532e-1124.08gene:FBgn0263079 transcript:FBtr0306922[more]
CG433381.774e-1123.59gene:FBgn0263079 transcript:FBtr0306921[more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1704.093e-2830.52coiled-coil domain containing 170 [Source:ZFIN;Acc... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
c1qtnf44.737e-5430.08C1q and TNF related 4 [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000000426.11.498e-2222.03coiled-coil domain-containing protein 170-like [So... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ccdc1709.316e-3527.70coiled-coil domain containing 170 [Source:MGI Symb... [more]
Ccdc1701.200e-3427.70coiled-coil domain containing 170 [Source:MGI Symb... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8IYT3|CC170_HUMAN5.381e-4729.35Coiled-coil domain-containing protein 170 OS=Homo ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203092883.076e-8830.84tr|A0A1S3J8Y0|A0A1S3J8Y0_LINUN coiled-coil domain-... [more]
gnl|BL_ORD_ID|239076992.635e-8430.58tr|K1Q8J9|K1Q8J9_CRAGI Coiled-coil domain-containi... [more]
gnl|BL_ORD_ID|225760024.536e-7729.44tr|A0A2C9LCU0|A0A2C9LCU0_BIOGL Uncharacterized pro... [more]
gnl|BL_ORD_ID|235164821.877e-7630.63tr|A0A210PKU6|A0A210PKU6_MIZYE Uncharacterized pro... [more]
gnl|BL_ORD_ID|181841082.662e-7529.61tr|A0A1I8G8S9|A0A1I8G8S9_9PLAT Uncharacterized pro... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC1709.647e-1729.00coiled-coil domain containing 170 [Source:HGNC Sym... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000006087.16.515e-3732.10pep scaffold:Pmarinus_7.0:GL479553:21345:31721:-1 ... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO485762.957e-4730.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of coiled-coil domain-containing protein 170 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048767.10.000e+099.87SMESG000048767.1[more]
SMESG000074429.11.075e-4426.32SMESG000074429.1[more]
SMESG000074429.11.196e-4426.32SMESG000074429.1[more]
SMESG000074429.13.465e-4426.26SMESG000074429.1[more]
SMESG000074429.13.823e-4426.26SMESG000074429.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010695 ID=SMED30010695|Name=coiled-coil domain-containing protein 170|organism=Schmidtea mediterranea sexual|type=transcript|length=2535bp
AATATTTTAATCAGCCTTACATTGTTCAACTAATTATTTTCCTAGCAACT
AAACAACTCTTTTTAAAAGTTCCAAAACAACTTTTTTATTTTTAAACTAA
ATTTATTAAATTACTAAATGGATTTGGATTTGCTGAGATCTCGCAATATT
GAGTTGGAAGAACAACTAAAAGTATGCAAAGAAGATTTAATAAAAAAAGA
CGAGCACATTAAAGTGTTATCGAGCATGGATATCAAGCAATGCACTTCAC
CAAATTCTGAAACCAACAATTCAAAAGCGGAATTGGCTTCATTGCAATTA
CAGCTGAGTAATACTTTTAACAAATTGGATGAAAATGAAATCGAATTGAA
ATGCAAGGCAGACCAAGTCGAAGAGCTACGAAATCTCAATAGGAATCTAA
ATGAACAAATAGAAAGTCTCGTTGCTATGAACAATGAAATGCAGATGAAA
ATGGCTTCGACAGATCAAACAGCGAATGATTTGAGTTGCGCAAATGCAAG
ATCAGAGTTGGCTATTTCCTCATTGCAAAAGGAATTGACAGACTCACTTG
ATAAGGTTGTCAAATTGGAAGATGAGCTCAAAAATTTAACTCTCAACAAC
AACACAACCGAAAAATCTCGAGAGTCTTTGGCTGCAGTTATATCAAATTT
TTATCAAGAGCTGAATACCTATTTGAATTTGGAATCAGATTCTGAGCCAG
GAGTGGTTTTTCAAAAGATCAAAGATCTTACGTCTGAAAACAATATGTTA
AAAGGTGAAATATCTAATATAAAGGCAACTGCTGAAGATAGAGAAAAGAA
GTATTTGGAATCACGAGAATCGTTTCGTCAAATGATGCAAAATGTAGACA
AAGACAAAGGAGATCTTGAAGAATATATTCGAATGAAAAAGAATTTAACA
TTTGAAATAGAAAAGCTCCAAGTGGAGAAAAAAGCAGTCGAAATTCATAA
TTCCGAACTTACAAAAAGGTTAGCAGATATCGACGGGATATTGAAAGAAA
CTCAACGAATATTAGATGAAAAAGAAGCACAACTCTCTAAGGTTTTCCTT
GAAAAGAGAGAATCGAATCAAAATATGAGTTTTGTAAACAGAGAATTTGA
AACTTTCCGGGAATCTATTGCGGGACTGTTAAGCACCTCATTAAGTCGAT
GTATGTCTTCCGAAGAATCTATTAAAGAACGACTAAGAATTCTTATTAAT
GAAGCAAAGGAAAAGGACAATAAAATACTTCAACTGGATATGAAATTGAA
AAACGTGTCGGAACAATACGAACGGAACTATGAAATCAATAAAGAGACTG
GATTAAAAGCTCGGCGGGTTGAATTAGAATATTTAGATTTGAAGGATCGC
ATCAGACAGCTAGAAAAGGAATTGTCATCGAGAGACGTTACAAGAGATTC
ATTGAGGGCAGACAAAGAAAAGTTCTACCATTTCTTGCGACGATTAGCAG
CAGTAATGAAAATGGATCCATACACACAAGAGCATGAGTTTTCTCTGATC
TTTGATGGTATCCTTGATCGTGCAAAGGCAATGATACAAAATGAAAACGA
AAGAAACATTGATACCAGTCAAACTATTTCCAGTTTGAAAAGGCGAATTC
GTGATCTGAAAGATCAACTACACAGTCGGGATTTGCATTTAGAATTAATG
AGAAAGAAAATGGCAAACCAAGAAGACCAAATCCGTGGAGCTCTGGACGA
AAATGATTTTAGGAAGGGCTTGGTGGATACTGAAGATAATCTGAAGGAAA
AACTCTCTAAAATGCAAAGAAAAGTCGATCAATTGCGAGATGAAAATAAA
GCTTTGAAAGCAGAGCTTTTTGAATGCTCTGATGTTAAAATATCAGTTGC
CAGTCAAACCAAAGAAATGGAAACACTGCAACATAACCTTCAGAAACTGG
AAAGAGTTCGACAGAAACAAGCAGAAAAAATTGCCGATCTTACGAAAAGT
CTAGAAATCTATGATTCGGAAGCAAATCATACAAAATTTGTATCAGATAA
TGCTGTCCAATCGCTGGCATCGGAATTACGAACTCTTCGAAATGCTTTGG
AGCGAGCTAAAAGATCTGAAAAAGAACTTTTGGATTTTCGATGTGTTGTC
GGTAGGATATTGGGTCTGTGCGTTGATGACTTGGCTATTCCTAATTACGA
CATCATACGCCGGCTGGAAAAGCTGGTATCAATTCCACACTCAGGTGTGA
CTGTTGCTGTGCCAGTTCAACATTATCCTCTGAAAGCCGGGTTTGAGGAC
GCAAACAGATTGTTGGGAAGGAAGCGAAGAAGTCCCAATCGAACAATTCA
ACAAGAATCAGGTCGACCGAGATCTGTTTCCCCAATTCACGATTTACGCG
ACTCTCGAAAATACTAATAAAATCAGATAATTCGTGTTTCTATATATGAT
AGTATTAATATCTATTAAATATTTCTACTCCTTTTCTCTATGATGTGATT
TACTGTTATTATATTTACTGTTATATTTATATCACAAACCACATGGGCCG
TGTACTGTACCGAAAATAAATTGGCTATTTCGAAA
back to top

protein sequence of SMED30010695-orf-1

>SMED30010695-orf-1 ID=SMED30010695-orf-1|Name=SMED30010695-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=750bp
MDLDLLRSRNIELEEQLKVCKEDLIKKDEHIKVLSSMDIKQCTSPNSETN
NSKAELASLQLQLSNTFNKLDENEIELKCKADQVEELRNLNRNLNEQIES
LVAMNNEMQMKMASTDQTANDLSCANARSELAISSLQKELTDSLDKVVKL
EDELKNLTLNNNTTEKSRESLAAVISNFYQELNTYLNLESDSEPGVVFQK
IKDLTSENNMLKGEISNIKATAEDREKKYLESRESFRQMMQNVDKDKGDL
EEYIRMKKNLTFEIEKLQVEKKAVEIHNSELTKRLADIDGILKETQRILD
EKEAQLSKVFLEKRESNQNMSFVNREFETFRESIAGLLSTSLSRCMSSEE
SIKERLRILINEAKEKDNKILQLDMKLKNVSEQYERNYEINKETGLKARR
VELEYLDLKDRIRQLEKELSSRDVTRDSLRADKEKFYHFLRRLAAVMKMD
PYTQEHEFSLIFDGILDRAKAMIQNENERNIDTSQTISSLKRRIRDLKDQ
LHSRDLHLELMRKKMANQEDQIRGALDENDFRKGLVDTEDNLKEKLSKMQ
RKVDQLRDENKALKAELFECSDVKISVASQTKEMETLQHNLQKLERVRQK
QAEKIADLTKSLEIYDSEANHTKFVSDNAVQSLASELRTLRNALERAKRS
EKELLDFRCVVGRILGLCVDDLAIPNYDIIRRLEKLVSIPHSGVTVAVPV
QHYPLKAGFEDANRLLGRKRRSPNRTIQQESGRPRSVSPIHDLRDSRKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039139CCDC170-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 346..383
NoneNo IPR availableCOILSCoilCoilcoord: 480..500
NoneNo IPR availableCOILSCoilCoilcoord: 133..167
NoneNo IPR availableCOILSCoilCoilcoord: 508..528
NoneNo IPR availableCOILSCoilCoilcoord: 398..418
NoneNo IPR availableCOILSCoilCoilcoord: 250..284
NoneNo IPR availableCOILSCoilCoilcoord: 630..653
NoneNo IPR availableCOILSCoilCoilcoord: 56..111
NoneNo IPR availableCOILSCoilCoilcoord: 3..23
NoneNo IPR availableCOILSCoilCoilcoord: 577..611
NoneNo IPR availableCOILSCoilCoilcoord: 292..319
NoneNo IPR availableCOILSCoilCoilcoord: 532..573
NoneNo IPR availableCOILSCoilCoilcoord: 201..221
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 721..749
NoneNo IPR availablePANTHERPTHR18863:SF6COILED-COIL DOMAIN CONTAINING 170coord: 26..693
IPR039139Coiled-coil domain-containing protein 170-likePANTHERPTHR18863TSEC-2-RELATEDcoord: 26..693