SMED30010682

Overview
NameSMED30010682
Smed IDSMED30010682
Length (bp)2956
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010682

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30010682SMESG000081460.1 SmedASXL_006154SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30010682SMESG000081460.1 dd_Smed_v4_2759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010682SMESG000081460.1 dd_Smed_v4_2759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010682 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001458:27830..30823 +14593
Homology
BLAST of SMED30010682 vs. Planmine SMEST
Match: SMESG000081460.1 (SMESG000081460.1)

HSP 1 Score: 1821.59 bits (4717), Expect = 0.000e+0
Identity = 924/932 (99.14%), Postives = 928/932 (99.57%), Query Frame = 3
Query:   12 MTVTKFISIIIFLVISNSCTSEEVQWNEKDNNSDYNIENSNRITDWDCWYKDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHCTLKTENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLDKEXXXXXXXXXXXXXXXXCAILSRNQRHWTKLKERLNIESRRSVFQRLIGRNKLKNTKIYETIDMRHKPKPADKNEVI 2807
            MTVTKFISIIIFLVISNSCTSEEVQWNE+DNNS+YNIENSNRITDWDCWYKDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHC LKTENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPP KNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNL FLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKK QNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLP+AFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLDKEYLRDKIR+YKLKLKLKCAILSRNQRHWTKLKERLNIESRRSVFQRLIGRNKLKNTKIYETIDMRHKPKPADKNEVI
Sbjct:    1 MTVTKFISIIIFLVISNSCTSEEVQWNEEDNNSEYNIENSNRITDWDCWYKDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHCKLKTENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPIKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLVFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKSQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPVAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLDKEYLRDKIRRYKLKLKLKCAILSRNQRHWTKLKERLNIESRRSVFQRLIGRNKLKNTKIYETIDMRHKPKPADKNEVI 932          
BLAST of SMED30010682 vs. Planmine SMEST
Match: SMESG000081459.1 (SMESG000081459.1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 314/831 (37.79%), Postives = 493/831 (59.33%), Query Frame = 3
Query:   87 WNEKDNNSD-YNIENSNRITDWDCWYKDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHCTLKTENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKR-ENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEK-KHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            ++E D N + + ++  N++ +W CWYK+Y+ K+  C SK  +S    KC  +R CKR C S YG  QC++ C  K   + K  KV+YRI   ++C+++VICVY S C   WP  + +GCYYT+A       H+        S R  +  T    SCLN    +  +    +   Q R+S G+ +YK G +W   +     L +LIG K V VKF     Y+KIG++WL+   + + +Y  + N W+  K+ + K++ +LG +W+  +       Y+ G +W+EI    N  Y K++ KWYRVK      LIK+   + K+  I    +IKL  RWFEF++K  KY IKF   + E++F     ++ I+  +YP++FK   + ++I   W++VE    ++FF  +K W++ SL +N L   KNKK        +    Y       ++  K+ D   GK FS + F +   S  +KL +G+WLPFK+ENG  L+ LSG+W++LK E NKLFY+  E+WIE I+IGK EFN++  HW++VKR E+ +  FFD+  WH IKL  +   LK N SWK L  +NG KF++LGN+Y +LKF    + ++ L +G K+Y+L   ++ +Y+++ N  + +EF+PH    +L  N WL +AFK+R+ +IK   CW++T  K  K  I+IGD++++ KISS K + VKI+   +KL+ RN IE+ +  L + FI+  LH+  N +++PF+  +E+  +K++DSWIE  I+E    I++ ++ EK+++T +NGILCE Y+ LK+P+ IRF +LYYNL+  W+ V+P+D  R+I  N+   KL
Sbjct:   26 YSELDENEEIFQVDKENKLQNWSCWYKNYFVKISHCPSKVTNSKLTRKCDMFRICKRQCQSDYGSRQCKIKCRTKRNKIPKSTKVLYRISNKDSCEDAVICVYDSHCKRTWPTTVQRGCYYTKA-------HK--------SNRKNVLST----SCLN-QNNFQFLFDKLKTSFQVRLSHGRRFYKFGNLWIPIRHKGDALEYLIGGKWVSVKFEGWRQYFKIGKQWLRTVIVERSLYIRLNNRWVRYKVFNSKDFIKLGERWLGFKVEKDSFYYQYGDEWLEIMFYDNDLYNKLNEKWYRVKIKRFSTLIKLGEKFNKLTIIHHSKFIKLGLRWFEFDMKSKKYSIKFGSSFHELQFIGKDIYIDIDGFQYPIVFKSFHILIKIKGDWLRVEPVKEKLFFLFDKFWLNLSLKKNVLLL-KNKK-------EETEFKYEKGKDLSLESVKDED---GKRFSVDNFYRKGKSFNLKLISGYWLPFKQENGIKLYLLSGKWVELKNEKNKLFYKDFEQWIETIIIGKYEFNKINFHWLEVKRNEDGQLMFFDAKRWHAIKLDRKKVYLKINNSWKLLALINGNKFVKLGNKYLRLKFDNSQKERYFLLLGQKWYRLSVTDHKYYLRIENQDRNIEFFPHGPPKLLWENVWLAVAFKNREIFIKYIGCWIKTYLKPEKFQIKIGDSYVDAKISSSKSLEVKISDHLYKLVGRNRIEVGEKNLNITFIDNNLHVLINDDYLPFKIMDERFMVKIVDSWIEGVINENGDTISITVDKEKLKITLENGILCELYEGLKIPVTIRFGKLYYNLDNNWVNVFPKDGKRYILTNQKKTKL 825          

HSP 2 Score: 144.821 bits (364), Expect = 1.524e-34
Identity = 118/522 (22.61%), Postives = 226/522 (43.30%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFS-LKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINML-INNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLE-IKISSDK 2159
            +  ++  GK Y +I   W E  ++D   F+++  KQ+  +F +  +Y K+G+ W+++  +  +I+  + + W+ LKI + + YF +G K VR++F N K     G+ W E ++ +  F   I  +W  +            G    +KFI   +++K+   W +F+I  G +FI  +  W      +    ++IN  ++ V +      ++I ++WIQ +Y+NNE+F  ++  W+ F + E  L+ + NK + K                                       KIEN   +   N  W+ FK  N     ++  +W K    D     Q   K ++  +     + + Q  W KVK EN  +Y + +D+W Q+ +   ++ + F+     L  +NGKK++   N +  +    + Q+ +  +++G    ++  +E +   ++     Q+E      +  L   N W      D  +YI   N W     +  K+ +   D   E IK S D+
Sbjct: 4844 VLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLVINGRQFKVRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERTLYAKINKDMFKF--------------------------------------KIENDDYLIEVNEQWVLFKILNNEPFIKIGNKWTKFDYNDGVQNVQVNGKTLQIKVQEGERYVKYQNQWYKVKVENGNYYIWFNDNWMQLFVENDNWFVAFSSGKIRLKTINGKKYLFFANDWRLI----ENQDGYDFVRVGDSIVRVSVQETVVTQEV-----QLEMKEENGVQYLKFENTWYKSKVLDGVYYIWMDNKWSALKIRNGKLVVMKNDNEPEIIKTSRDE 5318          

HSP 3 Score: 139.813 bits (351), Expect = 4.952e-33
Identity = 154/711 (21.66%), Postives = 288/711 (40.51%), Query Frame = 3
Query:  630 MYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEG------------------LNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIE-----NRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQ-------------------------------------LSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNR-----LQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKF------------------IRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIK 2513
            ++ ++G  W  A L + ++   IG + +P K  ++  Y+K+G +W ++      I   I   W  + + + K Y     + +RL+F    V +K  + WI+ K      Y    G W + K     NLIK+  N+   K   G                   N IK    WF  + K  K ++K   +W EI F K +  +   D   P+ F    + V+I+  W+ +E++NN  ++K+++ W+     +     N++ F K K+  ++   + R++++++     M   KNS +++ K+   N F KI N          WL     NG   +Q                                     ++ +W+ +K  D  + Y    KWI      K +  R         WVK K+    F+F   D W  +        +K NG    L  V+ K F                  I L  R  ++K       +F L+   +  K      ++++  +N+W Q+       +++LI+  W  + +K  K +I   N  +   F   K ++++G++++ +KI         IN + + L       L K   K +     +++ F G    F F + K+ IK+   WIE KI + + + V +++  I+ +  NG     + ++++PI++  K  + N++  W K
Sbjct: 1057 IFVQVGNNWVPADLTNNHVTLTIGNQNIPTKQNKEQLYYKLGSEWFEVYLYESIILIKIYEHWSPVSLINDKFYLIEEGELIRLKFFEENVFFKINEFWIQTKYEGTEVYSNFFGIWKQTKKKFKMNLIKLSKNWFPYKIENGKLLIQFYKDWYEMIFELTSNKIKFKNTWFTIKFKDSKIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRL---NHRDLIFKNVKGKLMYQLKNSWIEI-KFIKKNIFHKIGNK---------WLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFFQSDDKWTPVSWKNSRVRVKINGKVLDLKKVDHKYFVLIDGWKEFNLNDDNSIEITLPTRTIKVKIQ---HGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQINI-QRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKI---------INNQYWIL-------LGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQL-VLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHK 1733          

HSP 4 Score: 121.324 bits (303), Expect = 2.507e-27
Identity = 160/704 (22.73%), Postives = 296/704 (42.05%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFF-------LIGEKQ-----VPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQ-NYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGK---YFIKFDQKWIEIEFDKLQNFV-----LINDI------KYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFF-----------RKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKL----GKYFSNNQFSKI-----ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLD 2573
            +  ++  GK++  I +  +E +  + N ++       +IGE +      P+KF R   Y+ I  + L +  +   +   I+NA IE+K S  K   ++G +W  +        Y+ G + + I+I+  N F  KI   + +++F N    I+ K N+ ++ F   + Y K   +W   ++KK K    F   DQ  I  + ++ +        +I D       KY   +     +V IN++W +++ +N +I+++    W  FSL +                  NK L  I+LN++    Y   +   M   +N  +KL     K+F  NQ + +     EN   + L N  W+  K E+G F  +++  W++    DN+ FY    K IE        + +L   W+++K   ++ + F SD W  +K+V      +  G    + F NGK+F+  G  + + +  K    KFS+ +  ++ +L+ KE + Y     +   V+F  + S                   ++K G+ W +        FI I D +    +     +LV ING+ FK               V +I+    +     W+ F++E  + F+ +   WI+  I+E+  +  K+N +  +   +N       DD  + +           NE+W+     +N  FIK+     K D
Sbjct: 4494 VSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASYDYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKNALIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKY---GYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYL--INLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEK---GKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNES-------------------FLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLV-INGRQFK---------------VRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERT-LYAKINKDMFKFKIEN-------DDYLIEV-----------NEQWVLFKILNNEPFIKIGNKWTKFD 5135          

HSP 5 Score: 116.701 bits (291), Expect = 6.097e-26
Identity = 147/722 (20.36%), Postives = 291/722 (40.30%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPV------------------KFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDI--------------KYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNS--DLKLGKYFSNNQFS----KIENSLKMKLFN---------------------GHWLPFKKENGSFL---FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFN--GSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRI-GDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            +IQ +  R +++Y++G  W E  L D  L   I ++  PV                  +F   H ++K GE W++     + +Y +    W +    +GK    +  KW        K+  K  K W  I         +I G  + +KF N   LI+I   + +IKF+      K    W   ++ KGK  +K D+ W E+E+     +  +ND               +Y +  +   +  ++ N WI++++  + +   +   W+         +F+   +++ I +    +   + + S     F N    +K+   +   +FS     I++  K +LF+                           KK+ G +    + ++G+W   K  + K FY++K+KWIEF     T   ++    +K +R ++    +  D W + + +    ++       W +L  +NGK +  L N+ +  +F  K  N+F +K+   ++ L    N ++++++  W + E   +       N+  + + F + K Y+K G  W+ET     + +I + G   L++    +KD  ++I+GK FK+                                 +FE  K  I++   W E KI E     V +N+  +++   +G       ++++P+ I   +LY  L   WIK    +    +++N  L + 
Sbjct: 3249 IIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAIKFENSRLLIRISIQWIEIKFVSNEIKCKFQDEWVSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKQYYRMNNREYLLRKRFGVLSYRLKNHWIKIKFTKSTVLHYIGNEWLEILSKHGEEYFQFGDQILPIEIIDANSFQLKFADSILEVNFVNRYWKIKINNKWHEIKFSNKKVHIKSKDKWELFDVSSVLDSEAVERTDDFDLSNTSQQKKHKKQYGKYYGRYYLVNGRWYAFKIVNQKFFYKSKQKWIEFNSDNATMSIKINNKKLKFQRLDKVLNVYLIDKWRESQFLDDENSISVRTINRWINLKIINGKFY--LINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQ-IRIRFSNGKKYLKLGQIWIETKVIAGQFWIFVEGWKLLKM---IEKDYYIEISGKFFKV---------------------------------KFESAKRLIQLGQVWYEMKI-ENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRF 3930          

HSP 6 Score: 111.309 bits (277), Expect = 2.460e-24
Identity = 150/748 (20.05%), Postives = 303/748 (40.51%), Query Frame = 3
Query:  630 MYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRV--KFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS---------LNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKL---FNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKF---------NGSWKSLGFVNGKKFIRLGNRYSQLKFSKKG----------------------------------------QNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLIN--NAWLPMAFKDRKFYIKNGNCWLETIFK-GNKIFIRIGDAFLEIKISSDKDILVKINGKSFK---------------------LIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKV------------------IDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKN 2558
            +Y KIG+ W   ++ +  L   +G+K +  K  R   ++++G +W+++      +  +I + W  +       Y     + + ++F N  V +K G+ WIE K      Y   +G W +   + G H                     I +  +W+E++I +GK +IKF++ W  I F   +  + I    + V F+   + ++I+ QWI++++ +NEI  K    W+   +++ +L  + ++   ++          +N    I+ ++  +    P +   +K  +Y+  N  + +  S+  KL      HW+  K EN     ++  +WL++K +  + FYQ  ++     +I +  F      +VK+KR  E    +    W +I ++G+ +A+KF         N  W    F    +F       +  KF  K                                          N   +K+  K  K+  +E  +++ L++ W+Q +     S ++ I   N W+ +  K   F+++N    +   F   N+  + + + F+ I+I  D   L++I+G+  +                     L  +  +E ++  ++   INE+  I     W+ F+   E  F+++                   D+W+E KI E +   V  ++  I+ T  +G     Y   ++P+ I  K+ Y  ++  W K    +    IKLN+N
Sbjct: 2114 IYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHL--------------------IDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAVKFENSRLLIRISIQWIEIKFVSNEIKCKFQDEWVSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRF--IKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIKHKHEEDFYQFGDQLSPIGIIDENSF------FVKIKRV-EIILRYIKQYW-EIGILGKWFAVKFDEKGVYYEENKKWNVFNFELYTQFASTKTPETSTKFITKEISKSHFPWVFRWENKWFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDW-YLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKI-ENERFYVSFDNFWIEFTIKDGQDYFIYRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNEN 2829          

HSP 7 Score: 108.227 bits (269), Expect = 2.118e-23
Identity = 140/631 (22.19%), Postives = 268/631 (42.47%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISS------------GKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNY-IKLAKRWFEFEIKKGKYFIKFDQKWIEIEF-DKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNE-----IFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKL------GKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRL-QGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNE--IELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQL 2408
             I+F+ S  K+Y KI   W E + +   +     +  +P++F       +I E W+ I       Y  +   WI +  S             GK+++RL  + +  +    K+ Y+    WIEIK ++   + KI  KW  +   N     +   +   I+ I+  ++ IK+ K  F        + I+ + KWI ++F DK+  +           FK        N++WI + +K  +     +F+  N +W+ F   E   FF+ + K   +S  + R    R   +GK+   K  D K        K F+ N  + IE +L  +      +  K ++G F  Q   +  K K  +   F     +W + I I +   + L   +W K+  +  K +   +++   I+ +     LK   SW ++  +N + +I LG ++++   ++ G     ++ GGK +K   ++N   IKL   W +++    R + +LI+  W+  + K+ + ++  G   +         FI I   + + KI  ++  +  +N  +   I  N   I + K   +  +I    HI   G W  FR E+++ ++ +   W+   ++EK  + VK+ +E  Q 
Sbjct: 1229 TIKFKDS--KIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRLNHRDLIFKNVKGKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRY-----------FK--------NSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFFQSDDKWTPVSWKNSR---VRVKINGKVLDLKKVDHKYFVLIDGWKEFNLNDDNSIEITLPTRT-----IKVKIQHGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQ-INIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENG---IYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQL-VLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKT-LFVKIENESFQF 1824          

HSP 8 Score: 105.916 bits (263), Expect = 1.015e-22
Identity = 163/782 (20.84%), Postives = 303/782 (38.75%), Query Frame = 3
Query:  627 KMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKW------------------VRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS---------LNSKRNILYRSSSSGKMKPFK-----------NSDLKLG-----------------KYFSNNQFSKIEN---------SLKMKLFNGHWLPFKKENG-SFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHW--VKVKRENEKFYFFDSDSWHQIKLVGQ--------------------HYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQ-NKFSLKMGGKF-------YKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGN-KIFIRIGDAFLEIKISSDKDIL---------VKINGKSFKLI-----------ERNEIELNKLILKVNFINEKLHIFFNGNWVPF------------------RFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            ++Y+ I + W        N++  IG+  VP  F        IG+K ++      K++  +   W E+ +       ++  +W                  + ++F N +V YK G+ WIE K   N  Y   +G W                  +K    +G + I+++  W+ + +  G+   +F++ W  I F   +  + I    + V F+   ++++++ QW++VE+  NE   K   +W+   ++E +L    ++ L +I          LN    ++  +  +    P K           N DL L                  K+  N    KI N          L+   F    LP +  +G +F  ++   +LK++ E+++   ++KE W E        + +    W  V +K+  E   F D D   Q  +  Q                    H   K+   +    F+N  ++ R+     Q+ +  +GQ   FSL    K         K+   +N + I LNN WK+  F  + SI +L+ N W+ +  K+RKF+ +N    L   FK N ++ + I   ++ +KI S K  L         V I+ + F ++            RN I+L +  +++ FI +++ +F + +WV                    +FE  K F+   + W E ++ EK   +V + D  ++L    GI   +Y      +     + +  +   W K    D   FI +N N  + 
Sbjct: 4268 EVYFYINEYWVVVSFETDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIW------------------KKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENEFRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASYDYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKNALIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVD---QTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFIN-HRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQL-EKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRF 5026          

HSP 9 Score: 105.916 bits (263), Expect = 1.041e-22
Identity = 137/688 (19.91%), Postives = 279/688 (40.55%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHY-----------------WKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNR-KVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLN-------------------------------YIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLIND--IKYPVLFKLMSVY------------------VQINNQWIQV----------------EYK---NNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSD--LKLGKYFSNNQ---------------FSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFS-LKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIE 2348
            +  ++ +GK++ K+ + W+E +  + + ++ + +  + +    K +Y                 +++   W+KI   +  +  +I N W+E+    G+EYF+ G + + ++  +    + K     +E+  +  Y+  KI+ KW+ +KF N    IK K  +        L+                               Y  +  RW+ F+I   K+F K  QKWIE   D     + IN+  +K+  L K+++VY                  V+  N+WI +                E+K   +N+   K+ KNW    L  N  F   +   +K  ++     +  ++   +++ F N    LKLG+ +   +                  IE    +++ +G +   K E+   L QL   W ++K E+N+ +    E+W+E ++    EF +     + VK  + + Y      W + K+V  HY ++ NG        + K++I  G+R  +  +     N F+ +K+ G + +     ++ Y+ +   W +++    +S+++LIN  + P   K +K  IK G  W +      ++    GD ++E    + + I        +  I+R         L++ F N   +  +  +W   + +    +I  +D W+E
Sbjct: 3430 VSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIIS---KQYYRMNNREYLLRKRFGVLSYRLKNHWIKIKFTKSTVLHYIGNEWLEILSKHGEEYFQFGDQILPIEIIDANSFQLKFADSILEVNFVNRYWKIKINNKWHEIKFSNKKVHIKSKDKWELFDVSSVLDSEAVERTDDFDLSNTSQQKKHKKQYGKYYGRYYLVNGRWYAFKIVNQKFFYKSKQKWIEFNSDNATMSIKINNKKLKFQRLDKVLNVYLIDKWRESQFLDDENSISVRTINRWINLKIINGKFYLINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQIRIR-FSNGKKYLKLGQIWIETKVIAGQFWIFVEGWKLLKMIEKDYYIEI-SGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYI----NGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKV-EQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELI--------YPGIQR---------LRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLE 4090          

HSP 10 Score: 104.375 bits (259), Expect = 3.409e-22
Identity = 157/714 (21.99%), Postives = 299/714 (41.88%), Query Frame = 3
Query:  531 TKNIYSCL-NNMGRY-----PKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHY------------------WKIGEKWLKIAALRQKIYGH------------------IQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS-----LNSKRNILYRSSSSGKMKPFKNSD-----LKLGKYFSNNQFSKIENSLKMK------LFNGHWLPFKKENGSFLFQLSGQWLKLKE----ED-NKLFYQTKEKWIEFILIGKTEFNR-------------------LQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQN-KFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIF------------------IRIGDAFLEIKISSDKD-ILVKINGKSFKLI-ERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDE 2363
            T NIY+ + +NM  +       I    + +IQ +   GK++Y++G  WFE  L D  L   I ++  PV       Y                  +K GE W++       IY +                  I N W    + +G+ +F+  + W R+ F   K++ +       +K   +  + ++S +W  V+F  +    K +G++  +K +EG  +I + +  +E E +   ++ K +  WI I   +  ++       YP+ F     Y  INN+ + +   N  + +++       +LIE +  F +NK L KI      + +K+ + Y      ++ P +  D     LK+G +F   +F   +  ++ K       F+ + + +KK+N   L  L     K+KE    ED ++    T+    E I  G++E  R                   +   W ++K EN++ Y+     W    L  +   +K  G    +   + K  I L N++ +  F   G+N    + +  K+ KL+ K   F+ +      +++F  +  + +LIN  W+ M  +  KFY++  N W+E +   N+ F                  I++G +++E+K  +D+  + V  +    K++ +    E+   +++V F N K  +FF   W  F+ E+ K  + + D W+E  I E
Sbjct: 4284 TDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIWKKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENEFRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASY------DYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKN-----ALIEVK--FSENKWLHKIGNRWWEIITKQGLEYYQFGV-ELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLK----KIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYF---GENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKE 4976          

HSP 11 Score: 103.605 bits (257), Expect = 6.434e-22
Identity = 141/635 (22.20%), Postives = 268/635 (42.20%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEY--------FRL-----------GRKWVRLQFSNRKVEYKCGKKWIEI------------------------KILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYF-IKFDQKWIEIEFDKLQNFVLINDIKYPVL-FKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSD-LKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSD-SWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIEL--NKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDE 2363
            Q +  +GK +Y++       K V   L + +    + +KF +K+ + KIG KWL I +   + Y    N+   ++I     +        FRL             KW+ ++F+++ V Y    KWI +                        K  +N+F+ +   KW  V + N    +KI G    +K ++   Y  L   W EF +       I    + I+++    + F L ++ +     F     +V  +N+W Q+  + N +   ++K W       N+LF  KN  L+ I   + +  L   +S   MK   N   + LGK ++  +F   EN + ++ F G    F+  +   L +L  +W+++K + ++      E WIEF +    EF       + +  + +K+ F + D +WH+ K+  +   +     W      N ++FIR+  R  + ++           +GG            +IK+   W +      + I + +N  WL +  +++  ++K  N   +   KGN  +I++G  +L I++ ++ +I      K FK   ++++ +   KL LK+ + N++L + +   W   R E EK +I   + W E  I E
Sbjct: 1313 QIQFIKGKQFYRLNHRDLIFKNVKGKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFF-QSDDKWTPVSWKNSRVRVKINGKVLDLKKVDH-KYFVLIDGWKEFNLNDDNSIEITLPTRTIKVKIQHGE-FYLQHEARLTKFKFNNKMYFVNFDNEWFQINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWT--KFHLAENGIYVE-FGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMD-DKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRY-----------IGG----------FTHIKIYGKWDRFR-TEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINN-EIYTYFARKWFKFSYKHKVLVIPTKLPLKIKYENKELLVNYLNEWYRMRIENEKYYIWFFNEWAELSIFE 1917          

HSP 12 Score: 98.2117 bits (243), Expect = 2.252e-20
Identity = 152/744 (20.43%), Postives = 303/744 (40.73%), Query Frame = 3
Query:  402 CNGLWP--KYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYW-KIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS-LNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFS-KIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILI-GKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWL------PMAFKDRKFYIKNGNCWLETIFKG----------------NKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKL 2549
             NG W   K +NQ  +Y     Q W+E   + A   I     I   K  +  L+ +     ID   E   QF      +  +    W   K+++   + +  E     KF   + +  KI + W  +       +  I   WI+ +IS    Y       +R++FSN K   K G+ WIE K++   F+  + G W  +K       I+I G + K+KF      I+L + W+E +I+  ++++  +++W+EI     + F+   +I+ PV      +Y+++ + WI+ +  N     ++N     F L + + +  +  +  + S +N   +I       G    +K ++  +  +        K+E      L N  + PF+ +    + ++  +W  ++  + +L +   +KWIEFI   G+  +  +Q   +++K +N   Y    + WH++K+      + F   W  L       ++R GN+    KF  K Q +  +    K+ +L+ +   + I+  N+ +     P  +    I N         P +FK RK     G   ++    G                +  ++   +  +EI    +KD+   + G        ++I +N + L     NE  +I +  +W    + E + +  + + W+     E  +I  ++ D  +   F N  +     D  +       +++Y L  +W +VY  D++  +K+
Sbjct: 3633 VNGRWYAFKIVNQKFFYKSK--QKWIEFNSDNATMSIK----INNKKLKFQRLDKVLNVYLIDKWRES--QFLDDENSISVRTINRWINLKIINGKFYLINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQIRIRFSNGKKYLKLGQIWIETKVIAGQFWIFVEG-WKLLKMIEKDYYIEISGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHI----KIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELIYPGIQR--LRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQ--DYKFRIKDQ-QIDIWYENKWRRLIKRNGKYQIQ--NETESQTVIPIETKKTTIPNLTTTPKITKPKSFK-RKSVKSKGEISIDFSVSGKIRKKQVKKILNKYKKDGKYVNPQENLIEIS-KQNKDLPFPVTG--------SQININGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSF-ETDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKI 4345          

HSP 13 Score: 95.9005 bits (237), Expect = 1.354e-19
Identity = 150/703 (21.34%), Postives = 289/703 (41.11%), Query Frame = 3
Query:  582 DPSSEIVIQFRMSRGKMYYKIGQVWFEAKLV-----DRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKI--ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEF-----ILIGKTEF-------------NRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGK---FYKLMSKENLFYIKLNND--WKQVEFYP--------HRSINMLINNAWLPMAFK---DRKF----YIKNGNCWLETIFKGNKIFIRIG--DAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKL 2549
            D S EI +  R  + K+ +    +  EA+L      ++  F     +   +   R H    I + W KI     K++    N  I ++  +GK+Y +LG  W+ ++  N +     GKKW +  + +N  Y +  GK ++ +F ++ +LIK+   + +IK  +    + + + W EF +K G+ F+ F +  I I  D    F+ I+   +        +YV + N+W + E +NN  F ++ K          R  FR       I +             GK   F+  D ++  + +    + I  E +L +K+ N     FK +      ++  +WL+++  +N+++     KW +F     +L+  T+              N L   W +++ ENEK+Y +  + W ++ +    + +++         +N K      N++ ++    K  N++ +K+G +     K++ K     I+ +     K  E Y            IN   +   L    K   DR F    YI      +E   K  K+  +I   D + EI I       VK+N K  K +  N I+       + +  E ++++  G W    FE +  + K+ ++W+  +I +   +T+ + D+ IQ                        +L+Y L  +WI+VY  D++  + +
Sbjct: 1522 DNSIEITLPTRTIKVKIQHGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKK---------RRFEFRYIGGFTHIKI------------YGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENES-FQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSYKHKVLVIPTKLPLKIKYENKELLVNYL-NEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEV---IKENNEYKIKIGDETENILKIVKKLKPTTIRKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDH-----VKLNYKKEKKL--NFIQWKNYWYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQI-QNNQLTINVGDKIIQTKQQRD------------------RLFYQLGSEWIEVYLYDSILLLNI 2172          

HSP 14 Score: 94.7449 bits (234), Expect = 3.210e-19
Identity = 145/693 (20.92%), Postives = 263/693 (37.95%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIE-----------------IEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRL-FFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLK----------------LKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINML-INNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIER---NEIELNKLILKVNFINEKLHIFFN------------------GNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKV 2516
            + ++   + Y  I + W E  + D   F   GE ++PVK      Y ++G  W+K   +    +  I        +   K+Y   G +     + N     K    W+  K+  +  Y  I   W R+K       I I   Y   +     + IK+  +WF+  I  G+    F  KWIE                 I+FD    + +  +  + +  K   +Y+   + W+++  K ++ + +       F + + ++  + +NK    I  N K  I    + S  + P +     +    +  + +K   S K K          K   S  F +SG+  K                +  ++N +    + K + F + G ++ N + G  +  K++NE  Y    DSW+QI           N  W  + F     + ++G+      F     N+  + +G K  +        + +L   W   E Y + SI +L I + W P++  + KFY+      +E  F+  ++  + G+ ++E K  ++ DI    NG   K ++R   + IE++      N IN +LH  FN                  G     +FE  + FI++   W+E +  E +    K   + + +    G L  N D+    I  R    YY LN  WI +
Sbjct: 3857 EMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELIYPGIQRLRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQDYKFRIKDQQIDIWYENKWRRLIKRNGKYQIQ-NETESQTVIPIETKKTTIPNLTTTPKITK-PKSFKRKSVKS------KGEISIDFSVSGKIRKKQVKKILNKYKKDGKYVNPQENLIEISKQNKDLPFPVTG-SQIN-INGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSFETDNIYTQIGDNMVPFYFQ---NNQMIMTIGDKIIQTKQDGGKVFYQLGLQW--FEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENN-DIYSNFNGIWKKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENE-FRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVI 4532          

HSP 15 Score: 93.5893 bits (231), Expect = 6.701e-19
Identity = 137/624 (21.96%), Postives = 254/624 (40.71%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENS----------LKMKLFNGHW-LPFKKENGSFL-------FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIK-LVGQHYALKFNGSWKSL----------GFVNG------KKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKE-NLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLI---LKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAK 2354
            +I  R   GK Y K+G  W   K+++   + L+G+K           Y + G K  K      K    +   WIE+KI   ++   +   W+     N +     G+  I I +   Y +  I G W++ K       + +   + + +      +I++ KR FEF    G   IK   KW     +  + ++ +N     ++ +  +++V+I N+  Q + K N  + KV   W+   LI N ++    +K  K S   K  +L   +       ++N +L L  Y +     +IEN            ++ +F G W + +KK N  F        F    +W ++ +E+N+   +  ++    + I K    +L+   +   R++E      ++ +  IK  V +   + F  S K L           F NG      K  I +  +  +L F    ++K+S  +         KE  L +I+  N W  + FY   +I + I   W  ++F+    Y K G  W+    + N++ I +GD  ++ K   D+ +  ++  +  ++   + I L  +      V FI+   ++  +G  +  RFE    F K  + WIE K
Sbjct: 1605 LIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSY--KHKVLVIPTKLPLKIKYENKEL-LVNYLNEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEVIKENNEYKIKIGDETENILKIVK----KLKPTTI---RKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDHVKLNYKKEKKLNFIQWKNYWYPI-FYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETK 2216          

HSP 16 Score: 87.0409 bits (214), Expect = 7.193e-17
Identity = 152/731 (20.79%), Postives = 278/731 (38.03%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKW--YRVKFGNHF----------------NLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQ------------------KWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENS----------LKMKLFNGHW-LPFKKENGSFL-------FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIK-LVGQHYALKFNGSWKSL----------GFVNGK------KFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKEN-LFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLI---LKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLD 2573
            Q  + R  +   I + W +       LF       +P++F     Y K+G  W+ +  +  + +  +   W +  ++    Y   G K  + +F + K   K G++WIEIKI Q+     I   W  + VK G  F                  I I GN+ K K  +   Y+ L  +W E+EI+  + FI+  +                  KW     +  + ++ +N     ++ +  +++V+I N+  Q + K N  + KV   W+   LI N ++    +K  K S   K  +L   +       ++N +L L  Y +     +IEN            ++ +F G W + +KK N  F        F    +W ++ +E+N+   +  ++    + I K    +L+   +   R++E      ++ +  IK  V +   + F  S K L           F NGK        I +  +  +L F    ++K+S  +         KE  L +I+  N W  + FY   +I + I   W  ++F+    Y K G  W+    + N++ I +GD  ++ K   D+ +  ++  +  ++   + I L  +      V FI+   ++  +G  +  RFE    F K  + WIE K + +                                      +Y N N  W K   R     I +N    + D
Sbjct: 1571 QINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSY--KHKVLVIPTKLPLKIKYENKEL-LVNYLNEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEVIKENNEYKIKIGDETENILKIVK----KLKPTTI---RKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDHVKLNYKKEKKLNFIQWKNYWYPI-FYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENE-------------------------------------NVYSNFNGIWKKTLDRTGKHLIDINNKWYEYD 2252          

HSP 17 Score: 83.1889 bits (204), Expect = 9.392e-16
Identity = 133/725 (18.34%), Postives = 282/725 (38.90%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHY-WKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKW---------------------------------------VRLQFSNRKVEYK--------CGKKWIEIKILQNYFYGKISGKWYRVKFGNHFN------------------LIKIKGNYRKIKFIEGLNYIKLAK-RWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMK-------PFKNSDLKLGKYFSNNQFSKI---------ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKF------------------------SKKGQNKFSLKMGGKFYKLMSKE---------NLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGI 2426
            +I+ + S  K  +KIG  W+E        ++  G + +P++    + +  KIG+ +LKI     +     +  W E+   +   Y++   KW                                       +R ++++R+ +YK           +W  +KI     Y +  G+W      +                     LI +   +++  F E  + + L + +W +  IK  K+F +  +  + I+F +       ND           + V IN  W+ ++ ++ + + ++N NW+ F +I+N+ F+  N K ++      RN +    S  +MK        F + D  L K  ++  + +I         EN  +   F   W  F+ E G F   +  +W++L  ++   +     +      IG   F ++   W K K  +  F+ F +D+W +  +  ++  L  NG    + +++G   +++G+++ Q K+                        +K  ++ F  K+    Y +   E         N  +IK+ N W + + Y     N+ +N   L +  ++ + Y+K  N W +   +    +I   D ++++ + +D   +   +GK                +++  IN K ++FF  +W     ++   F++V DS +   + E    TV   + ++++  +NG+
Sbjct: 4577 LIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKE-------ND----------ELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLVINGRQFKVRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERTLYAKINKDMFKFKIENDDYLIEVNEQWVLFKILNNEPFIKIGNKWTKFD-YNDGVQNVQVNGKTLQIKVQEGERYVKYQNQWYKVKVENGNYYIWFNDNWMQLFVENDNWFVAFSSGK----------------IRLKTINGKKYLFFANDWRLIENQDGYDFVRVGDSIVRVSVQE----TVVTQEVQLEMKEENGV 5263          

HSP 18 Score: 82.8037 bits (203), Expect = 1.433e-15
Identity = 139/656 (21.19%), Postives = 262/656 (39.94%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFI-LIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNE---IELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKN 2558
            I+ R S GK Y K+GQ+W E K++    F++  E    +K   K +Y +I  K+ K+     K    +   W E+KI + + Y  +  +WV +   + K   K G+  + +KI+    Y ++   W + K  N    ++I G   +    +   YI    R FEF    G   IK D  W+  +      +V I +I   +  +  S+ + IN ++     K  +   KV   W    +I  RL F    K ++  +     ++Y      ++K F N++     Y  +    K++N +    F   WL    +   +  +   Q  K + +D ++    + KW   I   GK +          +  E +K    +  +  +I    +  + K   S KS G ++    +    R  Q+   KK  NK+  K  GK+  +  +ENL  I   N  K + F P     + IN   L    ++   YI+  + W +  +  N+++  I + ++ +   +D +I  +I         +N    + +   I++      K+       W      +    +K+ D W    +   K   ++ ++  I++ F+N  +   Y ++ +        +Y N N  W K   R     I+++ N
Sbjct: 3785 IRIRFSNGKKYLKLGQIWIETKVI-AGQFWIFVEGWKLLKMIEKDYYIEISGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEF-IYKNGELIYPGIQRLRIK-FDNTN-TYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQDYKFRIKDQQIDIWYENKWRRLIKRNGKYQIQNETESQTVIPIETKKTTIPNLTTTPKI---TKPKSFK-RKSVKSKGEISIDFSVSGKIRKKQV---KKILNKY--KKDGKY--VNPQENLIEISKQN--KDLPF-PVTGSQININGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSFETD-NIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIE-DEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIWKKTLDRQGKHMIEISNN 4420          

HSP 19 Score: 80.8777 bits (198), Expect = 4.446e-15
Identity = 93/465 (20.00%), Postives = 191/465 (41.08%), Query Frame = 3
Query:  990 KFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKG--------------------QNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKL---IERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEK 2315
            K  NH N I  K  +  I + +   Y+ +   W    I+    F++    W+  +       + I +   P       +Y ++ ++W +V    + I  K+ ++W   SLI ++ +  +  +L+++    + N+ ++ +       ++ +++     +SN              F G W   KK+    L +LS  W   K E+ KL  Q  + W E I    +   + +  W  +K ++ K Y   S  W +I+ + +   +KF   W  + F NGK  +R+   +  +++                         N+     G +FY+L  ++ +F        K V+      +   + N+W+ + F  +  + K GN WL  + +  + + +  ++   I+I  +    +KI    F+L   ++  EIE+N   + V F ++ +  F N  W+   F+E+K
Sbjct: 1015 KTENHVNYILWKNYWYPIFYYDEEIYLNVYGYWTLVSIETDVIFVQVGNNWVPADLTNNHVTLTIGNQNIPTKQNKEQLYYKLGSEWFEVYLYESIILIKIYEHWSPVSLINDKFYLIEEGELIRLKF-FEENVFFKINEFWIQTKYEGTEV-----YSN--------------FFGIWKQTKKKFKMNLIKLSKNWFPYKIENGKLLIQFYKDWYEMIFELTSNKIKFKNTWFTIKFKDSKIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRLNHRDLIF--------KNVK----GKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKK 1447          

HSP 20 Score: 79.7221 bits (195), Expect = 1.165e-14
Identity = 97/479 (20.25%), Postives = 210/479 (43.84%), Query Frame = 3
Query:  654 WFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQ---------------------NAWIELKISSGKEYFRLGRKWVRLQFS-NRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLF----KLMSV--------------YVQINNQWIQVEYKNNEIFF------------------KVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKN--SDLKLGKYFSNNQFSKIENSLKMKLFNGHW------------------LPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTE--FNRLQGHWVKVK-RENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNR 1847
            WF  K+++ + F+   EK +   +       KI EK LKI    +K + ++                      N WI+LKI +G  + +     +R +F+ + +       ++I I+I ++++  +I G+W R +   ++  + I    ++I+F+ G  Y++  + W EF+I   +Y+I  ++KWI  +      F+ I    + + F    KL+++              YV  +N WI+   K+ + +F                  K++ +W  F ++  ++  + N+   +  + +K+N +  +  S +   F N  + +K+G  ++  +  K +  + ++   G W                    +K +N     ++  +WLKLK  +N ++   + KWI F+   K +    + +   V+++ ++ EKF F+  + W+++K++   + + F   W  L   N K ++R  N+
Sbjct: 2538 WFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKIENERFYVSFDNFWIEFTIKDGQDYFIYRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNENWTEYLIENKKNQITINDRSFEF-SFNNEYTHIKIGGLWTRYKLVKTDLFISIE---GIWLKLLIKNKKLFLIIKEEIFKYKVKNKIRYIKVGDRWLKLKIINNSIYVYLERKWIRFVYNSKRKSILQKYKFKTVEIRLKQREKFLFY-LNKWYKLKILRNQFYIWFVDKWMELEVENDKWYLRYNNQ 3011          

HSP 21 Score: 77.411 bits (189), Expect = 5.996e-14
Identity = 131/648 (20.22%), Postives = 254/648 (39.20%), Query Frame = 3
Query:  762 WLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKL-MSKENLFYIKLNNDWKQVEF---YPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKI--SSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRF------------------EEEKTFIKVIDSWIEAKI--DEKKHITVKLNDEKIQLTFDNGIL-------------------CENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            W  I    + IY +I   W  +   S   Y ++G  WV +Q  N ++    G K I+ K  ++  + ++  +W  V   +   L+ I   +  + FI+   Y+       E   +    F K+ + WIE +++    +   N I    L +     + INN+W + +    +++ K NK W       +R+ F   +  ++I     +  L+          F+NS L +       +   + N +K K F   W+  K   G    ++   W +++  ++  +Y+  + WI   +I K E   ++     ++    K Y+  ++  H +K V      K    W  +   N K + R+GN++ ++K   K +  F  + G +   + +  EN F++K+    K+VE    Y  +   + I   W  + F ++  Y +    W       N     +   F   K   +S K I  +I+   F  + R E   NK       INE      N  W+ F +                  EE+K F+ + D W + KI  +E   +T++  +  I+L    G+                      N D+  +PI I        ++ +W++   ++N  ++ +N  + ++
Sbjct: 2086 WYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIW-------HRIVFGIEEIQIEI-----QGTLFAVK-------FENSRLLIRISIQWIEIKFVSNEIKCK-FQDEWVSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWI---IISKNEDASME---YPIRFIKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIK--HKHEEDF-YQFGDQLSPIGIIDENSFFVKI----KRVEIILRYIKQYWEIGILGKWFAVKFDEKGVYYEENKKW-------NVFNFELYTQFASTKTPETSTKFITKEISKSHFPWVFRWE---NKW-FPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRI 2689          

HSP 22 Score: 76.2554 bits (186), Expect = 1.293e-13
Identity = 125/543 (23.02%), Postives = 209/543 (38.49%), Query Frame = 3
Query: 1158 DKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKY-------FSNNQFSKIENS--LKMKLFNGH--------WLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILI-GK--TEFNRL---------------QGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVE-------FYPHRSI-----------NMLIN-----------NAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERN-----EIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLDKE 2579
            +K  NF+   +  YP+ +   ++Y+ I   W  V ++++ I+ K+ +NW+   +  N+L      K+++      R + Y+  S        +S L L  Y       F +N F  IE+   ++++  N H        W+  K EN +     +G W K  +   K       KW E+ +I GK   +FN++               QG    VK EN +     S  W +IK V      KF   W S+  V GK                       +K+   +Y++  + + FY ++N+ W  +         YP R I           N L+            N W+ +  +++K Y + GN WLE   K  + F + GD    I I  +    VKI  K  ++I R      EI +      V F  + ++   N  W  F FE    F        +      K IT +++       F        +++   P  I  +  +Y  NEKWI     DN+  +K+ +  +K+ KE
Sbjct: 2074 EKKLNFIQWKNYWYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAVKFENSRLLIRISIQWIEIKFVSNEIKCKFQDEWVSVKVVKGK---------------------LHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRFIKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIKHKHEEDFYQFGDQLSPIGIIDENSFFVKI--KRVEIILRYIKQYWEIGILGKWFAVKFDEKGVYYEENKKWNVFNFELYTQFAST-----KTPETSTKFITKEISKSHFPWVF-------RWENKWFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKE 2580          

HSP 23 Score: 68.9366 bits (167), Expect = 2.447e-11
Identity = 89/425 (20.94%), Postives = 176/425 (41.41%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKW--YRVKFGNHFNLIKIKGNYRK----IKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNS-----DLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGN 1844
            I  R+       +I   W   ++ +   + +I  K   ++F     Y +  + W++   + ++ +  I+  WI  +I +  E+  +G K   ++F N K     G  W+E+KI    FY      W  + +K G  + +      YRK    ++ +   +Y+K+   W +F+I   K  IK ++ W E   +  +N + IND  +   F     +++I   W + +    ++F  +   W+   +   +LF    +++ K  + +K   +       K+K   NS     + K  ++  N++   I    K K          K+   FLF L+ +W KLK   N+ +    +KW+E                  ++ EN+K+Y   ++  ++  +       +  G WK +   NG+  IR+ N
Sbjct: 2651 IPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKIENERFYVSFDNFWIEFTIKDGQDYFI------YRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNENWTEYLIENKKNQITINDRSFEFSFNNEYTHIKIGGLWTRYKLVKTDLFISIEGIWLKLLIKNKKLFLIIKEEIFKYKVKNKIRYIKVGDRWLKLKIINNSIYVYLERKWIRFVYNSKRKSILQKYKFKTVEIR----LKQREKFLFYLN-KWYKLKILRNQFYIWFVDKWME------------------LEVENDKWYLRYNNQNYEFDVFNNKIHFRHKGKWKVVEQYNGQCVIRIEN 3046          

HSP 24 Score: 51.6026 bits (122), Expect = 3.832e-6
Identity = 65/287 (22.65%), Postives = 124/287 (43.21%), Query Frame = 3
Query:  612 RMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFT---RKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRK-------WVRLQFSNRKVEYKCGKKWI---------EIKILQNYFYGKISG-KWYRVKFGNHF------NLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKL-----MSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNS 1379
            ++ R K+Y KI   W    L++ N F  +G K + +KF    ++ ++  +G+KW +++    K Y  I+N           E+F  G         W+ + F NR++  K    WI         +IKI  +Y   KIS  K   VK  +H       N I++      I FI+   ++ +   +  F+I   ++ +K    WIE   ++  + + I   K  +   L       +Y  +    I V  +  ++++ ++ NW++    + + +   N+K  K+S+N 
Sbjct:  552 KLDRKKVYLKINNSWKLLALINGNKFVKLGNKYLRLKFDNSQKERYFLLLGQKWYRLSVTDHKYYLRIENQ------DRNIEFFPHGPPKLLWENVWLAVAFKNREIFIKYIGCWIKTYLKPEKFQIKIGDSYVDAKISSSKSLEVKISDHLYKLVGRNRIEVGEKNLNITFIDNNLHVLINDDYLPFKIMDERFMVKIVDSWIEGVINENGDTISITVDKEKLKITLENGILCELYEGLK---IPVTIRFGKLYYNLDNNWVNVFPKDGKRYILTNQKKTKLSVND 829          
BLAST of SMED30010682 vs. Planmine SMEST
Match: SMESG000081459.1 (SMESG000081459.1)

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 314/831 (37.79%), Postives = 493/831 (59.33%), Query Frame = 3
Query:   87 WNEKDNNSD-YNIENSNRITDWDCWYKDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHCTLKTENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKR-ENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEK-KHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            ++E D N + + ++  N++ +W CWYK+Y+ K+  C SK  +S    KC  +R CKR C S YG  QC++ C  K   + K  KV+YRI   ++C+++VICVY S C   WP  + +GCYYT+A       H+        S R  +  T    SCLN    +  +    +   Q R+S G+ +YK G +W   +     L +LIG K V VKF     Y+KIG++WL+   + + +Y  + N W+  K+ + K++ +LG +W+  +       Y+ G +W+EI    N  Y K++ KWYRVK      LIK+   + K+  I    +IKL  RWFEF++K  KY IKF   + E++F     ++ I+  +YP++FK   + ++I   W++VE    ++FF  +K W++ SL +N L   KNKK        +    Y       ++  K+ D   GK FS + F +   S  +KL +G+WLPFK+ENG  L+ LSG+W++LK E NKLFY+  E+WIE I+IGK EFN++  HW++VKR E+ +  FFD+  WH IKL  +   LK N SWK L  +NG KF++LGN+Y +LKF    + ++ L +G K+Y+L   ++ +Y+++ N  + +EF+PH    +L  N WL +AFK+R+ +IK   CW++T  K  K  I+IGD++++ KISS K + VKI+   +KL+ RN IE+ +  L + FI+  LH+  N +++PF+  +E+  +K++DSWIE  I+E    I++ ++ EK+++T +NGILCE Y+ LK+P+ IRF +LYYNL+  W+ V+P+D  R+I  N+   KL
Sbjct:   26 YSELDENEEIFQVDKENKLQNWSCWYKNYFVKISHCPSKVTNSKLTRKCDMFRICKRQCQSDYGSRQCKIKCRTKRNKIPKSTKVLYRISNKDSCEDAVICVYDSHCKRTWPTTVQRGCYYTKA-------HK--------SNRKNVLST----SCLN-QNNFQFLFDKLKTSFQVRLSHGRRFYKFGNLWIPIRHKGDALEYLIGGKWVSVKFEGWRQYFKIGKQWLRTVIVERSLYIRLNNRWVRYKVFNSKDFIKLGERWLGFKVEKDSFYYQYGDEWLEIMFYDNDLYNKLNEKWYRVKIKRFSTLIKLGEKFNKLTIIHHSKFIKLGLRWFEFDMKSKKYSIKFGSSFHELQFIGKDIYIDIDGFQYPIVFKSFHILIKIKGDWLRVEPVKEKLFFLFDKFWLNLSLKKNVLLL-KNKK-------EETEFKYEKGKDLSLESVKDED---GKRFSVDNFYRKGKSFNLKLISGYWLPFKQENGIKLYLLSGKWVELKNEKNKLFYKDFEQWIETIIIGKYEFNKINFHWLEVKRNEDGQLMFFDAKRWHAIKLDRKKVYLKINNSWKLLALINGNKFVKLGNKYLRLKFDNSQKERYFLLLGQKWYRLSVTDHKYYLRIENQDRNIEFFPHGPPKLLWENVWLAVAFKNREIFIKYIGCWIKTYLKPEKFQIKIGDSYVDAKISSSKSLEVKISDHLYKLVGRNRIEVGEKNLNITFIDNNLHVLINDDYLPFKIMDERFMVKIVDSWIEGVINENGDTISITVDKEKLKITLENGILCELYEGLKIPVTIRFGKLYYNLDNNWVNVFPKDGKRYILTNQKKTKL 825          

HSP 2 Score: 144.436 bits (363), Expect = 1.550e-34
Identity = 118/522 (22.61%), Postives = 226/522 (43.30%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFS-LKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINML-INNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLE-IKISSDK 2159
            +  ++  GK Y +I   W E  ++D   F+++  KQ+  +F +  +Y K+G+ W+++  +  +I+  + + W+ LKI + + YF +G K VR++F N K     G+ W E ++ +  F   I  +W  +            G    +KFI   +++K+   W +F+I  G +FI  +  W      +    ++IN  ++ V +      ++I ++WIQ +Y+NNE+F  ++  W+ F + E  L+ + NK + K                                       KIEN   +   N  W+ FK  N     ++  +W K    D     Q   K ++  +     + + Q  W KVK EN  +Y + +D+W Q+ +   ++ + F+     L  +NGKK++   N +  +    + Q+ +  +++G    ++  +E +   ++     Q+E      +  L   N W      D  +YI   N W     +  K+ +   D   E IK S D+
Sbjct: 4846 VLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLVINGRQFKVRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERTLYAKINKDMFKF--------------------------------------KIENDDYLIEVNEQWVLFKILNNEPFIKIGNKWTKFDYNDGVQNVQVNGKTLQIKVQEGERYVKYQNQWYKVKVENGNYYIWFNDNWMQLFVENDNWFVAFSSGKIRLKTINGKKYLFFANDWRLI----ENQDGYDFVRVGDSIVRVSVQETVVTQEV-----QLEMKEENGVQYLKFENTWYKSKVLDGVYYIWMDNKWSALKIRNGKLVVMKNDNEPEIIKTSRDE 5320          

HSP 3 Score: 139.813 bits (351), Expect = 4.952e-33
Identity = 154/711 (21.66%), Postives = 288/711 (40.51%), Query Frame = 3
Query:  630 MYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEG------------------LNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIE-----NRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQ-------------------------------------LSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNR-----LQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKF------------------IRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIK 2513
            ++ ++G  W  A L + ++   IG + +P K  ++  Y+K+G +W ++      I   I   W  + + + K Y     + +RL+F    V +K  + WI+ K      Y    G W + K     NLIK+  N+   K   G                   N IK    WF  + K  K ++K   +W EI F K +  +   D   P+ F    + V+I+  W+ +E++NN  ++K+++ W+     +     N++ F K K+  ++   + R++++++     M   KNS +++ K+   N F KI N          WL     NG   +Q                                     ++ +W+ +K  D  + Y    KWI      K +  R         WVK K+    F+F   D W  +        +K NG    L  V+ K F                  I L  R  ++K       +F L+   +  K      ++++  +N+W Q+       +++LI+  W  + +K  K +I   N  +   F   K ++++G++++ +KI         IN + + L       L K   K +     +++ F G    F F + K+ IK+   WIE KI + + + V +++  I+ +  NG     + ++++PI++  K  + N++  W K
Sbjct: 1057 IFVQVGNNWVPADLTNNHVTLTIGNQNIPTKQNKEQLYYKLGSEWFEVYLYESIILIKIYEHWSPVSLINDKFYLIEEGELIRLKFFEENVFFKINEFWIQTKYEGTEVYSNFFGIWKQTKKKFKMNLIKLSKNWFPYKIENGKLLIQFYKDWYEMIFELTSNKIKFKNTWFTIKFKDSKIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRL---NHRDLIFKNVKGKLMYQLKNSWIEI-KFIKKNIFHKIGNK---------WLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFFQSDDKWTPVSWKNSRVRVKINGKVLDLKKVDHKYFVLIDGWKEFNLNDDNSIEITLPTRTIKVKIQ---HGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQINI-QRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKI---------INNQYWIL-------LGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQL-VLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHK 1733          

HSP 4 Score: 121.324 bits (303), Expect = 2.444e-27
Identity = 160/704 (22.73%), Postives = 296/704 (42.05%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFF-------LIGEKQ-----VPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQ-NYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGK---YFIKFDQKWIEIEFDKLQNFV-----LINDI------KYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFF-----------RKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKL----GKYFSNNQFSKI-----ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLD 2573
            +  ++  GK++  I +  +E +  + N ++       +IGE +      P+KF R   Y+ I  + L +  +   +   I+NA IE+K S  K   ++G +W  +        Y+ G + + I+I+  N F  KI   + +++F N    I+ K N+ ++ F   + Y K   +W   ++KK K    F   DQ  I  + ++ +        +I D       KY   +     +V IN++W +++ +N +I+++    W  FSL +                  NK L  I+LN++    Y   +   M   +N  +KL     K+F  NQ + +     EN   + L N  W+  K E+G F  +++  W++    DN+ FY    K IE        + +L   W+++K   ++ + F SD W  +K+V      +  G    + F NGK+F+  G  + + +  K    KFS+ +  ++ +L+ KE + Y     +   V+F  + S                   ++K G+ W +        FI I D +    +     +LV ING+ FK               V +I+    +     W+ F++E  + F+ +   WI+  I+E+  +  K+N +  +   +N       DD  + +           NE+W+     +N  FIK+     K D
Sbjct: 4496 VSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASYDYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKNALIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKY---GYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYL--INLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEK---GKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNES-------------------FLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLV-INGRQFK---------------VRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERT-LYAKINKDMFKFKIEN-------DDYLIEV-----------NEQWVLFKILNNEPFIKIGNKWTKFD 5137          

HSP 5 Score: 114.005 bits (284), Expect = 3.777e-25
Identity = 146/724 (20.17%), Postives = 297/724 (41.02%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPV------------------KFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFI----EGLNYIKLAKRWFEFEIKKGKYFIKFDQKWI------------EIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNS--DLKLGKYFSNNQFS----KIENSLKMKLFN---------------------GHWLPFKKENGSFL---FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFN--GSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRI-GDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            +IQ +  R +++Y++G  W E  L D  L   I ++  PV                  +F   H ++K GE W++     + +Y +    W +    +GK    +  KW        K+  K  K W  I         +I G  + +KF N   LI+I   + +IKF+    +G  ++K+ + W+E E +   ++ + +  WI             I F K + +  +N+ +Y +  +   +  ++ N WI++++  + +   +   W+         +F+   +++ I +    +   + + S     F N    +K+   +   +FS     I++  K +LF+                           KK+ G +    + ++G+W   K  + K FY++K+KWIEF     T   ++    +K +R ++    +  D W + + +    ++       W +L  +NGK +  L N+ +  +F  K  N+F +K+   ++ L    N ++++++  W + E   +       N+  + + F + K Y+K G  W+ET     + +I + G   L++    +KD  ++I+GK FK+                                 +FE  K  I++   W E KI E     V +N+  +++   +G       ++++P+ I   +LY  L   WIK    +    +++N  L + 
Sbjct: 3249 IIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAIKFENSRLLIRISIQWIEIKFVMKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRFIKGKQYYRMNNREYLLRKRFGVLSYRLKNHWIKIKFTKSTVLHYIGNEWLEILSKHGEEYFQFGDQILPIEIIDANSFQLKFADSILEVNFVNRYWKIKINNKWHEIKFSNKKVHIKSKDKWELFDVSSVLDSEAVERTDDFDLSNTSQQKKHKKQYGKYYGRYYLVNGRWYAFKIVNQKFFYKSKQKWIEFNSDNATMSIKINNKKLKFQRLDKVLNVYLIDKWRESQFLDDENSISVRTINRWINLKIINGKFY--LINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQ-IRIRFSNGKKYLKLGQIWIETKVIAGQFWIFVEGWKLLKM---IEKDYYIEISGKFFKV---------------------------------KFESAKRLIQLGQVWYEMKI-ENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRF 3932          

HSP 6 Score: 111.309 bits (277), Expect = 2.481e-24
Identity = 150/748 (20.05%), Postives = 303/748 (40.51%), Query Frame = 3
Query:  630 MYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRV--KFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS---------LNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKL---FNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKF---------NGSWKSLGFVNGKKFIRLGNRYSQLKFSKKG----------------------------------------QNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLIN--NAWLPMAFKDRKFYIKNGNCWLETIFK-GNKIFIRIGDAFLEIKISSDKDILVKINGKSFK---------------------LIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKV------------------IDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKN 2558
            +Y KIG+ W   ++ +  L   +G+K +  K  R   ++++G +W+++      +  +I + W  +       Y     + + ++F N  V +K G+ WIE K      Y   +G W +   + G H                     I +  +W+E++I +GK +IKF++ W  I F   +  + I    + V F+   + ++I+ QWI++++ +NEI  K    W+   +++ +L  + ++   ++          +N    I+ ++  +    P +   +K  +Y+  N  + +  S+  KL      HW+  K EN     ++  +WL++K +  + FYQ  ++     +I +  F      +VK+KR  E    +    W +I ++G+ +A+KF         N  W    F    +F       +  KF  K                                          N   +K+  K  K+  +E  +++ L++ W+Q +     S ++ I   N W+ +  K   F+++N    +   F   N+  + + + F+ I+I  D   L++I+G+  +                     L  +  +E ++  ++   INE+  I     W+ F+   E  F+++                   D+W+E KI E +   V  ++  I+ T  +G     Y   ++P+ I  K+ Y  ++  W K    +    IKLN+N
Sbjct: 2114 IYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHL--------------------IDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAVKFENSRLLIRISIQWIEIKFVSNEIKCKFQDEWVSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRF--IKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIKHKHEEDFYQFGDQLSPIGIIDENSF------FVKIKRV-EIILRYIKQYW-EIGILGKWFAVKFDEKGVYYEENKKWNVFNFELYTQFASTKTPETSTKFITKEISKSHFPWVFRWENKWFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDW-YLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKI-ENERFYVSFDNFWIEFTIKDGQDYFIYRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNEN 2829          

HSP 7 Score: 108.997 bits (271), Expect = 1.459e-23
Identity = 140/704 (19.89%), Postives = 283/704 (40.20%), Query Frame = 3
Query:  594 EIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEK------------QVPVKFTRKHHYWKIGEK------------------WLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNR-KVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLN-------------------------------YIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLIND--IKYPVLFKLMSVY------------------VQINNQWIQV----------------EYK---NNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSD--LKLGKYFSNNQ---------------FSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFS-LKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIE 2348
            EI    ++ +GK++ K+ + W+E +  + + ++ + +             + P++F +   Y+++  +                  W+KI   +  +  +I N W+E+    G+EYF+ G + + ++  +    + K     +E+  +  Y+  KI+ KW+ +KF N    IK K  +        L+                               Y  +  RW+ F+I   K+F K  QKWIE   D     + IN+  +K+  L K+++VY                  V+  N+WI +                E+K   +N+   K+ KNW    L  N  F   +   +K  ++     +  ++   +++ F N    LKLG+ +   +                  IE    +++ +G +   K E+   L QL   W ++K E+N+ +    E+W+E ++    EF +     + VK  + + Y      W + K+V  HY ++ NG        + K++I  G+R  +  +     N F+ +K+ G + +     ++ Y+ +   W +++    +S+++LIN  + P   K +K  IK G  W +      ++    GD ++E    + + I        +  I+R         L++ F N   +  +  +W   + +    +I  +D W+E
Sbjct: 3413 EIKFVMKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRFIKGKQYYRMNNREYLLRKRFGVLSYRLKNHWIKIKFTKSTVLHYIGNEWLEILSKHGEEYFQFGDQILPIEIIDANSFQLKFADSILEVNFVNRYWKIKINNKWHEIKFSNKKVHIKSKDKWELFDVSSVLDSEAVERTDDFDLSNTSQQKKHKKQYGKYYGRYYLVNGRWYAFKIVNQKFFYKSKQKWIEFNSDNATMSIKINNKKLKFQRLDKVLNVYLIDKWRESQFLDDENSISVRTINRWINLKIINGKFYLINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQIRIR-FSNGKKYLKLGQIWIETKVIAGQFWIFVEGWKLLKMIEKDYYIEI-SGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYI----NGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKV-EQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELI--------YPGIQR---------LRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLE 4092          

HSP 8 Score: 108.227 bits (269), Expect = 1.962e-23
Identity = 140/631 (22.19%), Postives = 268/631 (42.47%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISS------------GKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNY-IKLAKRWFEFEIKKGKYFIKFDQKWIEIEF-DKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNE-----IFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKL------GKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRL-QGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNE--IELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQL 2408
             I+F+ S  K+Y KI   W E + +   +     +  +P++F       +I E W+ I       Y  +   WI +  S             GK+++RL  + +  +    K+ Y+    WIEIK ++   + KI  KW  +   N     +   +   I+ I+  ++ IK+ K  F        + I+ + KWI ++F DK+  +           FK        N++WI + +K  +     +F+  N +W+ F   E   FF+ + K   +S  + R    R   +GK+   K  D K        K F+ N  + IE +L  +      +  K ++G F  Q   +  K K  +   F     +W + I I +   + L   +W K+  +  K +   +++   I+ +     LK   SW ++  +N + +I LG ++++   ++ G     ++ GGK +K   ++N   IKL   W +++    R + +LI+  W+  + K+ + ++  G   +         FI I   + + KI  ++  +  +N  +   I  N   I + K   +  +I    HI   G W  FR E+++ ++ +   W+   ++EK  + VK+ +E  Q 
Sbjct: 1229 TIKFKDS--KIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRLNHRDLIFKNVKGKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRY-----------FK--------NSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFFQSDDKWTPVSWKNSR---VRVKINGKVLDLKKVDHKYFVLIDGWKEFNLNDDNSIEITLPTRT-----IKVKIQHGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQ-INIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENG---IYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQL-VLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKT-LFVKIENESFQF 1824          

HSP 9 Score: 105.916 bits (263), Expect = 9.983e-23
Identity = 163/782 (20.84%), Postives = 303/782 (38.75%), Query Frame = 3
Query:  627 KMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKW------------------VRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS---------LNSKRNILYRSSSSGKMKPFK-----------NSDLKLG-----------------KYFSNNQFSKIEN---------SLKMKLFNGHWLPFKKENG-SFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHW--VKVKRENEKFYFFDSDSWHQIKLVGQ--------------------HYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQ-NKFSLKMGGKF-------YKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGN-KIFIRIGDAFLEIKISSDKDIL---------VKINGKSFKLI-----------ERNEIELNKLILKVNFINEKLHIFFNGNWVPF------------------RFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            ++Y+ I + W        N++  IG+  VP  F        IG+K ++      K++  +   W E+ +       ++  +W                  + ++F N +V YK G+ WIE K   N  Y   +G W                  +K    +G + I+++  W+ + +  G+   +F++ W  I F   +  + I    + V F+   ++++++ QW++VE+  NE   K   +W+   ++E +L    ++ L +I          LN    ++  +  +    P K           N DL L                  K+  N    KI N          L+   F    LP +  +G +F  ++   +LK++ E+++   ++KE W E        + +    W  V +K+  E   F D D   Q  +  Q                    H   K+   +    F+N  ++ R+     Q+ +  +GQ   FSL    K         K+   +N + I LNN WK+  F  + SI +L+ N W+ +  K+RKF+ +N    L   FK N ++ + I   ++ +KI S K  L         V I+ + F ++            RN I+L +  +++ FI +++ +F + +WV                    +FE  K F+   + W E ++ EK   +V + D  ++L    GI   +Y      +     + +  +   W K    D   FI +N N  + 
Sbjct: 4270 EVYFYINEYWVVVSFETDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIW------------------KKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENEFRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASYDYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKNALIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVD---QTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFIN-HRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQL-EKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRF 5028          

HSP 10 Score: 104.375 bits (259), Expect = 3.438e-22
Identity = 157/714 (21.99%), Postives = 299/714 (41.88%), Query Frame = 3
Query:  531 TKNIYSCL-NNMGRY-----PKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHY------------------WKIGEKWLKIAALRQKIYGH------------------IQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS-----LNSKRNILYRSSSSGKMKPFKNSD-----LKLGKYFSNNQFSKIENSLKMK------LFNGHWLPFKKENGSFLFQLSGQWLKLKE----ED-NKLFYQTKEKWIEFILIGKTEFNR-------------------LQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQN-KFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIF------------------IRIGDAFLEIKISSDKD-ILVKINGKSFKLI-ERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDE 2363
            T NIY+ + +NM  +       I    + +IQ +   GK++Y++G  WFE  L D  L   I ++  PV       Y                  +K GE W++       IY +                  I N W    + +G+ +F+  + W R+ F   K++ +       +K   +  + ++S +W  V+F  +    K +G++  +K +EG  +I + +  +E E +   ++ K +  WI I   +  ++       YP+ F     Y  INN+ + +   N  + +++       +LIE +  F +NK L KI      + +K+ + Y      ++ P +  D     LK+G +F   +F   +  ++ K       F+ + + +KK+N   L  L     K+KE    ED ++    T+    E I  G++E  R                   +   W ++K EN++ Y+     W    L  +   +K  G    +   + K  I L N++ +  F   G+N    + +  K+ KL+ K   F+ +      +++F  +  + +LIN  W+ M  +  KFY++  N W+E +   N+ F                  I++G +++E+K  +D+  + V  +    K++ +    E+   +++V F N K  +FF   W  F+ E+ K  + + D W+E  I E
Sbjct: 4286 TDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIWKKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENEFRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVIGETRDASY------DYPIKFNRGKQYYHINNRDLLLNNINGTLSYQIKN-----ALIEVK--FSENKWLHKIGNRWWEIITKQGLEYYQFGV-ELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLK----KIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYF---GENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKENDELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKE 4978          

HSP 11 Score: 103.605 bits (257), Expect = 6.544e-22
Identity = 141/635 (22.20%), Postives = 268/635 (42.20%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEY--------FRL-----------GRKWVRLQFSNRKVEYKCGKKWIEI------------------------KILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYF-IKFDQKWIEIEFDKLQNFVLINDIKYPVL-FKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSD-LKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSD-SWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIEL--NKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDE 2363
            Q +  +GK +Y++       K V   L + +    + +KF +K+ + KIG KWL I +   + Y    N+   ++I     +        FRL             KW+ ++F+++ V Y    KWI +                        K  +N+F+ +   KW  V + N    +KI G    +K ++   Y  L   W EF +       I    + I+++    + F L ++ +     F     +V  +N+W Q+  + N +   ++K W       N+LF  KN  L+ I   + +  L   +S   MK   N   + LGK ++  +F   EN + ++ F G    F+  +   L +L  +W+++K + ++      E WIEF +    EF       + +  + +K+ F + D +WH+ K+  +   +     W      N ++FIR+  R  + ++           +GG            +IK+   W +      + I + +N  WL +  +++  ++K  N   +   KGN  +I++G  +L I++ ++ +I      K FK   ++++ +   KL LK+ + N++L + +   W   R E EK +I   + W E  I E
Sbjct: 1313 QIQFIKGKQFYRLNHRDLIFKNVKGKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKKKQQRGLFYFHNNDWVKFKKTERNFFF-QSDDKWTPVSWKNSRVRVKINGKVLDLKKVDH-KYFVLIDGWKEFNLNDDNSIEITLPTRTIKVKIQHGE-FYLQHEARLTKFKFNNKMYFVNFDNEWFQINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWT--KFHLAENGIYVE-FGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMD-DKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRY-----------IGG----------FTHIKIYGKWDRFR-TEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINN-EIYTYFARKWFKFSYKHKVLVIPTKLPLKIKYENKELLVNYLNEWYRMRIENEKYYIWFFNEWAELSIFE 1917          

HSP 12 Score: 98.2117 bits (243), Expect = 2.253e-20
Identity = 152/744 (20.43%), Postives = 303/744 (40.73%), Query Frame = 3
Query:  402 CNGLWP--KYINQGCYYTQAFSQWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYW-KIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKIS-LNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFS-KIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILI-GKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWL------PMAFKDRKFYIKNGNCWLETIFKG----------------NKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKL 2549
             NG W   K +NQ  +Y     Q W+E   + A   I     I   K  +  L+ +     ID   E   QF      +  +    W   K+++   + +  E     KF   + +  KI + W  +       +  I   WI+ +IS    Y       +R++FSN K   K G+ WIE K++   F+  + G W  +K       I+I G + K+KF      I+L + W+E +I+  ++++  +++W+EI     + F+   +I+ PV      +Y+++ + WI+ +  N     ++N     F L + + +  +  +  + S +N   +I       G    +K ++  +  +        K+E      L N  + PF+ +    + ++  +W  ++  + +L +   +KWIEFI   G+  +  +Q   +++K +N   Y    + WH++K+      + F   W  L       ++R GN+    KF  K Q +  +    K+ +L+ +   + I+  N+ +     P  +    I N         P +FK RK     G   ++    G                +  ++   +  +EI    +KD+   + G        ++I +N + L     NE  +I +  +W    + E + +  + + W+     E  +I  ++ D  +   F N  +     D  +       +++Y L  +W +VY  D++  +K+
Sbjct: 3635 VNGRWYAFKIVNQKFFYKSK--QKWIEFNSDNATMSIK----INNKKLKFQRLDKVLNVYLIDKWRES--QFLDDENSISVRTINRWINLKIINGKFYLINQETATEFKFKTDNQFIIKIEKNWFPLRLDSNYYFLEIDGYWIKFEISDNNYYINNNNHQIRIRFSNGKKYLKLGQIWIETKVIAGQFWIFVEG-WKLLKMIEKDYYIEISGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHI----KIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELIYPGIQR--LRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQ--DYKFRIKDQ-QIDIWYENKWRRLIKRNGKYQIQ--NETESQTVIPIETKKTTIPNLTTTPKITKPKSFK-RKSVKSKGEISIDFSVSGKIRKKQVKKILNKYKKDGKYVNPQENLIEIS-KQNKDLPFPVTG--------SQININGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSF-ETDNIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKI 4347          

HSP 13 Score: 95.9005 bits (237), Expect = 1.321e-19
Identity = 150/703 (21.34%), Postives = 289/703 (41.11%), Query Frame = 3
Query:  582 DPSSEIVIQFRMSRGKMYYKIGQVWFEAKLV-----DRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKI--ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEF-----ILIGKTEF-------------NRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGK---FYKLMSKENLFYIKLNND--WKQVEFYP--------HRSINMLINNAWLPMAFK---DRKF----YIKNGNCWLETIFKGNKIFIRIG--DAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKL 2549
            D S EI +  R  + K+ +    +  EA+L      ++  F     +   +   R H    I + W KI     K++    N  I ++  +GK+Y +LG  W+ ++  N +     GKKW +  + +N  Y +  GK ++ +F ++ +LIK+   + +IK  +    + + + W EF +K G+ F+ F +  I I  D    F+ I+   +        +YV + N+W + E +NN  F ++ K          R  FR       I +             GK   F+  D ++  + +    + I  E +L +K+ N     FK +      ++  +WL+++  +N+++     KW +F     +L+  T+              N L   W +++ ENEK+Y +  + W ++ +    + +++         +N K      N++ ++    K  N++ +K+G +     K++ K     I+ +     K  E Y            IN   +   L    K   DR F    YI      +E   K  K+  +I   D + EI I       VK+N K  K +  N I+       + +  E ++++  G W    FE +  + K+ ++W+  +I +   +T+ + D+ IQ                        +L+Y L  +WI+VY  D++  + +
Sbjct: 1522 DNSIEITLPTRTIKVKIQHGEFYLQHEARLTKFKFNNKMYFVNFDNEWFQINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKK---------RRFEFRYIGGFTHIKI------------YGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENES-FQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSYKHKVLVIPTKLPLKIKYENKELLVNYL-NEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEV---IKENNEYKIKIGDETENILKIVKKLKPTTIRKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDH-----VKLNYKKEKKL--NFIQWKNYWYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQI-QNNQLTINVGDKIIQTKQQRD------------------RLFYQLGSEWIEVYLYDSILLLNI 2172          

HSP 14 Score: 94.7449 bits (234), Expect = 3.183e-19
Identity = 145/693 (20.92%), Postives = 263/693 (37.95%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIE-----------------IEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRL-FFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLK----------------LKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINML-INNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIER---NEIELNKLILKVNFINEKLHIFFN------------------GNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKV 2516
            + ++   + Y  I + W E  + D   F   GE ++PVK      Y ++G  W+K   +    +  I        +   K+Y   G +     + N     K    W+  K+  +  Y  I   W R+K       I I   Y   +     + IK+  +WF+  I  G+    F  KWIE                 I+FD    + +  +  + +  K   +Y+   + W+++  K ++ + +       F + + ++  + +NK    I  N K  I    + S  + P +     +    +  + +K   S K K          K   S  F +SG+  K                +  ++N +    + K + F + G ++ N + G  +  K++NE  Y    DSW+QI           N  W  + F     + ++G+      F     N+  + +G K  +        + +L   W   E Y + SI +L I + W P++  + KFY+      +E  F+  ++  + G+ ++E K  ++ DI    NG   K ++R   + IE++      N IN +LH  FN                  G     +FE  + FI++   W+E +  E +    K   + + +    G L  N D+    I  R    YY LN  WI +
Sbjct: 3859 EMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEFIYKNGELIYPGIQRLRIKFDNTNTYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQDYKFRIKDQQIDIWYENKWRRLIKRNGKYQIQ-NETESQTVIPIETKKTTIPNLTTTPKITK-PKSFKRKSVKS------KGEISIDFSVSGKIRKKQVKKILNKYKKDGKYVNPQENLIEISKQNKDLPFPVTG-SQIN-INGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSFETDNIYTQIGDNMVPFYFQ---NNQMIMTIGDKIIQTKQDGGKVFYQLGLQW--FEVYLYDSILLLKIYDEWTPVSLVNDKFYVIEDEVLIEIRFENTRVSYKYGEIWIETKYENN-DIYSNFNGIWKKTLDRQGKHMIEISNNWYPYNVINGQLHFQFNKIWHRIVFGIEKIQIEIQGTMFAVKFENSRLFIRMSIQWLEVEFYENE-FRCKFQGDWVSVKVVEGKLHINIDENLYEIEWRNDNFYYKLNGLWIVI 4534          

HSP 15 Score: 93.5893 bits (231), Expect = 6.424e-19
Identity = 137/624 (21.96%), Postives = 254/624 (40.71%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENS----------LKMKLFNGHW-LPFKKENGSFL-------FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIK-LVGQHYALKFNGSWKSL----------GFVNG------KKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKE-NLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLI---LKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAK 2354
            +I  R   GK Y K+G  W   K+++   + L+G+K           Y + G K  K      K    +   WIE+KI   ++   +   W+     N +     G+  I I +   Y +  I G W++ K       + +   + + +      +I++ KR FEF    G   IK   KW     +  + ++ +N     ++ +  +++V+I N+  Q + K N  + KV   W+   LI N ++    +K  K S   K  +L   +       ++N +L L  Y +     +IEN            ++ +F G W + +KK N  F        F    +W ++ +E+N+   +  ++    + I K    +L+   +   R++E      ++ +  IK  V +   + F  S K L           F NG      K  I +  +  +L F    ++K+S  +         KE  L +I+  N W  + FY   +I + I   W  ++F+    Y K G  W+    + N++ I +GD  ++ K   D+ +  ++  +  ++   + I L  +      V FI+   ++  +G  +  RFE    F K  + WIE K
Sbjct: 1605 LIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSY--KHKVLVIPTKLPLKIKYENKEL-LVNYLNEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEVIKENNEYKIKIGDETENILKIVK----KLKPTTI---RKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDHVKLNYKKEKKLNFIQWKNYWYPI-FYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETK 2216          

HSP 16 Score: 87.0409 bits (214), Expect = 7.193e-17
Identity = 152/731 (20.79%), Postives = 278/731 (38.03%), Query Frame = 3
Query:  606 QFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKW--YRVKFGNHF----------------NLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQ------------------KWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENS----------LKMKLFNGHW-LPFKKENGSFL-------FQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIK-LVGQHYALKFNGSWKSL----------GFVNGK------KFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKEN-LFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLI---LKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLD 2573
            Q  + R  +   I + W +       LF       +P++F     Y K+G  W+ +  +  + +  +   W +  ++    Y   G K  + +F + K   K G++WIEIKI Q+     I   W  + VK G  F                  I I GN+ K K  +   Y+ L  +W E+EI+  + FI+  +                  KW     +  + ++ +N     ++ +  +++V+I N+  Q + K N  + KV   W+   LI N ++    +K  K S   K  +L   +       ++N +L L  Y +     +IEN            ++ +F G W + +KK N  F        F    +W ++ +E+N+   +  ++    + I K    +L+   +   R++E      ++ +  IK  V +   + F  S K L           F NGK        I +  +  +L F    ++K+S  +         KE  L +I+  N W  + FY   +I + I   W  ++F+    Y K G  W+    + N++ I +GD  ++ K   D+ +  ++  +  ++   + I L  +      V FI+   ++  +G  +  RFE    F K  + WIE K + +                                      +Y N N  W K   R     I +N    + D
Sbjct: 1571 QINIQRNHLSILIDKYWTKIVYKGNKLFIDKNNNLIPIRFLNGKKYLKLGNSWINMKIINNQYWILLGKKWTKFHLAENGIYVEFGGKVFKFEFRDNKSLIKLGQRWIEIKIQQDRQLVLIDENWIEFSVKNGREFVYFGEMEIPISMDDKYQFINIDGNWHKFKIYKERIYVYLVNKWTEYEIRNNRQFIRIKKRRFEFRYIGGFTHIKIYGKWDRFRTEDKEIYLFLNGKWLTLIVEEKTLFVKIENESFQFKNKGNYRYIKVGWKWLRIRLINNEIYTYFARKWFKFSY--KHKVLVIPTKLPLKIKYENKEL-LVNYLNEWYRMRIENEKYYIWFFNEWAELSIFEGEWCIRYKKINYKFRIINSKLNFWYENKWEEVIKENNEYKIKIGDETENILKIVK----KLKPTTI---RKSESIKTKTTEIYQLIKSTVTRRTEINFQTSVKELKNKVKKILDRNFKNGKYINTQKHLIEMSEKNQKLPFKINRKDKYSEIIIDHVKLNYKKEKKLNFIQWKNYWYPI-FYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENE-------------------------------------NVYSNFNGIWKKTLDRTGKHLIDINNKWYEYD 2252          

HSP 17 Score: 83.1889 bits (204), Expect = 9.313e-16
Identity = 133/725 (18.34%), Postives = 282/725 (38.90%), Query Frame = 3
Query:  600 VIQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHY-WKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKW---------------------------------------VRLQFSNRKVEYK--------CGKKWIEIKILQNYFYGKISGKWYRVKFGNHFN------------------LIKIKGNYRKIKFIEGLNYIKLAK-RWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMK-------PFKNSDLKLGKYFSNNQFSKI---------ENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKF------------------------SKKGQNKFSLKMGGKFYKLMSKE---------NLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGI 2426
            +I+ + S  K  +KIG  W+E        ++  G + +P++    + +  KIG+ +LKI     +     +  W E+   +   Y++   KW                                       +R ++++R+ +YK           +W  +KI     Y +  G+W      +                     LI +   +++  F E  + + L + +W +  IK  K+F +  +  + I+F +       ND           + V IN  W+ ++ ++ + + ++N NW+ F +I+N+ F+  N K ++      RN +    S  +MK        F + D  L K  ++  + +I         EN  +   F   W  F+ E G F   +  +W++L  ++   +     +      IG   F ++   W K K  +  F+ F +D+W +  +  ++  L  NG    + +++G   +++G+++ Q K+                        +K  ++ F  K+    Y +   E         N  +IK+ N W + + Y     N+ +N   L +  ++ + Y+K  N W +   +    +I   D ++++ + +D   +   +GK                +++  IN K ++FF  +W     ++   F++V DS +   + E    TV   + ++++  +NG+
Sbjct: 4579 LIEVKFSENKWLHKIGNRWWEIITKQGLEYYQFGVELLPIEIVDGNTFRLKIGDFFLKIRFENDQWQIESKENWYEMTFDNNIVYYKKDNKWLLVDLKKIKETGSFEDVDQTTITTQPNEPEKITEGESEVIRDEYTHRRNKYKYKYGYFVFINHRWRRMKIENKQIYYQHRGQWETFSLDDEEKIVKIKGLKLKIKQSDNKYLINLNNQWKEFYFGENYSIMVLVRNKWIKLIIKNRKFFWENQETILRIKFKE-------ND----------ELLVLINRFWVLMKIESGKFYLEINNNWIEFVIIDNQFFYVLNNKQIETRFFKSRNYIKLGQSWIEMKFITDQIWVFVSDDWVLLKIVNDETYFEIGGKLVRVKFENGKRFVFFGELWYEFQLEKGKFSVNIEDRWVELIIKEGIEYTSYGGEMFAVKFIGNESFLKIGSIWTKFKIVDGYFFIFINDNWTRFIVRERNQVLVINGRQFKVRYIDGLTSLKIGSKWIQFKYENNEMFLLIDGLWIKFDINERTLYAKINKDMFKFKIENDDYLIEVNEQWVLFKILNNEPFIKIGNKWTKFD-YNDGVQNVQVNGKTLQIKVQEGERYVKYQNQWYKVKVENGNYYIWFNDNWMQLFVENDNWFVAFSSGK----------------IRLKTINGKKYLFFANDWRLIENQDGYDFVRVGDSIVRVSVQE----TVVTQEVQLEMKEENGV 5265          

HSP 18 Score: 82.8037 bits (203), Expect = 1.339e-15
Identity = 139/656 (21.19%), Postives = 262/656 (39.94%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFI-LIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERNE---IELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKN 2558
            I+ R S GK Y K+GQ+W E K++    F++  E    +K   K +Y +I  K+ K+     K    +   W E+KI + + Y  +  +WV +   + K   K G+  + +KI+    Y ++   W + K  N    ++I G   +    +   YI    R FEF    G   IK D  W+  +      +V I +I   +  +  S+ + IN ++     K  +   KV   W    +I  RL F    K ++  +     ++Y      ++K F N++     Y  +    K++N +    F   WL    +   +  +   Q  K + +D ++    + KW   I   GK +          +  E +K    +  +  +I    +  + K   S KS G ++    +    R  Q+   KK  NK+  K  GK+  +  +ENL  I   N  K + F P     + IN   L    ++   YI+  + W +  +  N+++  I + ++ +   +D +I  +I         +N    + +   I++      K+       W      +    +K+ D W    +   K   ++ ++  I++ F+N  +   Y ++ +        +Y N N  W K   R     I+++ N
Sbjct: 3787 IRIRFSNGKKYLKLGQIWIETKVI-AGQFWIFVEGWKLLKMIEKDYYIEISGKFFKVKFESAKRLIQLGQVWYEMKIENNRFYVHINERWVEILIKDGKEFIKSGEIELPVKIVDGELYIELGSHWIKFKIVNGHYHVEINGKLTRFYLRDRKQYILEGDREFEFSYINGFTHIKIDGYWVRYKVTNDIVYVFIEEIWLRLKVEQKSLSILINEEYFPFRIKVKKHMIKVGLKWFDVRIINGRLHFYFGDKWIEF-IYKNGELIYPGIQRLRIK-FDNTN-TYAMYLEDWHKMKMKNGIIYIWFLDDWLELSGKYDDWYVRYGNQDYKFRIKDQQIDIWYENKWRRLIKRNGKYQIQNETESQTVIPIETKKTTIPNLTTTPKI---TKPKSFK-RKSVKSKGEISIDFSVSGKIRKKQV---KKILNKY--KKDGKY--VNPQENLIEISKQN--KDLPF-PVTGSQININGINLNFKKQNETNYIQWKDSWYQIFYYENEVYFYINEYWVVVSFETD-NIYTQIGDNMVPFYFQNNQMIMTIGDKIIQTKQDGGKVFYQLGLQWFEVYLYDSILLLKIYDEWTPVSLVNDKFYVIE-DEVLIEIRFENTRVSYKYGEIWIETKYENNDIYSNFNGIWKKTLDRQGKHMIEISNN 4422          

HSP 19 Score: 80.8777 bits (198), Expect = 4.522e-15
Identity = 93/465 (20.00%), Postives = 191/465 (41.08%), Query Frame = 3
Query:  990 KFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKG--------------------QNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKL---IERNEIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEK 2315
            K  NH N I  K  +  I + +   Y+ +   W    I+    F++    W+  +       + I +   P       +Y ++ ++W +V    + I  K+ ++W   SLI ++ +  +  +L+++    + N+ ++ +       ++ +++     +SN              F G W   KK+    L +LS  W   K E+ KL  Q  + W E I    +   + +  W  +K ++ K Y   S  W +I+ + +   +KF   W  + F NGK  +R+   +  +++                         N+     G +FY+L  ++ +F        K V+      +   + N+W+ + F  +  + K GN WL  + +  + + +  ++   I+I  +    +KI    F+L   ++  EIE+N   + V F ++ +  F N  W+   F+E+K
Sbjct: 1015 KTENHVNYILWKNYWYPIFYYDEEIYLNVYGYWTLVSIETDVIFVQVGNNWVPADLTNNHVTLTIGNQNIPTKQNKEQLYYKLGSEWFEVYLYESIILIKIYEHWSPVSLINDKFYLIEEGELIRLKF-FEENVFFKINEFWIQTKYEGTEV-----YSN--------------FFGIWKQTKKKFKMNLIKLSKNWFPYKIENGKLLIQFYKDWYEMIFELTSNKIKFKNTWFTIKFKDSKIYLKISIQWKEIRFIKEEIQIKFQDFWIPIRFNNGKIQVRIDEIWMDIEWRNNNFYYKLSEVWIPIGYSQEISETNQIQFIKGKQFYRLNHRDLIF--------KNVK----GKLMYQLKNSWIEIKFIKKNIFHKIGNKWLHIVSRNGEEYYQFDNSSYPIEIIDENSFNIKIYKIIFRLRFTVDHWEIEMNDKWIPVKFNDKIVRYFKNSKWISLNFKEKK 1447          

HSP 20 Score: 79.7221 bits (195), Expect = 1.145e-14
Identity = 97/479 (20.25%), Postives = 210/479 (43.84%), Query Frame = 3
Query:  654 WFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQ---------------------NAWIELKISSGKEYFRLGRKWVRLQFS-NRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLF----KLMSV--------------YVQINNQWIQVEYKNNEIFF------------------KVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKN--SDLKLGKYFSNNQFSKIENSLKMKLFNGHW------------------LPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTE--FNRLQGHWVKVK-RENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNR 1847
            WF  K+++ + F+   EK +   +       KI EK LKI    +K + ++                      N WI+LKI +G  + +     +R +F+ + +       ++I I+I ++++  +I G+W R +   ++  + I    ++I+F+ G  Y++  + W EF+I   +Y+I  ++KWI  +      F+ I    + + F    KL+++              YV  +N WI+   K+ + +F                  K++ +W  F ++  ++  + N+   +  + +K+N +  +  S +   F N  + +K+G  ++  +  K +  + ++   G W                    +K +N     ++  +WLKLK  +N ++   + KWI F+   K +    + +   V+++ ++ EKF F+  + W+++K++   + + F   W  L   N K ++R  N+
Sbjct: 2538 WFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKIENERFYVSFDNFWIEFTIKDGQDYFIYRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNENWTEYLIENKKNQITINDRSFEF-SFNNEYTHIKIGGLWTRYKLVKTDLFISIE---GIWLKLLIKNKKLFLIIKEEIFKYKVKNKIRYIKVGDRWLKLKIINNSIYVYLERKWIRFVYNSKRKSILQKYKFKTVEIRLKQREKFLFY-LNKWYKLKILRNQFYIWFVDKWMELEVENDKWYLRYNNQ 3011          

HSP 21 Score: 77.411 bits (189), Expect = 6.150e-14
Identity = 131/648 (20.22%), Postives = 254/648 (39.20%), Query Frame = 3
Query:  762 WLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKL-MSKENLFYIKLNNDWKQVEF---YPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKI--SSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEKLHIFFNGNWVPFRF------------------EEEKTFIKVIDSWIEAKI--DEKKHITVKLNDEKIQLTFDNGIL-------------------CENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKL 2570
            W  I    + IY +I   W  +   S   Y ++G  WV +Q  N ++    G K I+ K  ++  + ++  +W  V   +   L+ I   +  + FI+   Y+       E   +    F K+ + WIE +++    +   N I    L +     + INN+W + +    +++ K NK W       +R+ F   +  ++I     +  L+          F+NS L +       +   + N +K K F   W+  K   G    ++   W +++  ++  +Y+  + WI   +I K E   ++     ++    K Y+  ++  H +K V      K    W  +   N K + R+GN++ ++K   K +  F  + G +   + +  EN F++K+    K+VE    Y  +   + I   W  + F ++  Y +    W       N     +   F   K   +S K I  +I+   F  + R E   NK       INE      N  W+ F +                  EE+K F+ + D W + KI  +E   +T++  +  I+L    G+                      N D+  +PI I        ++ +W++   ++N  ++ +N  + ++
Sbjct: 2086 WYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDRLFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIW-------HRIVFGIEEIQIEI-----QGTLFAVK-------FENSRLLIRISIQWIEIKFVSNEIKCK-FQDEWVSVKVVKGKLHMKVDEDWYEVEWRNDHFYYRMNDAWI---IISKNEDASME---YPIRFIKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIK--HKHEEDF-YQFGDQLSPIGIIDENSFFVKI----KRVEIILRYIKQYWEIGILGKWFAVKFDEKGVYYEENKKW-------NVFNFELYTQFASTKTPETSTKFITKEISKSHFPWVFRWE---NKW-FPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKEEKKYFVYLSDRWRQYKINSEESDSLTIRTLNRWIKLKIKTGMFFLQNQETLIRFRFAPDNQFSVNLDNQFIPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRI 2689          

HSP 22 Score: 76.2554 bits (186), Expect = 1.338e-13
Identity = 125/543 (23.02%), Postives = 209/543 (38.49%), Query Frame = 3
Query: 1158 DKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNSDLKLGKY-------FSNNQFSKIENS--LKMKLFNGH--------WLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILI-GK--TEFNRL---------------QGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNNDWKQVE-------FYPHRSI-----------NMLIN-----------NAWLPMAFKDRKFYIKNGNCWLETIFKGNKIFIRIGDAFLEIKISSDKDILVKINGKSFKLIERN-----EIELNKLILKVNFINEKLHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLTFDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNLVKLDKE 2579
            +K  NF+   +  YP+ +   ++Y+ I   W  V ++++ I+ K+ +NW+   +  N+L      K+++      R + Y+  S        +S L L  Y       F +N F  IE+   ++++  N H        W+  K EN +     +G W K  +   K       KW E+ +I GK   +FN++               QG    VK EN +     S  W +IK V      KF   W S+  V GK                       +K+   +Y++  + + FY ++N+ W  +         YP R I           N L+            N W+ +  +++K Y + GN WLE   K  + F + GD    I I  +    VKI  K  ++I R      EI +      V F  + ++   N  W  F FE    F        +      K IT +++       F        +++   P  I  +  +Y  NEKWI     DN+  +K+ +  +K+ KE
Sbjct: 2074 EKKLNFIQWKNYWYPIFYYEENIYLYIYGYWTVVSFESDTIYTKIGENWVPVQIQNNQLTINVGDKIIQTKQQRDR-LFYQLGSEWIEVYLYDSILLLNIYDEWTPVVFIDNNFYVIEDGELIEIRFENAHVFFKYGEIWIETKYENENVYSNFNGIWKKTLDRTGKHLIDINNKWYEYDIIRGKLYIKFNKIWHRIVFGIEEIQIEIQGTLFAVKFENSRLLIRISIQWIEIKFVSNEIKCKFQDEWVSVKVVKGK---------------------LHMKVDEDWYEVEWRNDHFYYRMNDAWIIISKNEDASMEYPIRFIKGKQYYRINNKNHLLKSVNGKLMYKLKNHWIRVKVENQKTYHRIGNKWLEIKHKHEEDFYQFGDQLSPIGIIDENSFFVKI--KRVEIILRYIKQYWEIGILGKWFAVKFDEKGVYYEENKKWNVFNFELYTQFAST-----KTPETSTKFITKEISKSHFPWVF-------RWENKWFPFKIINEDYFYEQNEKWIAFPWIDNVADVKIYEKELKIYKE 2580          

HSP 23 Score: 68.9366 bits (167), Expect = 2.447e-11
Identity = 89/425 (20.94%), Postives = 176/425 (41.41%), Query Frame = 3
Query:  603 IQFRMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYKCGKKWIEIKILQNYFYGKISGKW--YRVKFGNHFNLIKIKGNYRK----IKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNSKRNILYRSSSSGKMKPFKNS-----DLKLGKYFSNNQFSKIENSLKMKLFNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKTEFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGFVNGKKFIRLGN 1844
            I  R+       +I   W   ++ +   + +I  K   ++F     Y +  + W++   + ++ +  I+  WI  +I +  E+  +G K   ++F N K     G  W+E+KI    FY      W  + +K G  + +      YRK    ++ +   +Y+K+   W +F+I   K  IK ++ W E   +  +N + IND  +   F     +++I   W + +    ++F  +   W+   +   +LF    +++ K  + +K   +       K+K   NS     + K  ++  N++   I    K K          K+   FLF L+ +W KLK   N+ +    +KW+E                  ++ EN+K+Y   ++  ++  +       +  G WK +   NG+  IR+ N
Sbjct: 2651 IPIRIEEDWYLLQIDGQWLRFEVKENYFYVIINNKMKRIRFLYGKKYLEFDQNWMEFKIINERYWILIERKWISFQILNENEFLEIGGKVFGIKFLNSKKLINMGDNWLEMKIENERFYVSFDNFWIEFTIKDGQDYFI------YRKTEIPVRIVGKEHYLKIDNHWRKFQIVNEKIQIKLNENWTEYLIENKKNQITINDRSFEFSFNNEYTHIKIGGLWTRYKLVKTDLFISIEGIWLKLLIKNKKLFLIIKEEIFKYKVKNKIRYIKVGDRWLKLKIINNSIYVYLERKWIRFVYNSKRKSILQKYKFKTVEIR----LKQREKFLFYLN-KWYKLKILRNQFYIWFVDKWME------------------LEVENDKWYLRYNNQNYEFDVFNNKIHFRHKGKWKVVEQYNGQCVIRIEN 3046          

HSP 24 Score: 51.6026 bits (122), Expect = 3.613e-6
Identity = 65/287 (22.65%), Postives = 124/287 (43.21%), Query Frame = 3
Query:  612 RMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFT---RKHHYWKIGEKWLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRK-------WVRLQFSNRKVEYKCGKKWI---------EIKILQNYFYGKISG-KWYRVKFGNHF------NLIKIKGNYRKIKFIEGLNYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLFKL-----MSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLVKISLNS 1379
            ++ R K+Y KI   W    L++ N F  +G K + +KF    ++ ++  +G+KW +++    K Y  I+N           E+F  G         W+ + F NR++  K    WI         +IKI  +Y   KIS  K   VK  +H       N I++      I FI+   ++ +   +  F+I   ++ +K    WIE   ++  + + I   K  +   L       +Y  +    I V  +  ++++ ++ NW++    + + +   N+K  K+S+N 
Sbjct:  552 KLDRKKVYLKINNSWKLLALINGNKFVKLGNKYLRLKFDNSQKERYFLLLGQKWYRLSVTDHKYYLRIENQ------DRNIEFFPHGPPKLLWENVWLAVAFKNREIFIKYIGCWIKTYLKPEKFQIKIGDSYVDAKISSSKSLEVKISDHLYKLVGRNRIEVGEKNLNITFIDNNLHVLINDDYLPFKIMDERFMVKIVDSWIEGVINENGDTISITVDKEKLKITLENGILCELYEGLK---IPVTIRFGKLYYNLDNNWVNVFPKDGKRYILTNQKKTKLSVND 829          
The following BLAST results are available for this feature:
BLAST of SMED30010682 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010682 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000081460.10.000e+099.14SMESG000081460.1[more]
SMESG000081459.11.524e-3437.79SMESG000081459.1[more]
SMESG000081459.11.550e-3437.79SMESG000081459.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010682 ID=SMED30010682|Name=SMED30010682|organism=Schmidtea mediterranea sexual|type=transcript|length=2956bp
CTTGTACATGAATGACTGTCACAAAATTTATTTCTATAATCATTTTTTTA
GTAATAAGTAATTCATGTACAAGTGAAGAAGTCCAATGGAATGAAAAAGA
TAATAATTCTGATTATAACATTGAAAACTCTAATAGAATAACTGATTGGG
ACTGTTGGTACAAAGATTACTATCAAAAAGTTGATCGCTGCCATTCGAAA
ACTATAAGTTCAACAGAGCATATAAAATGCAAACAATATAGAGGTTGCAA
ACGTTATTGTACGTCCATTTATGGGTTGGAGCAATGTCGTGTACATTGTA
CGTTAAAGACTGAAAATTTAACAAAATATATCAAGGTTGTATATCGTATC
AGACAAAATGAAAATTGTAAAAATTCCGTGATATGTGTATACAAATCTGA
ATGCAACGGATTATGGCCAAAATATATCAATCAAGGGTGCTACTACACTC
AGGCTTTTAGTCAATGGTGGCTAGAGCATAGAAAGGAATACGCAAGGCCG
AGGATTTCTAAAAGATCAACTATTCCACCAACAAAAAATATATATAGCTG
CCTGAATAATATGGGGAGATATCCAAAAATAGATCCATCTTCAGAAATAG
TGATTCAATTTAGAATGAGTCGTGGTAAAATGTATTATAAAATTGGCCAA
GTATGGTTCGAAGCAAAGTTGGTTGATCGTAATTTGTTTTTTCTAATAGG
AGAAAAACAAGTTCCTGTCAAGTTTACCCGGAAACATCATTATTGGAAAA
TCGGGGAGAAATGGCTTAAAATAGCTGCATTGCGACAAAAGATTTACGGT
CACATTCAGAATGCTTGGATAGAACTGAAAATTTCTTCTGGGAAAGAATA
TTTTAGGTTAGGACGAAAATGGGTGCGTTTACAATTTTCCAATAGAAAGG
TAGAATATAAATGTGGGAAAAAATGGATTGAAATTAAAATCCTTCAAAAT
TATTTTTATGGAAAAATAAGTGGAAAATGGTACCGAGTAAAATTTGGAAA
TCATTTTAATCTAATAAAAATTAAAGGAAATTATAGAAAAATAAAATTTA
TTGAGGGATTAAATTACATTAAATTAGCAAAACGCTGGTTTGAGTTTGAA
ATAAAAAAAGGGAAATATTTTATTAAATTTGATCAGAAATGGATTGAGAT
TGAATTTGATAAATTACAGAATTTTGTTTTAATTAATGACATAAAATATC
CCGTTCTTTTTAAATTAATGTCGGTTTACGTCCAAATAAATAACCAGTGG
ATCCAAGTTGAATATAAAAACAATGAAATATTTTTTAAAGTTAATAAAAA
TTGGATGCACTTTTCTTTAATAGAAAACCGTTTATTTTTTCGAAAAAATA
AAAAATTGGTTAAGATTTCTCTAAATAGCAAACGAAATATTTTATATAGG
TCTTCATCTTCGGGGAAAATGAAACCCTTCAAAAATTCCGATTTAAAATT
AGGGAAATATTTTTCGAATAATCAATTTTCAAAAATTGAAAACTCTTTGA
AAATGAAACTTTTCAATGGTCATTGGTTACCGTTTAAAAAGGAGAATGGA
AGCTTTTTATTCCAGTTATCAGGACAGTGGTTGAAATTGAAAGAGGAAGA
CAATAAATTGTTTTATCAAACCAAAGAAAAGTGGATTGAATTTATTTTAA
TAGGTAAAACAGAATTTAATAGACTTCAAGGTCATTGGGTTAAAGTGAAA
CGAGAGAATGAAAAATTTTATTTTTTTGATTCGGATTCTTGGCATCAAAT
CAAACTAGTTGGCCAGCACTATGCTTTGAAGTTTAATGGAAGTTGGAAAT
CACTCGGGTTCGTTAATGGGAAAAAGTTTATTAGATTGGGAAATAGGTAT
TCTCAGCTGAAATTTAGCAAAAAAGGTCAAAATAAATTTTCTTTAAAAAT
GGGGGGTAAATTTTATAAATTGATGTCTAAAGAAAATTTATTTTACATTA
AATTAAATAACGATTGGAAGCAAGTGGAATTCTACCCTCATCGGTCAATT
AATATGCTCATTAACAATGCTTGGCTTCCAATGGCTTTTAAAGACAGAAA
ATTCTATATTAAAAATGGCAATTGTTGGCTGGAGACGATTTTCAAAGGAA
ACAAAATTTTCATTAGGATAGGAGACGCTTTTCTTGAAATTAAGATTTCT
TCAGATAAAGACATTTTAGTGAAAATAAATGGAAAATCTTTCAAATTGAT
TGAACGCAATGAAATCGAATTAAATAAGTTGATTTTGAAAGTGAATTTTA
TTAATGAAAAATTGCACATATTTTTCAATGGGAATTGGGTGCCGTTTAGA
TTCGAGGAAGAGAAGACTTTTATCAAAGTTATCGACTCTTGGATTGAAGC
GAAAATCGACGAAAAAAAACATATTACTGTCAAACTGAATGACGAGAAAA
TCCAGTTGACTTTTGACAATGGAATTCTGTGTGAAAATTATGACGACCTT
AAAGTTCCAATTAATATTCGATTTAAACAATTGTATTATAATTTGAATGA
AAAATGGATTAAAGTGTATCCGAGAGACAATTTGCGATTTATTAAATTGA
ATAAGAACTTGGTGAAATTGGACAAAGAATATTTGAGAGATAAAATTAGA
AAATACAAATTAAAACTGAAACTGAAGTGTGCAATATTGTCTAGAAATCA
ACGACATTGGACGAAACTAAAAGAGCGCTTGAATATCGAAAGTAGACGTT
CGGTTTTTCAAAGACTTATTGGTCGAAATAAGTTGAAAAATACGAAAATT
TACGAAACAATTGACATGAGACATAAACCAAAACCGGCTGATAAAAATGA
AGTCATTTAAATGATTTTATTGTGTTTTTCATGTTTAAATACTTGCAAAC
TTTTGTTTAGATTTGATGGTAAAGTTTTATTGTTTGTTGAAAAAAAAAAC
ATTTGAAAAATGTGATAATAAATAATTTTCATTGATAAAATATTAATTGA
ATAAAA
back to top

protein sequence of SMED30010682-orf-1

>SMED30010682-orf-1 ID=SMED30010682-orf-1|Name=SMED30010682-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=933bp
MTVTKFISIIIFLVISNSCTSEEVQWNEKDNNSDYNIENSNRITDWDCWY
KDYYQKVDRCHSKTISSTEHIKCKQYRGCKRYCTSIYGLEQCRVHCTLKT
ENLTKYIKVVYRIRQNENCKNSVICVYKSECNGLWPKYINQGCYYTQAFS
QWWLEHRKEYARPRISKRSTIPPTKNIYSCLNNMGRYPKIDPSSEIVIQF
RMSRGKMYYKIGQVWFEAKLVDRNLFFLIGEKQVPVKFTRKHHYWKIGEK
WLKIAALRQKIYGHIQNAWIELKISSGKEYFRLGRKWVRLQFSNRKVEYK
CGKKWIEIKILQNYFYGKISGKWYRVKFGNHFNLIKIKGNYRKIKFIEGL
NYIKLAKRWFEFEIKKGKYFIKFDQKWIEIEFDKLQNFVLINDIKYPVLF
KLMSVYVQINNQWIQVEYKNNEIFFKVNKNWMHFSLIENRLFFRKNKKLV
KISLNSKRNILYRSSSSGKMKPFKNSDLKLGKYFSNNQFSKIENSLKMKL
FNGHWLPFKKENGSFLFQLSGQWLKLKEEDNKLFYQTKEKWIEFILIGKT
EFNRLQGHWVKVKRENEKFYFFDSDSWHQIKLVGQHYALKFNGSWKSLGF
VNGKKFIRLGNRYSQLKFSKKGQNKFSLKMGGKFYKLMSKENLFYIKLNN
DWKQVEFYPHRSINMLINNAWLPMAFKDRKFYIKNGNCWLETIFKGNKIF
IRIGDAFLEIKISSDKDILVKINGKSFKLIERNEIELNKLILKVNFINEK
LHIFFNGNWVPFRFEEEKTFIKVIDSWIEAKIDEKKHITVKLNDEKIQLT
FDNGILCENYDDLKVPINIRFKQLYYNLNEKWIKVYPRDNLRFIKLNKNL
VKLDKEYLRDKIRKYKLKLKLKCAILSRNQRHWTKLKERLNIESRRSVFQ
RLIGRNKLKNTKIYETIDMRHKPKPADKNEVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 730..750
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.831