Serine/threonine-protein kinase STE20

Overview
NameSerine/threonine-protein kinase STE20
Smed IDSMED30010687
Length (bp)1706
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein kinase STE20 (SMED30010687) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein kinase STE20 (SMED30010687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein kinase STE20 (SMED30010687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein kinase STE20 (SMED30010687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010687SMESG000025783.1 SMESG000025782.1 Contig764GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010687SMESG000014619.1 Contig764GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30010687SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010687SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010687SMESG000014619.1 dd_Smed_v4_1212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 108.997 bits (271), Expect = 2.775e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  470 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 647          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 108.997 bits (271), Expect = 2.775e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  470 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 647          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 108.612 bits (270), Expect = 3.129e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 108.612 bits (270), Expect = 3.203e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  435 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 612          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Match: MAP3K3 (mitogen-activated protein kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6855])

HSP 1 Score: 108.612 bits (270), Expect = 3.529e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  466 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 643          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 100.138 bits (248), Expect = 8.066e-22
Identity = 77/287 (26.83%), Postives = 141/287 (49.13%), Query Frame = 1
Query:  721 PLDRECKIYCVEMSNKLDLTII----SKISTGKFADIYLGKINSFNR--DCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGS-LKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGIT--GSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISG------YDAIIARCIRPIQKHRPNAWEL 1536
            P +R   +  +E ++KLD  +I     +I  G F ++Y G  N   R    +++   Q   +  + +  + +V+++    Y T     +    + +  KL I+ EY+ GGS L    S  L  + I    R+ILKGL++LH E+ IHR+I   +VL+  +G+ K+ +F ++  L    T+ +   IT  GS        +APE++    Y +KAD+WS G   I++ + + P+ D++ ++   LI +N      P++ G      +   +  C+    ++RP+A  L
Sbjct:  162 PAERRKVVKPIEDNSKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQ-EIQVLSQCDSQYVT-----KYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQL----TETVKKRITFVGSPF-----WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPP----PVLQGSQWSKPFKEFVEMCLNKDPENRPSASTL 429          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Match: F26E4.5 (Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;Acc:O01325])

HSP 1 Score: 95.5153 bits (236), Expect = 9.633e-21
Identity = 83/307 (27.04%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  622 LKEFILNENRQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLDLTIISKISTGKFADIYLG--KINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLK----LPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSAS---LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI--ISGYDA-IIARCIRPI 1506
            LKEF              T  S      +L S+ +  E ++Y  +      + +  K+  G+F +++ G   +  F  D EV      +      K +  E IT L+    +        V L  + T+ E + IV E  +GG LKSR+      L      KYC+QI KG+++L  +++IHR++   +VL+D + N K+++F LS F        L+      KV      +APE LL   Y  K+DVWSFG ++ ++ S + PY DV  ++       +  +  +P   +   DA ++  C  P+
Sbjct:  150 LKEFCFENISDLVRYHHQTRASVYKSGIKLFSWVVREEWQLYHEQ------INLGKKLGNGEFGEVFQGVLSVGIFTNDVEVA-----VKTMKGSKVTADERITFLREANLMLKLNHKYVVRLYGVATQQEPIMIVMELCSGGCLKSRIEKKDEQLSDVLKRKYCKQIAKGMRYLEKKQVIHRDLAARNVLLDKSDNCKISDFGLSLFGKLHKEQKLM------KV--PIRWLAPETLLKGIYSSKSDVWSFGVVMFEVFSGEYPYADVKVLKELRRKVAHENLRLKPPSDMPTDDAKVMEMCFEPV 437          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 95.9005 bits (237), Expect = 1.625e-20
Identity = 69/272 (25.37%), Postives = 131/272 (48.16%), Query Frame = 1
Query:  739 KIYCVEMSNKLDLTIISKISTGKFADIYLGKINSFNR--DCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGS-LKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISG------YDAIIARCIRPIQKHRPNA 1527
            +IY  ++  ++  T   +I  G F ++Y G  N   R    +++   Q   +  + +  + +V+++    Y T     +    + +  KL I+ EY+ GGS L    S  L  + I    R+ILKGL++LH E+ IHR+I   +VL+  +G+ K+ +F ++  L       +     GS        +APE++    Y +KAD+WS G   I++ + + P+ D++ ++   LI +N      P++ G      +   +  C+    ++RP+A
Sbjct:   22 RIYIQKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQ-EIQVLSQCDSQYVT-----KYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRIT--FVGSPF-----WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKN----PPPVLQGSQWSKPFKEFVEMCLNKDPENRPSA 276          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 93.9745 bits (232), Expect = 5.620e-20
Identity = 70/268 (26.12%), Postives = 129/268 (48.13%), Query Frame = 1
Query:  763 NKLDLTII----SKISTGKFADIYLGKINSFNR--DCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGS-LKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISG------YDAIIARCIRPIQKHRPNA 1527
            +KLD  +I     +I  G F ++Y G  N   R    +++   Q   +  + +  + +V+++    Y T     +    + +  KL I+ EY+ GGS L    S  L  + I    R+ILKGL++LH E+ IHR+I   +VL+  +G+ K+ +F ++  L       +     GS        +APE++    Y +KAD+WS G   I++ + + P+ D++ ++   LI +N      P++ G      +   +  C+    ++RP+A
Sbjct:    6 SKLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQ-EIQVLSQCDSQYVT-----KYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRIT--FVGSPF-----WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKN----PPPVLQGSQWSKPFKEFVEMCLNKDPENRPSA 256          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 93.9745 bits (232), Expect = 6.148e-20
Identity = 70/267 (26.22%), Postives = 128/267 (47.94%), Query Frame = 1
Query:  766 KLDLTII----SKISTGKFADIYLGKINSFNR--DCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGS-LKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISG------YDAIIARCIRPIQKHRPNA 1527
            KLD  +I     +I  G F ++Y G  N   R    +++   Q   +  + +  + +V+++    Y T     +    + +  KL I+ EY+ GGS L    S  L  + I    R+ILKGL++LH E+ IHR+I   +VL+  +G+ K+ +F ++  L       +     GS        +APE++    Y +KAD+WS G   I++ + + P+ D++ ++   LI +N      P++ G      +   +  C+    ++RP+A
Sbjct:   12 KLDPEVIFTKQERIGRGSFGEVYKGIDNRTGRVVAIKIIDLEQAEDEIEDIQQ-EIQVLSQCDSQYVT-----KYFGSFLKGSKLWIIMEYLGGGSALDLTKSGKLDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRIT--FVGSPF-----WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKN----PPPVLQGSQWSKPFKEFVEMCLNKDPENRPSA 261          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 94.3597 bits (233), Expect = 6.955e-20
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
             V  ++ Y  +E+L +V EY+ GGSL   ++ + +   +I   CR++L+ L+FLH  ++IHR+I  +++L+  +G+ KLT+F + ++     +    + G            +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N
Sbjct:  487 VVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP--------YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATN 639          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081714)

HSP 1 Score: 94.3597 bits (233), Expect = 6.955e-20
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
             V  ++ Y  +E+L +V EY+ GGSL   ++ + +   +I   CR++L+ L+FLH  ++IHR+I  +++L+  +G+ KLT+F + ++     +    + G            +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N
Sbjct:  487 VVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP--------YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATN 639          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081716)

HSP 1 Score: 94.3597 bits (233), Expect = 6.955e-20
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
             V  ++ Y  +E+L +V EY+ GGSL   ++ + +   +I   CR++L+ L+FLH  ++IHR+I  +++L+  +G+ KLT+F + ++     +    + G            +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N
Sbjct:  487 VVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP--------YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATN 639          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0081715)

HSP 1 Score: 94.3597 bits (233), Expect = 6.955e-20
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
             V  ++ Y  +E+L +V EY+ GGSL   ++ + +   +I   CR++L+ L+FLH  ++IHR+I  +++L+  +G+ KLT+F + ++     +    + G            +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N
Sbjct:  487 VVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP--------YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATN 639          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334544)

HSP 1 Score: 94.3597 bits (233), Expect = 6.955e-20
Identity = 52/161 (32.30%), Postives = 92/161 (57.14%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
             V  ++ Y  +E+L +V EY+ GGSL   ++ + +   +I   CR++L+ L+FLH  ++IHR+I  +++L+  +G+ KLT+F + ++     +    + G            +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N
Sbjct:  487 VVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETCMDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFGFCAQISPEQSKRTTMVGTP--------YWMAPEVVTRKQYGPKVDLWSLGIMAIEMVEGEPPYLNENPLKALYLIATN 639          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 115.161 bits (287), Expect = 1.517e-26
Identity = 73/188 (38.83%), Postives = 104/188 (55.32%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     RCI    K+RP+A EL
Sbjct:  434 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEEL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 115.161 bits (287), Expect = 1.654e-26
Identity = 73/188 (38.83%), Postives = 104/188 (55.32%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     RCI    K+RP+A EL
Sbjct:  428 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:ZFIN;Acc:ZDB-GENE-070910-1])

HSP 1 Score: 114.775 bits (286), Expect = 1.874e-26
Identity = 73/188 (38.83%), Postives = 104/188 (55.32%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     RCI    K+RP+A EL
Sbjct:  416 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPQLPSHISEHTRDFLRCIFVEAKYRPSAEEL 598          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 101.293 bits (251), Expect = 4.741e-22
Identity = 63/188 (33.51%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            T  + L I  EYM GGS+K +L +   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  S+ L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ + P+ +  ++ A   IA   T     P +S +     + I    K RP A +L
Sbjct:  434 THEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLPPHVSDHCRDFLKRIFVETKQRPAAEDL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 101.293 bits (251), Expect = 4.852e-22
Identity = 63/188 (33.51%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            T  + L I  EYM GGS+K +L +   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  S+ L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ + P+ +  ++ A   IA   T     P +S +     + I    K RP A +L
Sbjct:  426 THEKTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADIWSIGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPTLPPHVSDHCRDFLKRIFVETKQRPAAEDL 608          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 105.916 bits (263), Expect = 1.930e-23
Identity = 57/156 (36.54%), Postives = 90/156 (57.69%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAEI--NKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            ++ + L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D +GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ K P+ +  ++ A   IA   T
Sbjct:  439 SQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPY-----WMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPT 589          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 105.916 bits (263), Expect = 2.249e-23
Identity = 66/189 (34.92%), Postives = 100/189 (52.91%), Query Frame = 1
Query:  997 KLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEP-IISGYDAIIARCIRPIQKHRPNAWELHNYFL 1551
            KL I  EYM GGS+K +L A   + E    +Y RQIL+G+ +LHG  I+HR+I   ++L D  GN KL +F  SK +   C +   +  +TG+        ++PEV+ GE YG KADVWS    ++++++ K P+ +  ++ A   IA   T    P  +S       + I   +K RP A EL  +  
Sbjct:  430 KLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLRHLF 613          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Match: dennd1a (DENN domain containing 1A [Source:Xenbase;Acc:XB-GENE-5729862])

HSP 1 Score: 105.916 bits (263), Expect = 2.337e-23
Identity = 66/189 (34.92%), Postives = 100/189 (52.91%), Query Frame = 1
Query:  997 KLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEP-IISGYDAIIARCIRPIQKHRPNAWELHNYFL 1551
            KL I  EYM GGS+K +L A   + E    +Y RQIL+G+ +LHG  I+HR+I   ++L D  GN KL +F  SK +   C +   +  +TG+        ++PEV+ GE YG KADVWS    ++++++ K P+ +  ++ A   IA   T    P  +S       + I   +K RP A EL  +  
Sbjct:  437 KLSIFVEYMPGGSIKDQLKAYGALTENVTRRYTRQILQGVSYLHGNMIVHRDIKGANILRDSAGNVKLGDFGASKRIQTICMSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADVWSVACTVVEMLTEKPPWSEYEAMAAIFKIATQPTKPRLPDTVSDACRDFMKQIFVEEKRRPTAEELLRHLF 620          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Match: MAP3K2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:100493570])

HSP 1 Score: 105.531 bits (262), Expect = 2.489e-23
Identity = 57/156 (36.54%), Postives = 90/156 (57.69%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAEI--NKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            ++ + L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D +GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ K P+ +  ++ A   IA   T
Sbjct:  411 SQEKTLSIFMEYMPGGSIKDQLKAYGALTEFVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRLQTICLSGTGMKSVTGTPY-----WMSPEVISGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPT 561          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Match: samd8 (sterile alpha motif domain containing 8 [Source:Xenbase;Acc:XB-GENE-1012742])

HSP 1 Score: 103.605 bits (257), Expect = 1.087e-22
Identity = 57/151 (37.75%), Postives = 86/151 (56.95%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            L I  EYM GGS+K +L A   + E    +Y RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T
Sbjct:  442 LTIFMEYMPGGSVKDQLKAYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT 587          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Match: Map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346874])

HSP 1 Score: 107.842 bits (268), Expect = 3.485e-24
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Match: Map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:MGI Symbol;Acc:MGI:1346873])

HSP 1 Score: 105.916 bits (263), Expect = 1.441e-23
Identity = 66/187 (35.29%), Postives = 100/187 (53.48%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            + + L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KAD+WS    ++++++ K P+ +  ++ A   IA   T     P +S Y     + I    K RP+A EL
Sbjct:  429 QEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNIKLGDFGASKRLQTICLSGTGMKSVTGTPY-----WMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSAEEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Match: Pak2 (p21 (RAC1) activated kinase 2 [Source:MGI Symbol;Acc:MGI:1339984])

HSP 1 Score: 96.6709 bits (239), Expect = 1.140e-20
Identity = 57/163 (34.97%), Postives = 92/163 (56.44%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDM-LLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
             V  ++ Y   ++L +V EY+ GGSL   ++ + +  A+I   CR+ L+ L+FLH  ++IHR+I  ++VL+   G+ KLT+F    F    T +    S + G+        +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N T
Sbjct:  306 IVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDF---GFCAQITPEQSKRSTMVGTPY-----WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGT 460          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Match: Stk25 (serine/threonine kinase 25 (yeast) [Source:MGI Symbol;Acc:MGI:1891699])

HSP 1 Score: 94.7449 bits (234), Expect = 2.710e-20
Identity = 73/262 (27.86%), Postives = 124/262 (47.33%), Query Frame = 1
Query:  775 LTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYE--VITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRL-SASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDA-----IIARCIRPIQKHRPNAWEL 1536
             T + +I  G F ++Y G I++  ++   +K        +  ++ + E  V+++   PY T          Y ++ KL I+ EY+ GGS    L    L    I    R+ILKGL +LH E+ IHR+I   +VL+   G+ KL +F ++  L +  T +  +   G+        +APEV+    Y FKAD+WS G   I++   + P  D++ ++   LI +N      P + G+ +      +  C+    + RP A EL
Sbjct:   20 FTKLDRIGKGSFGEVYKG-IDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYIT-----RYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTD--TQIKRNTFVGTPF-----WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNP----PTLEGHHSKPFKEFVEACLNKDPRFRPTAKEL 264          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Match: Pak3 (p21 (RAC1) activated kinase 3 [Source:MGI Symbol;Acc:MGI:1339656])

HSP 1 Score: 93.9745 bits (232), Expect = 8.138e-20
Identity = 55/163 (33.74%), Postives = 91/163 (55.83%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDM-LLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
             V  ++ Y   ++L +V EY+ GGSL   ++ + +   +I   CR+ L+ L FLH  ++IHR+I  +++L+  +G+ KLT+F    F    T +    S + G+        +APEV+  + YG K D+WS G M I++V  + PY + N ++A  LIA N T
Sbjct:  325 IVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDF---GFCAQITPEQSKRSTMVGTPY-----WMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGT 479          
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Match: sp|Q99759|M3K3_HUMAN (Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP3K3 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.503e-23
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Match: sp|Q61084|M3K3_MOUSE (Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map3k3 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.437e-23
Identity = 68/183 (37.16%), Postives = 99/183 (54.10%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P  IS +     R I    + RP+A EL
Sbjct:  439 LTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEEL 616          
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Match: sp|Q9Y2U5|M3K2_HUMAN (Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 9.056e-23
Identity = 66/187 (35.29%), Postives = 100/187 (53.48%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            + + L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KAD+WS    ++++++ K P+ +  ++ A   IA   T     P +S Y     + I    K RP+A EL
Sbjct:  429 QEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPY-----WMSPEVISGEGYGRKADIWSVACTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFVEAKLRPSADEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Match: sp|Q9LT35|NEK6_ARATH (Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana OX=3702 GN=NEK6 PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 5.425e-21
Identity = 76/266 (28.57%), Postives = 126/266 (47.37%), Query Frame = 1
Query:  772 DLTIISKISTGKFADIYLGKINSFNRDCEVLKYR--QNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSASLGV-AEINKYCR---QILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAE-NRTILYEPIISGYDAIIARCIRPI----QKHRPNAWEL 1536
            D  ++ +I  G F   +L    S  R   V K R  +           +  +I++LK PY      VE  + + E + +CIVT Y  GG +   +  S GV A   K CR   Q+L  + +LH  +++HR++ C ++ +      +L +F L+K L     D L S + G+    +  C  PE+L   PYG+K+D+WS G  + ++ + +   P   +     LI + NR+ L  P+   Y + + R I+ +     +HRP A EL
Sbjct:    3 DYEVVEQIGRGAFGSAFLVIHKSERRKYVVKKIRLAKQTERCKLAAIQEMSLISKLKSPY-----IVEYKDSWVEKDCVCIVTSYCEGGDMTQMIKKSRGVFASEEKLCRWMVQLLLAIDYLHNNRVLHRDLKCSNIFLTKENEVRLGDFGLAKLL---GKDDLASSMVGT---PNYMC--PELLADIPYGYKSDIWSLGCCMFEVAAHQ---PAFKAPDMAALINKINRSSL-SPLPVMYSSSLKRLIKSMLRKNPEHRPTAAEL 251          
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Match: sp|Q6BNF3|STE20_DEBHA (Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=STE20 PE=3 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 8.461e-21
Identity = 67/198 (33.84%), Postives = 108/198 (54.55%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTI-LYEPIISGYD--AIIARCIRPIQKHRPNAWELHN 1542
             V  I+ Y     L +V EYM GGSL   ++ S +   +I   CR+ LKGL+FLH + +IHR+I  +++L++ +GN K+T+F     +     ++  + + G+        +APEV+  + YG K DVWS G M+I+++  + PY +   ++A  LIA N T  L EP    YD    ++ C++     R NA +L N
Sbjct:  859 IVNFIDSYLLRGDLWVVMEYMEGGSLTEIVTHSVMTEGQIGAVCRETLKGLRFLHSKGVIHRDIKSDNILLNIDGNIKMTDFGFCAQINEI--NLKRTTMVGTPY-----WMAPEVVSRKEYGPKVDVWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSYDIRKFLSWCLQVDFNKRGNADQLLN 1049          
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Match: A0A3Q2CUL5 (Mitogen-activated protein kinase kinase kinase 3 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.153e-24
Identity = 72/185 (38.92%), Postives = 102/185 (55.14%), Query Frame = 1
Query:  994 EKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            +KL I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T  L  P  S       RCI    KHRP+A EL
Sbjct:  428 KKLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSEGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPLLPPRASDQARDFIRCIFVEAKHRPSAEEL 607          
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Match: A0A3Q2CUJ6 (Mitogen-activated protein kinase kinase kinase 3 OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.659e-24
Identity = 72/185 (38.92%), Postives = 102/185 (55.14%), Query Frame = 1
Query:  994 EKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
            +KL I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T  L  P  S       RCI    KHRP+A EL
Sbjct:  428 KKLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSEGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPLLPPRASDQARDFIRCIFVEAKHRPSAEEL 607          
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Match: A0A087Y7U3 (Mitogen-activated protein kinase kinase kinase 3 OS=Poecilia formosa OX=48698 PE=4 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.902e-24
Identity = 74/188 (39.36%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T  L  P  S       RCI    KHRP+A EL
Sbjct:  425 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPLLPPRASDQARDFIRCIFVEAKHRPSAEEL 607          
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Match: A0A3B3U3Q6 (Mitogen-activated protein kinase kinase kinase 3 OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.934e-24
Identity = 74/188 (39.36%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T  L  P  S       RCI    KHRP+A EL
Sbjct:  384 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPLLPPRASDQARDFIRCIFVEAKHRPSAEEL 566          
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Match: A0A3B3YHL3 (Mitogen-activated protein kinase kinase kinase 3 OS=Poecilia mexicana OX=48701 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 2.102e-24
Identity = 74/188 (39.36%), Postives = 103/188 (54.79%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT-ILYEPIISGYDAIIARCIRPIQKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T  L  P  S       RCI    KHRP+A EL
Sbjct:  425 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPLLPPRASDQARDFIRCIFVEAKHRPSAEEL 607          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 113.235 bits (282), Expect = 6.162e-26
Identity = 73/191 (38.22%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIAR-CIRPI---QKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ G+ YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    PI+  + +   R  IR I    KHRP+A EL
Sbjct:  428 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT---NPILPSHTSEQTRDFIRRIFVEAKHRPSAEEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 113.235 bits (282), Expect = 6.162e-26
Identity = 73/191 (38.22%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIAR-CIRPI---QKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ G+ YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    PI+  + +   R  IR I    KHRP+A EL
Sbjct:  428 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT---NPILPSHTSEQTRDFIRRIFVEAKHRPSAEEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:103034596])

HSP 1 Score: 113.235 bits (282), Expect = 6.162e-26
Identity = 73/191 (38.22%), Postives = 106/191 (55.50%), Query Frame = 1
Query:  988 ENEK-LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIAR-CIRPI---QKHRPNAWEL 1536
             NEK L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ G+ YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    PI+  + +   R  IR I    KHRP+A EL
Sbjct:  428 HNEKTLTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSSTGVRSVTGTPY-----WMSPEVISGDGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT---NPILPSHTSEQTRDFIRRIFVEAKHRPSAEEL 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:103026704])

HSP 1 Score: 103.219 bits (256), Expect = 1.077e-22
Identity = 65/188 (34.57%), Postives = 100/188 (53.19%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            T    L I  EYM GGS+K +L +   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  S+ L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++L+ P+ +  ++ A   IA   T    P  +S +     + I    K RP A EL
Sbjct:  431 THERTLSIFMEYMPGGSIKDQLKSYGALTENVTRKYTRQILEGVCYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASRRLQTICLSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADIWSVGCTVVEMLTLRPPWAEFEAMAAIFKIATQPTNPALPAHVSDHCRDFLKRIFVETKQRPAAEEL 613          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Match: stk25a (serine/threonine-protein kinase 25 [Source:NCBI gene;Acc:103021644])

HSP 1 Score: 99.7525 bits (247), Expect = 3.785e-22
Identity = 79/257 (30.74%), Postives = 125/257 (48.64%), Query Frame = 1
Query:  775 LTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFV-ELINMYTENEKLCIVTEYMTGGSLKSRLS-ASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIIS-GYDAIIARCIRPIQKHRPNAWEL 1536
             T + +I  G F ++Y G IN  NR  EV+  +  I D    ++   ++   + +     SPFV +    Y ++ KL I+ EY+ GGS    L    L  A I    R+ILKGL +LH E+ IHR+I   +VL+  +G  KL +F ++  L +  T +  +   G+        +APEV+    Y FKAD+WS G   I++   + P  D++ ++   LI +N     E   S  +   +  C+    + RP A EL
Sbjct:   20 FTKLERIGKGSFGEVYKG-IN--NRTKEVVAIK--IIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYFGSYLKSTKLWIIMEYLGGGSALDMLKPGPLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTD--TQIKRNTFVGTPF-----WMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLEGSYSKAFKDFVEACLNKDPRFRPTAKEL 264          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 108.997 bits (271), Expect = 2.361e-25
Identity = 68/187 (36.36%), Postives = 103/187 (55.08%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            + + L I  EYM GGS+K +L A   + E    KY RQIL+G+ FLHG  I+HR+I   ++L D  GN KL +F  SK L   C+    +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ K P+ +  ++ A   IA   T    P+  S +   + R I    K RP+A +L
Sbjct:  432 QQKTLSIFMEYMPGGSIKDQLRAYGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVTGTPY-----WMSPEVINGEGYGRKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTDPRLPLHASEHARDLLRRIFVEAKLRPSAEDL 613          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 3.877e-19
Identity = 54/180 (30.00%), Postives = 92/180 (51.11%), Query Frame = 1
Query: 1003 CIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIIS----GYDAIIARCIRPIQKHRPN 1524
            CI+ EY   G L   L A   ++   +  + R I +G+ +LH  KIIHR++   +VLI  +   K+++F  SK +   +T M  +G            +APEV+  EP   K D+WSFG +L ++++ + PY DV+S      +  N   L+ PI +    G+  ++ +C     ++RP+
Sbjct:   76 CIIMEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSKEMREKSTRMSFAGTV--------AWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAIIWGVGSNS--LHLPIPASCPEGFKILLTQCWNSKPRNRPS 245          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002088.1 (pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 gene:ENSPMAG00000001892.1 transcript:ENSPMAT00000002088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 6.649e-19
Identity = 53/178 (29.78%), Postives = 88/178 (49.44%), Query Frame = 1
Query: 1003 CIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI--ISGYDAIIARCIRPIQKHRPN 1524
            CI+ EY   G L   L A   +    + ++   I  G+ +LH  KIIHR++   +VLI  +   K+++F  SK L + +T M  +G            +APEV+  EP   K D+WSFG +L ++++ + PY DV+S      +  N   L  P     G+  ++ +C     ++RP+
Sbjct:   11 CIIMEYCAQGQLYEVLRAGRKITPELLYRWTTGIASGMNYLHLHKIIHRDLKSPNVLITHDDLVKISDFGTSKELMDKSTKMSFAGTVA--------WMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAIIWGVGSNSLHLPVPTSCPDGFKILLTQCWTGKPRNRPS 180          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 87.8113 bits (216), Expect = 1.895e-18
Identity = 50/160 (31.25%), Postives = 88/160 (55.00%), Query Frame = 1
Query:  964 VELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNF-YLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
            V++ N Y   ++L +V E++ GG+L   ++ + +   +I   C  +L+ L +LHG+ +IHR+I  +S+L+  +G  KL++F + ++     T    L G            +APEV+   PYG + DVWS G M+I++V  + PY +   +QA   I +N
Sbjct:  477 VDMYNSYLVADELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFGFCAQVSKEVTRRKSLVGT--------PYWMAPEVISRLPYGPEVDVWSLGIMVIEMVDGEPPYFNEPPLQAMRRIRDN 628          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 86.2705 bits (212), Expect = 7.459e-18
Identity = 62/228 (27.19%), Postives = 109/228 (47.81%), Query Frame = 1
Query:  778 TIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKS---RLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGE-----PYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAEN 1437
            ++I ++  G F  +Y  +    N++  VL   + I   +  +   Y V   + L        V L+N +    KL I  E+  GG++ +    L   L   +I   C+Q+L+ L +LH  +IIHR++   ++L+   G+ KL +F +S    N  T        G+        +APEV++ E     PY +KAD+WS G  LI++  ++ P  ++N ++    IA+N
Sbjct:   34 SVIGELGDGAFGKVYKAQ----NKESGVLAAAKVIETKSEEELEDYMVEIEI-LALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVS--AKNTRTLQRRDSFIGTPY-----WMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKN 249          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 90.5077 bits (223), Expect = 1.859e-19
Identity = 55/168 (32.74%), Postives = 91/168 (54.17%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTI-LYEP 1458
             V  I+ Y     L ++ EYM GGSL   ++   L   +I   CR+ L GL+FLH + ++HR+I  +++L+   G+ KLT+F     +     ++  + + G+        +APEV+  + YG K D+WS G M+I+++  + PY +   ++A  LIA N T  L EP
Sbjct:  677 IVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINEL--NLKRTTMVGTPY-----WMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 837          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 84.3445 bits (207), Expect = 1.620e-17
Identity = 64/192 (33.33%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFL--FNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDA-----IIARCIRPIQKHRPNAWEL 1536
            E   L I  EY+ GGS+ S L+      E  I  + RQIL G+ +LH + IIHR+I   ++LID  G  K+T+F +SK L   N   +   S + GS        ++PEV+       KAD+WS G ++I++ + K P+PD + +QA   I  N T    P I  +        + +      ++RP+A EL
Sbjct:  525 EGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRAS-LQGS-----VFWMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTNTT----PEIPSWATSEGKNFLRKAFELDYQYRPSALEL 706          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 80.8777 bits (198), Expect = 6.763e-17
Identity = 60/234 (25.64%), Postives = 113/234 (48.29%), Query Frame = 1
Query:  772 DLTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGS----------PFV-ELINMYTENEKLCIVTEYMTGGSLKSRLSASL----GVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLI 1428
            D  I+  + TG F  ++L            ++ R N   +   K  K E++ RLK    T            PF+  +   + + +++ ++ +Y+ GG L S L  S      VA+   Y  ++   L++LH + II+R++  E++L+D NG+ K+T+F  +K++ + T    L G            +APEV+  +PY    D WSFG ++ ++++   P+ D N+++ +  I
Sbjct:   86 DFQILRTLGTGSFGRVHL------------IRSRHN-GRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKF--YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT--YTLCGTPD--------YIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKI 294          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 80.4925 bits (197), Expect = 1.461e-16
Identity = 60/217 (27.65%), Postives = 104/217 (47.93%), Query Frame = 1
Query:  964 VELINMYT--ENEKLCIVTEYMTGGSL----KSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPD---VNSIQAFTLI------------AENRTILYEPIISGYDAIIARCIRPIQKHRPNAWELHNY 1545
            V    M+T  EN  + I  EYM G SL    K+ L     ++E  + K    +L+GL +LH +K+IHR+I  +++L++ NG  KL +F +S    N     L +  TG+     +  +APE + G+PY   +DVWS G  ++++ + K P        +I  F L+                 I++ P    + + I  C++   + RP+  ++ N+
Sbjct:  281 VRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNS----LATTFTGT-----SFYMAPERIQGQPYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSP---SFKSFIDYCLKKDSRERPSPRQMINH 485          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 79.7221 bits (195), Expect = 1.592e-16
Identity = 59/231 (25.54%), Postives = 110/231 (47.62%), Query Frame = 1
Query:  772 DLTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTT----------GSPFV-ELINMYTENEKLCIVTEYMTGGSLKSRLSASL----GVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAF 1419
            D  I+  + TG F  ++L + N   R             F   K  K   I +LK    T            PF+  +   + +++++ +V +Y+ GG L S L  S      VA+   Y  ++   L++LH + II+R++  E++L+D NG+ K+T+F  +K++ + T    L G            +APEV+  +PY    D WSFG ++ ++++   P+ + N+++ +
Sbjct:   87 DFQILRTLGTGSFGRVHLIRSNHNGR-------------FYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKF--YAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVT--YTLCGTPD--------YIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTY 292          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 102.834 bits (255), Expect = 1.565e-24
Identity = 65/195 (33.33%), Postives = 101/195 (51.79%), Query Frame = 1
Query:  964 VELINMYTENEKLCIVTEYMTGGSLKSRLS--ASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAI--IARCIRPIQKHRPNAWEL 1536
            V+   + T++  + I  EY+ GGS+   +    +L  +   KY RQIL+G+ +LH  +I+HR+I   ++L D  GN KL +F  SK L    +      + G+        +APEV+ GE YG KADVWS G  ++++++ K P+ D   + A   IA   T    P     DA+  +   +R   K RP+A EL
Sbjct:   67 VQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGTPY-----WMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADEL 256          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Match: EDO33667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRJ0])

HSP 1 Score: 94.7449 bits (234), Expect = 1.029e-20
Identity = 56/163 (34.36%), Postives = 90/163 (55.21%), Query Frame = 1
Query:  961 FVELINMYTENEKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDM-LLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
             V  ++ Y   E+L +V EY+ GGSL   ++ + +   +I   CR+ L+ L+FLH   +IHR+I  +++L+  +G  KLT+F    F    T +    S + G+        +APEV+  + YG + DVWS G M I++V  + PY + N ++A  LIA N T
Sbjct:  283 IVNYVDSYLVGEELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNGVIHRDIKSDNILLGMDGQVKLTDF---GFCATITPEQNKRSTMVGTPY-----WMAPEVVTRKQYGPRVDVWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGT 437          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Match: EDO45846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL1])

HSP 1 Score: 91.6633 bits (226), Expect = 1.743e-20
Identity = 51/159 (32.08%), Postives = 88/159 (55.35%), Query Frame = 1
Query:  958 PFVELINMYTEN---EKLCIVTEYMTGGSLKSRLSAS-LGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDM-LLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAF 1419
            P   ++ MY  +   ++L +V E++ GG+L   ++ + L   ++   CR +LK L FLH + +IHR+I  +S+L+  NG  KL++F    F    T DM     + G+        +APEV+  +PYG + D+WS G M++++V  + PY +   +QA 
Sbjct:   82 PHPNIVEMYGSHLVGDELWVVMEFLEGGTLTDIVTHTNLSEEQVACVCRAVLKALTFLHSQGVIHRDIKSDSILLTSNGTVKLSDF---GFCAQVTEDMPRRKSLVGTPY-----WMAPEVISRKPYGTEVDIWSLGIMVLEMVDGEPPYFNEPPLQAM 232          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 86.6557 bits (213), Expect = 8.599e-18
Identity = 63/242 (26.03%), Postives = 115/242 (47.52%), Query Frame = 1
Query:  772 DLTIISKISTGKFADIYLGKINSFNR--DCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFV-ELINMYTENEKLCIVTEYMTGGSLKSRLSASLGVAEINK--YCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAI 1482
            D T I  +  G F  + L +    +     ++LK    + D     + +  +I R  L  + G PF+  L + +   E+L  V EY+ GG L  ++  S    E     Y  +++  LQFLH   +I+R++  ++VL+D +G+ KL +F + K       + +  G T +        +APE+L  +PYGF  D W+ G ++ ++++ + P+   N    F  I  +  +LY P+    +A+
Sbjct:  382 DFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQD----DDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCK-------ENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHD-DVLY-PVWLSREAV 610          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Match: EDO27976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7S3])

HSP 1 Score: 82.8037 bits (203), Expect = 1.288e-17
Identity = 64/225 (28.44%), Postives = 108/225 (48.00%), Query Frame = 1
Query:  754 EMSNKLDLT-------IISKISTGKFADIYLGKINSFNRDC--EVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLS--ASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNG-NAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPY 1392
            E SN  DLT       +++ +       +Y+  + SF R+   E  K  Q I D       +  ++ RLK P+      ++ +          I  E+M GGS+   LS       A + +Y RQIL+G+ +LH  +++HR+I   ++L+D  G + ++ +F  +  L    T +  +G    ++      +APEVL GE YG   DVWS G +LI++ + K P+
Sbjct:   36 EGSNLTDLTAVEASCSLLTMMCGDPVYRVYVAALVSFCRNSKSEQDKVCQTIMD-------EIAILARLKHPH-----LIKCLGATRHTGHFNIFLEWMAGGSISMLLSKYGPFEEAILIRYLRQILQGVSYLHENQVVHRDIKGANILVDSTGQDIRIADFGAAARL---ATQITGAGEFQGQLLGTIAFMAPEVLRGESYGRSCDVWSVGCVLIEMATGKPPW 245          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Match: map3k3 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101169290])

HSP 1 Score: 115.161 bits (287), Expect = 1.213e-26
Identity = 70/186 (37.63%), Postives = 103/186 (55.38%), Query Frame = 1
Query: 1000 LCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIAR----CIRPIQKHRPNAWEL 1536
            L I  EYM GGS+K +L A   + E    KY RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  SK L   C +   +  +TG+        ++PEV+ GE YG KADVWS G  ++++++ K P+ +  ++ A   IA   T    P++  + +  AR    CI    KHRP+A EL
Sbjct:  430 LTIFMEYMPGGSVKDQLKAYGALTENVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPY-----WMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPT---NPLLPSHTSDQARDFIHCIFVEAKHRPSAEEL 607          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.293 bits (251), Expect = 3.214e-22
Identity = 55/155 (35.48%), Postives = 88/155 (56.77%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            +  KL I  E+M GGS+K +L A   + E    +Y RQIL+G+ +LH   I+HR+I   ++L D +GN KL +F  SK +   C +   +  +TG+        ++PEV+ GE YG KADVWS    ++++++ K P+ +  ++ A   IA   T
Sbjct:  400 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPY-----WMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPT 549          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.679 bits (252), Expect = 3.324e-22
Identity = 55/155 (35.48%), Postives = 88/155 (56.77%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            +  KL I  E+M GGS+K +L A   + E    +Y RQIL+G+ +LH   I+HR+I   ++L D +GN KL +F  SK +   C +   +  +TG+        ++PEV+ GE YG KADVWS    ++++++ K P+ +  ++ A   IA   T
Sbjct:  430 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPY-----WMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPT 579          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Match: map3k22 (mitogen-activated protein kinase kinase kinase 3 [Source:NCBI gene;Acc:101156127])

HSP 1 Score: 101.679 bits (252), Expect = 3.324e-22
Identity = 55/155 (35.48%), Postives = 88/155 (56.77%), Query Frame = 1
Query:  988 ENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRT 1443
            +  KL I  E+M GGS+K +L A   + E    +Y RQIL+G+ +LH   I+HR+I   ++L D +GN KL +F  SK +   C +   +  +TG+        ++PEV+ GE YG KADVWS    ++++++ K P+ +  ++ A   IA   T
Sbjct:  430 DQRKLTIFVEFMPGGSIKDQLKAYGALTEKVTRRYTRQILQGVSYLHSNMIVHRDIKGANILRDSSGNVKLGDFGASKRIQTICMSGTGIKSVTGTPY-----WMSPEVINGEGYGRKADVWSVACTVVEMLTQKPPWAEYEAMAAIFKIATQPT 579          
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:NCBI gene;Acc:101160297])

HSP 1 Score: 100.138 bits (248), Expect = 9.057e-22
Identity = 63/188 (33.51%), Postives = 101/188 (53.72%), Query Frame = 1
Query:  985 TENEKLCIVTEYMTGGSLKSRLSASLGVAE--INKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFN-CTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPI-ISGYDAIIARCIRPIQKHRPNAWEL 1536
            T    L I  E+M GGS+K +L +   + E    +Y RQIL+G+ +LH   I+HR+I   ++L D  GN KL +F  S+ L   C +   +  +TG+        ++PEV+ GE YG KAD+WS G  ++++++ + P+ +  ++ A   IA   T    P+ +S +     R I    K RP+A EL
Sbjct:  461 TMERTLSIFMEHMPGGSIKDQLKSYGALTENVTRRYTRQILEGVSYLHSNMIVHRDIKGANILRDSVGNVKLGDFGASRRLQTICLSGTGIKSVTGTPY-----WMSPEVISGEGYGRKADIWSVGCTVVEMLTQRPPWAEFEAMAAIFKIATQPTNPELPVHVSDHCREFLRRIFVETKQRPSADEL 643          
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Match: SMESG000014619.1 (SMESG000014619.1)

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 441/503 (87.67%), Postives = 467/503 (92.84%), Query Frame = 1
Query:   55 LIKLTDLVTQNSVNTFEILQSDNVVYLKVKLSGKIGGRAQDFQIHSTDSVN-NPLNDNRSISDISFTGNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLQQCEFDNSKVKIWAGESLIVNITLLNPLNTEDENVTQVIGRFEFSATETVASLKEFILNENRQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLDLTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIARCIRPIQKHRPNAWELHNYFLDPN 1560
            +I L ++   N + TFE+L SDN++YLK KL+ +I  R QD ++    ++   PLN+N  I        L+Y+I +E++DDIIL++KRNYCGIPKF QFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATL+QC+FDNSKVKIW GESLIVNITLLNPLNTEDENVTQVIGRF+FSATETVASLKEFILNEN+QFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKL+LTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPY TGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIARCIRPIQKHRPNAWELHN FLDPN
Sbjct:    3 VITLENVNNSNDIETFEMLISDNLIYLKKKLADRICERVQDIKLFDQRNIAVPPLNNNGRIP----CKELYYSIYEEENDDIILHIKRNYCGIPKFFQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLEQCKFDNSKVKIWVGESLIVNITLLNPLNTEDENVTQVIGRFDFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLELTIISKISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYATGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIISGYDAIIARCIRPIQKHRPNAWELHNDFLDPN 501          
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Match: SMESG000014613.1 (SMESG000014613.1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 364/513 (70.96%), Postives = 415/513 (80.90%), Query Frame = 1
Query:   43 MARYLIKLTDLVTQNSVNTFEILQSDNVVYLKVKLSGKIGGRAQDFQIHSTDSVNNPLNDNRSISDISFTGNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLQQCEFDNSKVKIWAGESLIVNITLLNPLNTEDENVTQVIGRFEFSATETVASLKEFILNENRQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLDLTIISKISTG-KFADIYLGKIN-SFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLS-ASLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEP---IISGYDAIIARCIRPIQKHRPN-AWELHNYFLDPN 1560
            MARYLIKLTDL TQNSVNTFEILQSDNVVYLKVKLS KIGGRAQDFQIHSTDSVNNPLNDNRSISDISF GNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQKNFYI Q NGSFADNNATL+QC+FDNSKVKIW GE+ IVNITLLNPLNTED+N   VIGRFEFSATETVASLKEFILNEN+QFHNLQLFTETSFLDDKKQLASYPLDRECKIYCV+MS + D+ I +   T  K+   Y G IN S    C    Y   ++D N+ K  KYE++TRLKL Y    PFVEL+ MYTE + L IVTE M GGSL+ +LS A L  + I KYC+QIL+GL+F+H EKIIHRNINC SVL+DG GN KL+NF+ SKFL+N +TDM+  GI G+++DDD CCVAPEVLLGEPYGF+AD+WSFGA LI+IV+ +RPYP +   +A  +I   + I YE      + +D II +CI PIQ +RP  ++ + +YF + N
Sbjct:    1 MARYLIKLTDLFTQNSVNTFEILQSDNVVYLKVKLSDKIGGRAQDFQIHSTDSVNNPLNDNRSISDISFAGNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQKNFYIFQENGSFADNNATLEQCKFDNSKVKIWVGENYIVNITLLNPLNTEDKN---VIGRFEFSATETVASLKEFILNENKQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVDMSKRTDIIINTADKTKEKYYARYPGTINSSVIEKCVAYAYDCKLTDINSMKILKYEIVTRLKLSYKY--PFVELLTMYTEQDNLFIVTEDMPGGSLRQQLSIAPLEASVIIKYCQQILEGLKFMHDEKIIHRNINCGSVLLDGKGNVKLSNFHFSKFLYNLSTDMIFMGIKGTRIDDDACCVAPEVLLGEPYGFQADIWSFGATLIEIVTRERPYPKLTYKKAIYIIKNEKKIDYERNCYAGTNFDEIIDKCISPIQSNRPTVSFLIDDYFKNSN 508          
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 246.128 bits (627), Expect = 1.733e-74
Identity = 162/481 (33.68%), Postives = 258/481 (53.64%), Query Frame = 1
Query:  118 DNVVYLKVKLSGKIGGRAQDFQIHSTDSVNNPLNDNRSI-SDISFTGNLFYTISKEQSDDIILYVKRNYCGIPKFLQFPKLTTIGQLISELKTLYNIQ-KNFYILQGNGSFADNNATLQQCEFDNSKVKIWAGESLIVNITLLNPLNTEDENVTQVIGRFEFSATETVASLKEFI---LNENRQFHNLQLFTETSFLDDKKQLASYPLDRE-CKIYCVEMSNKLDLTIISKISTGKFADIYLGKINSFNRDCEVLKYR---QNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSA-SLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIIS-GYDAIIARCIRPIQKHRPNA 1527
            DN V +K ++S  I        + +       LNDN  I S+I     +FY +S+  ++ I++ + +N+  IPK++Q     T+ QL   L +      K F   +      DN A       + SK+K+W G  L+V + + +PL  +    TQ     E S TE++ +LK+ I   ++  ++   L LFTETSFL D K L  YP+ RE C+IY  ++  +    I   ++ G++A I+ G+   FN    + +Y+   + + D N  +   YE++TR+ L     S F EL+ MY +++   IVT++M  GSLK   +A  L   EI +Y  QI + L ++H  ++IHR+++C SVL+  + N KL+NF LS++LF  TT  LL GI GSK++     +APEVL  +PYG K+D+WSFG  ++++++  RPYP++N +     I  N+ I Y   IS      I +C+   Q  RP A
Sbjct:   26 DNAVIIKKRISDLINIEVHKINLFAERW--QRLNDNDFIDSNIKL---IFYEVSQPITEKIVVQMMKNHFNIPKWIQVKTEATVLQLKKILSSFSESHLKTFLFTEAGEMLLDNTAIKSYDLMNASKLKVWRGNDLLVQLEICDPLAKDPS--TQKRFPLEISVTESIINLKKKISEKISIGKEI-KLALFTETSFLQDGKCLLDYPIPRENCQIYYADLIKEETANIKGPLAEGRYARIFEGEFGQFNERVAIKRYKIEERRVEDANILR---YEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKNISPKISEFIDKCLHECQCERPTA 493          
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 172.17 bits (435), Expect = 3.097e-49
Identity = 94/254 (37.01%), Postives = 148/254 (58.27%), Query Frame = 1
Query:  781 IISKISTGKFADIYLGKINSFNRDCEVLKYR---QNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSA-SLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIIS-GYDAIIARCIRPIQKHRPNA 1527
            I   ++ G++A I+ G+   FN    + +Y+   + + D N  +   YE++TR+ L     S F EL+ MY +++   IVT++M  GSLK   +A  L   EI +Y  QI + L ++H  ++IHR+++C SVL+  + N KL+NF LS++LF  TT  LL GI GSK++     +APEVL  +PYG K+D+WSFG  ++++++  RPYP++N +     I  N+ I Y   IS      I +C+   Q  RP A
Sbjct:   17 IKGPLAEGRYARIFEGEFGQFNERVAIKRYKIEERRVEDANILR---YEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKNISPKISEFIDKCLHECQCERPTA 265          
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Match: SMESG000014940.1 (SMESG000014940.1)

HSP 1 Score: 172.17 bits (435), Expect = 3.904e-49
Identity = 94/254 (37.01%), Postives = 148/254 (58.27%), Query Frame = 1
Query:  781 IISKISTGKFADIYLGKINSFNRDCEVLKYR---QNISDFNNFKNSKYEVITRLKLPYTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSA-SLGVAEINKYCRQILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDMLLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPYPDVNSIQAFTLIAENRTILYEPIIS-GYDAIIARCIRPIQKHRPNA 1527
            I   ++ G++A I+ G+   FN    + +Y+   + + D N  +   YE++TR+ L     S F EL+ MY +++   IVT++M  GSLK   +A  L   EI +Y  QI + L ++H  ++IHR+++C SVL+  + N KL+NF LS++LF  TT  LL GI GSK++     +APEVL  +PYG K+D+WSFG  ++++++  RPYP++N +     I  N+ I Y   IS      I +C+   Q  RP A
Sbjct:   28 IKGPLAEGRYARIFEGEFGQFNERVAIKRYKIEERRVEDANILR---YEIVTRIMLSKANVSRFAELMAMYDDSKYFYIVTDFMEQGSLKDIYTARQLNDHEIIRYSIQISEALDYMHSNRLIHRDLSCSSVLVGSDNNIKLSNFQLSEYLF--TTAQLLEGIPGSKIESQQLWLAPEVLHKKPYGIKSDIWSFGVTVMEMLTRDRPYPNMNIVSGSHKICNNKCIEYNKNISPKISEFIDKCLHECQCERPTA 276          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K32.775e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K32.775e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K33.129e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K33.203e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
MAP3K33.529e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-18.066e-2226.83Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
F26E4.59.633e-2127.04Tyrosine-protein kinase [Source:UniProtKB/TrEMBL;... [more]
gck-11.625e-2025.37Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-15.620e-2026.12Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-16.148e-2026.22Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pak6.955e-2032.30gene:FBgn0267698 transcript:FBtr0334539[more]
Pak6.955e-2032.30gene:FBgn0267698 transcript:FBtr0081714[more]
Pak6.955e-2032.30gene:FBgn0267698 transcript:FBtr0081716[more]
Pak6.955e-2032.30gene:FBgn0267698 transcript:FBtr0081715[more]
Pak6.955e-2032.30gene:FBgn0267698 transcript:FBtr0334544[more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k31.517e-2638.83mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.654e-2638.83mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k31.874e-2638.83mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k24.741e-2233.51mitogen-activated protein kinase kinase kinase 2 [... [more]
map3k24.852e-2233.51mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP3K21.930e-2336.54mitogen-activated protein kinase kinase kinase 2 [... [more]
dennd1a2.249e-2334.92DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
dennd1a2.337e-2334.92DENN domain containing 1A [Source:Xenbase;Acc:XB-G... [more]
MAP3K22.489e-2336.54mitogen-activated protein kinase kinase kinase 2 [... [more]
samd81.087e-2237.75sterile alpha motif domain containing 8 [Source:Xe... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map3k33.485e-2437.16mitogen-activated protein kinase kinase kinase 3 [... [more]
Map3k21.441e-2335.29mitogen-activated protein kinase kinase kinase 2 [... [more]
Pak21.140e-2034.97p21 (RAC1) activated kinase 2 [Source:MGI Symbol;A... [more]
Stk252.710e-2027.86serine/threonine kinase 25 (yeast) [Source:MGI Sym... [more]
Pak38.138e-2033.74p21 (RAC1) activated kinase 3 [Source:MGI Symbol;A... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99759|M3K3_HUMAN1.503e-2337.16Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q61084|M3K3_MOUSE2.437e-2337.16Mitogen-activated protein kinase kinase kinase 3 O... [more]
sp|Q9Y2U5|M3K2_HUMAN9.056e-2335.29Mitogen-activated protein kinase kinase kinase 2 O... [more]
sp|Q9LT35|NEK6_ARATH5.425e-2128.57Serine/threonine-protein kinase Nek6 OS=Arabidopsi... [more]
sp|Q6BNF3|STE20_DEBHA8.461e-2133.84Serine/threonine-protein kinase STE20 OS=Debaryomy... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2CUL51.153e-2438.92Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A3Q2CUJ61.659e-2438.92Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A087Y7U31.902e-2439.36Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A3B3U3Q61.934e-2439.36Mitogen-activated protein kinase kinase kinase 3 O... [more]
A0A3B3YHL32.102e-2439.36Mitogen-activated protein kinase kinase kinase 3 O... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k36.162e-2638.22mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.162e-2638.22mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k36.162e-2638.22mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k21.077e-2234.57mitogen-activated protein kinase kinase kinase 2 [... [more]
stk25a3.785e-2230.74serine/threonine-protein kinase 25 [Source:NCBI ge... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k22.361e-2536.36mitogen-activated protein kinase kinase kinase 2 [... [more]
ENSPMAT00000008193.13.877e-1930.00pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
ENSPMAT00000002088.16.649e-1929.78pep scaffold:Pmarinus_7.0:GL478600:446:35095:-1 ge... [more]
pak41.895e-1831.25p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
slka7.459e-1827.19STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
STE201.859e-1932.74Cdc42p-activated signal transducing kinase; involv... [more]
STE111.620e-1733.33Signal transducing MEK kinase; involved in pheromo... [more]
TPK16.763e-1725.64cAMP-dependent protein kinase catalytic subunit; p... [more]
MKK11.461e-1627.65MAPKK involved in the protein kinase C signaling p... [more]
TPK31.592e-1625.54cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO414101.565e-2433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336671.029e-2034.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458461.743e-2032.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355858.599e-1826.03Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO279761.288e-1728.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k31.213e-2637.63mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.214e-2235.48mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.324e-2235.48mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k223.324e-2235.48mitogen-activated protein kinase kinase kinase 3 [... [more]
map3k29.057e-2233.51mitogen-activated protein kinase kinase kinase 2 [... [more]
back to top
BLAST of Serine/threonine-protein kinase STE20 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014619.10.000e+087.67SMESG000014619.1[more]
SMESG000014613.10.000e+070.96SMESG000014613.1[more]
SMESG000014940.11.733e-7433.68SMESG000014940.1[more]
SMESG000014940.13.097e-4937.01SMESG000014940.1[more]
SMESG000014940.13.904e-4937.01SMESG000014940.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010687 ID=SMED30010687|Name=Serine/threonine-protein kinase STE20|organism=Schmidtea mediterranea sexual|type=transcript|length=1706bp
CTAATATTTGTTTAAATAATTATCGATGATGATGATTTGAATATGGCAAG
GTATTTAATAAAGCTAACAGATCTTGTCACACAAAATAGTGTGAATACGT
TTGAAATTCTTCAAAGTGACAATGTCGTTTATTTGAAGGTGAAATTGTCT
GGCAAAATTGGTGGAAGAGCACAAGATTTTCAAATTCATTCAACAGATTC
TGTGAATAATCCATTAAACGATAACAGATCAATTTCTGATATTTCATTCA
CTGGGAATTTATTTTATACAATTTCCAAAGAACAATCTGACGACATAATT
CTCTACGTTAAGCGCAATTATTGCGGCATTCCGAAGTTTTTGCAATTTCC
GAAACTTACTACAATCGGCCAATTAATTTCGGAATTGAAAACATTATATA
ATATTCAAAAGAATTTCTATATATTGCAAGGAAATGGCTCGTTTGCTGAC
AATAATGCGACATTGCAGCAATGCGAATTCGACAATTCGAAGGTCAAAAT
ATGGGCGGGTGAAAGTTTAATTGTCAACATTACCCTTCTGAATCCACTGA
ACACAGAGGATGAAAATGTCACTCAAGTTATTGGTAGATTTGAATTCTCA
GCTACGGAAACGGTTGCTAGTTTAAAGGAATTTATTCTAAATGAAAATAG
ACAATTTCATAATTTACAACTGTTTACAGAAACATCATTTTTAGACGATA
AGAAGCAATTAGCAAGCTATCCGCTTGACAGAGAGTGCAAAATTTATTGT
GTAGAGATGTCGAATAAACTCGACTTGACAATTATATCCAAAATCAGCAC
CGGAAAATTTGCCGATATATACCTCGGGAAAATCAACTCCTTTAACCGGG
ATTGTGAAGTGCTTAAATATAGGCAAAATATTTCTGATTTTAACAATTTC
AAAAATTCGAAATATGAAGTTATAACTCGTCTCAAATTACCTTACACAAC
GGGATCTCCATTTGTGGAACTTATAAACATGTATACAGAGAACGAGAAGC
TTTGCATAGTTACTGAATACATGACTGGAGGATCTCTGAAGTCACGTTTG
TCGGCTTCGTTGGGAGTTGCGGAAATCAACAAATATTGTCGACAAATACT
TAAAGGATTGCAGTTCTTGCACGGAGAGAAGATAATTCACCGCAATATAA
ACTGCGAAAGCGTTCTAATCGATGGAAATGGCAATGCGAAATTGACAAAC
TTTTACTTGTCTAAGTTCCTCTTCAATTGTACAACAGACATGCTATTGAG
CGGCATTACCGGATCCAAGGTCGATGACGATACCTGTTGTGTTGCACCGG
AAGTGCTGCTAGGGGAACCTTATGGATTTAAAGCTGACGTTTGGTCGTTC
GGAGCGATGCTAATTCAGATCGTTTCACTGAAACGGCCGTATCCAGATGT
AAATAGCATTCAAGCCTTTACACTGATTGCCGAGAATAGGACAATTCTTT
ATGAGCCTATTATATCCGGTTACGATGCAATCATTGCCAGGTGCATTAGA
CCGATACAAAAACACAGACCAAATGCTTGGGAACTTCATAATTACTTTCT
GGATCCTAATTGATTGACTTTCTAGACATTTCTAGGATTTCAGCAGAATT
CCAATTGTAATGTCACATTTCTGCGATATTTAGATTAGAATTTGCTAACA
GTTTTTAATAAAATTCTAAAAATCCTGAAAGATTGTTGAAAAAATAAAAA
TATTTG
back to top

protein sequence of SMED30010687-orf-1

>SMED30010687-orf-1 ID=SMED30010687-orf-1|Name=SMED30010687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MARYLIKLTDLVTQNSVNTFEILQSDNVVYLKVKLSGKIGGRAQDFQIHS
TDSVNNPLNDNRSISDISFTGNLFYTISKEQSDDIILYVKRNYCGIPKFL
QFPKLTTIGQLISELKTLYNIQKNFYILQGNGSFADNNATLQQCEFDNSK
VKIWAGESLIVNITLLNPLNTEDENVTQVIGRFEFSATETVASLKEFILN
ENRQFHNLQLFTETSFLDDKKQLASYPLDRECKIYCVEMSNKLDLTIISK
ISTGKFADIYLGKINSFNRDCEVLKYRQNISDFNNFKNSKYEVITRLKLP
YTTGSPFVELINMYTENEKLCIVTEYMTGGSLKSRLSASLGVAEINKYCR
QILKGLQFLHGEKIIHRNINCESVLIDGNGNAKLTNFYLSKFLFNCTTDM
LLSGITGSKVDDDTCCVAPEVLLGEPYGFKADVWSFGAMLIQIVSLKRPY
PDVNSIQAFTLIAENRTILYEPIISGYDAIIARCIRPIQKHRPNAWELHN
YFLDPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004702signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0042803protein homodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0023014signal transduction by protein phosphorylation
GO:0046777protein autophosphorylation
GO:2000401regulation of lymphocyte migration
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 7..71