Serine/threonine-protein phosphatase 4 regulatory subunit 3

Overview
NameSerine/threonine-protein phosphatase 4 regulatory subunit 3
Smed IDSMED30010680
Length (bp)2915
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase 4 regulatory subunit 3 (SMED30010680) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 4 regulatory subunit 3 (SMED30010680) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase 4 regulatory subunit 3 (SMED30010680) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 4 regulatory subunit 3 (SMED30010680) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010680

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010680h1SMcG0004914 SmedASXL_014129SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010680h1SMcG0004914 SmedASXL_014129SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30010680h1SMcG0004914 dd_Smed_v4_4095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010680h1SMcG0004914 dd_Smed_v4_4095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010680h1SMcG0004914 dd_Smed_v4_4095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010680h1SMcG0004914 dd_Smed_v4_4095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010680h1SMcG0004914 dd_Smed_v4_4095_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010680h1SMcG0004914 Contig49037newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010680h1SMcG0004914 Contig49037uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Match: PPP4R3A (protein phosphatase 4 regulatory subunit 3A [Source:HGNC Symbol;Acc:HGNC:20219])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Match: PPP4R3A (protein phosphatase 4 regulatory subunit 3A [Source:HGNC Symbol;Acc:HGNC:20219])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Match: PPP4R3A (protein phosphatase 4 regulatory subunit 3A [Source:HGNC Symbol;Acc:HGNC:20219])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 313/653 (47.93%), Postives = 442/653 (67.69%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPN-------------DSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +             D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 650          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Match: PPP4R3B (protein phosphatase 4 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:29267])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 308/654 (47.09%), Postives = 443/654 (67.74%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD--------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+T+VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSV++TQDLID++++    EM  +S       + PTC+LN L EI+++ T V++ PI+RE+LA ALE   Y+K+L+ LF   E+LE+ + LHHLYEI+R I+  N+  L+E++FSDE +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T  + R++L+   KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +++++ +D L IN++I+ MI D D EL     +  +L+ LIDPENM+ +  K EK EFLNFFY   +  LT PL+  T++              N +  D+Y TA ++  I+ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ I  K+EF  RYI K N+   V+  LL+   +YN+LNSA++ELFEFIR E+I  L  +++EN +++L+  +YV TF+ LK +Y+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETS----HLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNIVGSNKNNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDR 653          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Match: PPP4R3B (protein phosphatase 4 regulatory subunit 3B [Source:HGNC Symbol;Acc:HGNC:29267])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 309/686 (45.04%), Postives = 446/686 (65.01%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQ------LKY----------------------------------------DDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+T+VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSV++TQDLID++++    EM  +S       + PTC+LN L EI+++ T V++ PI+RE+LA ALE   Y+K+L+ LF   E+LE+ + LHHLYEI+R I+  N+  L+E++FSDE +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T  + R++L+   KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +++++ +D L IN++I+ MI D D EL     +  +L+ LIDPENM+ +  K EK EFLNFFY   +  LT PL+  T++++      LK+                                        D+Y TA ++  I+ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ I  K+EF  RYI K N+   V+  LL+   +YN+LNSA++ELFEFIR E+I  L  +++EN +++L+  +YV TF+ LK +Y+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETS----HLIDLPTCELNKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDILLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDFFLKHYRYSWSFICTPSHSHSHSTPSSSISQDNIVGSNKNNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDR 685          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Celegans
Match: smk-1 (SMEK (Dictyostelium Suppressor of MEK null) homolog [Source:UniProtKB/TrEMBL;Acc:H2KYN7])

HSP 1 Score: 438.728 bits (1127), Expect = 5.386e-137
Identity = 242/656 (36.89%), Postives = 387/656 (58.99%), Query Frame = 2
Query:   56 RVKLYMLNEERQWDDKGTGHV---------SATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP---HKRVKHREFLTKKANFKEVFPMN-NALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQ-----KESFFNFLCLN----RALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSR-ENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNEN-RQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            RVKLY+L ++R W+D+GTGHV          A     N+M LV + E    ++LES+IQ DT YQKQQETLIVWSE D MDLALSFQEK+GC+++W+KIC VQG+DP          D  D  +M    S        + P  ++  L E+  +    +     RE++  A+E    + +L ++F   ED+E  + L   Y I++ +   NR  + E++  D  + D +G+ E++P   H R KHR+F+ KKA F+EV  ++ + L++KI + YR QYIQD+C+P   LF++N  S+L+S V+  ++DI+T LQ D +    LF  L++ ET    R+DL   LKE   +  S+ PS      KE+FF     N      L ++   FK  D   + V +D+++  ++  A ++RDF +  S+ ++ N+ + +N++I H++ D+D  L++G  I  ++K L+DPENM  +  K+E+ +FL  FY      L KP+++  +   +K DDY  A   + I+ LL FCVE HS++M+     N+++ +V+ L KS+H F+V  AL+++++ ++ K++   RYI+K  +L  V+    +N  +YN++NS++L LFEF+R+E++  LI  V+ENH E +    YV TF+ +K RYDQ  +R
Sbjct:  175 RVKLYVLCDQRIWEDRGTGHVVTHQLSAEDGAPSNAGNTMVLVRL-EGQNKNMLESRIQMDTVYQKQQETLIVWSETDVMDLALSFQEKSGCEELWQKICEVQGRDPGDPDATFDDGDDSDVGEMPSSASR------LQLPPIEIGRLGELDALLHMHLTTNSAREKMTLAIENDNVVTKLCEVFRMCEDIEHTEGLRTFYSIVKNLFMLNRNTVIEMLLDDNNIKDVIGMFEFDPAYKHPR-KHRDFVYKKAKFREVLNISCDELRDKIHRLYRAQYIQDACLPSLGLFEENLLSTLSSHVFFCRVDIVTLLQKDKKAMSELFGQLISEETDVIRRRDLALFLKEMISLSTSI-PSNGPAATKETFFKLQLQNMFNSEILDSLEPCFKSPDHETRAVMVDVLRTMVDANAQMIRDFLLKQSKTKDKNEDVLLNMMIRHLLTDIDVHLTSGSEIVLIMKTLLDPENM--TTVKSERSDFLQLFYNRCYESLLKPILENVSGGNIKKDDYMIANRQSVILRLLTFCVEHHSFSMRQRCVSNDLMNKVLVLLKSKHSFLVLSALKLLQRVVTVKDDKYIRYIVKEKVLDPVMECFRKNGNRYNIINSSVLHLFEFVRSEDVRPLIKYVVENHMEVVDSVNYVKTFKEIKIRYDQHRDR 819          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Celegans
Match: smk-1 (SMEK (Dictyostelium Suppressor of MEK null) homolog [Source:UniProtKB/TrEMBL;Acc:H2KYN7])

HSP 1 Score: 384.415 bits (986), Expect = 5.400e-119
Identity = 208/587 (35.43%), Postives = 344/587 (58.60%), Query Frame = 2
Query:  233 ETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP---HKRVKHREFLTKKANFKEVFPMN-NALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQ----PSQKESFFNFLCLN----RALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSR-ENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNEN-RQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            ETLIVWSE D MDLALSFQEK+GC+++W+KIC VQG+DP          D  D  +M    S        + P  ++  L E+  +    +     RE++  A+E    + +L ++F   ED+E  + L   Y I++ +   NR  + E++  D  + D +G+ E++P   H R KHR+F+ KKA F+EV  ++ + L++KI + YR QYIQD+C+P   LF++N  S+L+S V+  ++DI+T LQ D +    LF  L++ ET    R+DL   LKE   +  S+      + KE+FF     N      L ++   FK  D   + V +D+++  ++  A ++RDF +  S+ ++ N+ + +N++I H++ D+D  L++G  I  ++K L+DPENM  +  K+E+ +FL  FY      L KP+++  +   +K DDY  A   + I+ LL FCVE HS++M+     N+++ +V+ L KS+H F+V  AL+++++ ++ K++   RYI+K  +L  V+    +N  +YN++NS++L LFEF+R+E++  LI  V+ENH E +    YV TF+ +K RYDQ  +R
Sbjct:    6 ETLIVWSETDVMDLALSFQEKSGCEELWQKICEVQGRDPGDPDATFDDGDDSDVGEMPSSASR------LQLPPIEIGRLGELDALLHMHLTTNSAREKMTLAIENDNVVTKLCEVFRMCEDIEHTEGLRTFYSIVKNLFMLNRNTVIEMLLDDNNIKDVIGMFEFDPAYKHPR-KHRDFVYKKAKFREVLNISCDELRDKIHRLYRAQYIQDACLPSLGLFEENLLSTLSSHVFFCRVDIVTLLQKDKKAMSELFGQLISEETDVIRRRDLALFLKEMISLSTSIPSNGPAATKETFFKLQLQNMFNSEILDSLEPCFKSPDHETRAVMVDVLRTMVDANAQMIRDFLLKQSKTKDKNEDVLLNMMIRHLLTDIDVHLTSGSEIVLIMKTLLDPENM--TTVKSERSDFLQLFYNRCYESLLKPILENVSGGNIKKDDYMIANRQSVILRLLTFCVEHHSFSMRQRCVSNDLMNKVLVLLKSKHSFLVLSALKLLQRVVTVKDDKYIRYIVKEKVLDPVMECFRKNGNRYNIINSSVLHLFEFVRSEDVRPLIKYVVENHMEVVDSVNYVKTFKEIKIRYDQHRDR 583          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Fly
Match: flfl (gene:FBgn0024555 transcript:FBtr0344783)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 291/641 (45.40%), Postives = 431/641 (67.24%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLF-DDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVKLY LN ERQWDD+GTGHVS+T+VE    ++L+V +E+DGS LLESKIQ DTAYQKQQ+TLIVWSEGDN DLALSFQEK GCD+IWEKIC VQGKDPSV+ITQD++++++D    +M  ++       E P C+L+ L +ISE     ++ P+++E+L+ ALE   Y+K+L++LFH  EDL++ + LHHL+EI + I   N+  L+E++F+D+ + D VG LEY+P   +  KHR++L + A F+E  P+ N  L  KI QT+RVQYIQD  +P PS+F +DN  ++L+SF++ NK++I+T +QDD ++   +F  L +  T    R+D +  LKEFC    +LQP  K+SF+  L     L+A+  +  + D+  K   IDI+   +E    VVR++ +N +     + + +NI I+ M+ND + EL     +  ++K+L++PENM+      EK +FLNFFYK S+  L  P++  T  ++ + +DY TA ++  ++++L+FCVE HSY++KN+    ++L R++ L KS H F+V GALR++RK I+ K+EF  R+I+K N+ + VV   +  N +YN+L SAILELFEFI+ E+I  L    +EN  +     +YV TF+ LK RYDQ  +R
Sbjct:    5 TRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDIVEESEDERFEDMSDTAP----PIELPPCELSRLEDISETIQSCLSTPLRKEKLSMALESESYIKKLLNLFHVCEDLDNTEGLHHLFEIFKNIFLLNKNALFEIMFADDTIFDVVGCLEYDPSVSQPKKHRQYLKQLAKFREAVPIKNLDLLAKIHQTFRVQYIQDIILPTPSVFVEDNMLNTLSSFIFFNKVEIVTMIQDDERYLLDVFAVLTDPTTGDAKRRDTVLFLKEFCNYAQNLQPQGKDSFYKTLTCLGILQALELTLVMNDKKTKSASIDILTAIVEFSPLVVRNYTLNQANRPEVERMLLNIAIEQMLNDSEPELGIAVQLMGIVKILLEPENML-----TEKGDFLNFFYKYSVQTLVAPVILNTIGDRPQNEDYQTAQLLGIVLDILSFCVEHHSYHIKNFLLQKDLLKRILVLMKSTHTFLVLGALRLLRKIIALKDEFYNRHIVKCNLFAPVVDAFIRNNGRYNLLESAILELFEFIKLEDIRTLCVYFVENFSKIFDEIEYVQTFKYLKNRYDQYQDR 636          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Fly
Match: flfl (gene:FBgn0024555 transcript:FBtr0082817)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 291/641 (45.40%), Postives = 431/641 (67.24%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLF-DDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVKLY LN ERQWDD+GTGHVS+T+VE    ++L+V +E+DGS LLESKIQ DTAYQKQQ+TLIVWSEGDN DLALSFQEK GCD+IWEKIC VQGKDPSV+ITQD++++++D    +M  ++       E P C+L+ L +ISE     ++ P+++E+L+ ALE   Y+K+L++LFH  EDL++ + LHHL+EI + I   N+  L+E++F+D+ + D VG LEY+P   +  KHR++L + A F+E  P+ N  L  KI QT+RVQYIQD  +P PS+F +DN  ++L+SF++ NK++I+T +QDD ++   +F  L +  T    R+D +  LKEFC    +LQP  K+SF+  L     L+A+  +  + D+  K   IDI+   +E    VVR++ +N +     + + +NI I+ M+ND + EL     +  ++K+L++PENM+      EK +FLNFFYK S+  L  P++  T  ++ + +DY TA ++  ++++L+FCVE HSY++KN+    ++L R++ L KS H F+V GALR++RK I+ K+EF  R+I+K N+ + VV   +  N +YN+L SAILELFEFI+ E+I  L    +EN  +     +YV TF+ LK RYDQ  +R
Sbjct:    5 TRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDIVEESEDERFEDMSDTAP----PIELPPCELSRLEDISETIQSCLSTPLRKEKLSMALESESYIKKLLNLFHVCEDLDNTEGLHHLFEIFKNIFLLNKNALFEIMFADDTIFDVVGCLEYDPSVSQPKKHRQYLKQLAKFREAVPIKNLDLLAKIHQTFRVQYIQDIILPTPSVFVEDNMLNTLSSFIFFNKVEIVTMIQDDERYLLDVFAVLTDPTTGDAKRRDTVLFLKEFCNYAQNLQPQGKDSFYKTLTCLGILQALELTLVMNDKKTKSASIDILTAIVEFSPLVVRNYTLNQANRPEVERMLLNIAIEQMLNDSEPELGIAVQLMGIVKILLEPENML-----TEKGDFLNFFYKYSVQTLVAPVILNTIGDRPQNEDYQTAQLLGIVLDILSFCVEHHSYHIKNFLLQKDLLKRILVLMKSTHTFLVLGALRLLRKIIALKDEFYNRHIVKCNLFAPVVDAFIRNNGRYNLLESAILELFEFIKLEDIRTLCVYFVENFSKIFDEIEYVQTFKYLKNRYDQYQDR 636          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Fly
Match: flfl (gene:FBgn0024555 transcript:FBtr0114604)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 291/641 (45.40%), Postives = 431/641 (67.24%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLF-DDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVKLY LN ERQWDD+GTGHVS+T+VE    ++L+V +E+DGS LLESKIQ DTAYQKQQ+TLIVWSEGDN DLALSFQEK GCD+IWEKIC VQGKDPSV+ITQD++++++D    +M  ++       E P C+L+ L +ISE     ++ P+++E+L+ ALE   Y+K+L++LFH  EDL++ + LHHL+EI + I   N+  L+E++F+D+ + D VG LEY+P   +  KHR++L + A F+E  P+ N  L  KI QT+RVQYIQD  +P PS+F +DN  ++L+SF++ NK++I+T +QDD ++   +F  L +  T    R+D +  LKEFC    +LQP  K+SF+  L     L+A+  +  + D+  K   IDI+   +E    VVR++ +N +     + + +NI I+ M+ND + EL     +  ++K+L++PENM+      EK +FLNFFYK S+  L  P++  T  ++ + +DY TA ++  ++++L+FCVE HSY++KN+    ++L R++ L KS H F+V GALR++RK I+ K+EF  R+I+K N+ + VV   +  N +YN+L SAILELFEFI+ E+I  L    +EN  +     +YV TF+ LK RYDQ  +R
Sbjct:    5 TRRRVKLYALNAERQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKIQPDTAYQKQQDTLIVWSEGDNFDLALSFQEKAGCDEIWEKICQVQGKDPSVEITQDIVEESEDERFEDMSDTAP----PIELPPCELSRLEDISETIQSCLSTPLRKEKLSMALESESYIKKLLNLFHVCEDLDNTEGLHHLFEIFKNIFLLNKNALFEIMFADDTIFDVVGCLEYDPSVSQPKKHRQYLKQLAKFREAVPIKNLDLLAKIHQTFRVQYIQDIILPTPSVFVEDNMLNTLSSFIFFNKVEIVTMIQDDERYLLDVFAVLTDPTTGDAKRRDTVLFLKEFCNYAQNLQPQGKDSFYKTLTCLGILQALELTLVMNDKKTKSASIDILTAIVEFSPLVVRNYTLNQANRPEVERMLLNIAIEQMLNDSEPELGIAVQLMGIVKILLEPENML-----TEKGDFLNFFYKYSVQTLVAPVILNTIGDRPQNEDYQTAQLLGIVLDILSFCVEHHSYHIKNFLLQKDLLKRILVLMKSTHTFLVLGALRLLRKIIALKDEFYNRHIVKCNLFAPVVDAFIRNNGRYNLLESAILELFEFIKLEDIRTLCVYFVENFSKIFDEIEYVQTFKYLKNRYDQYQDR 636          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Zebrafish
Match: smek1 (SMEK homolog 1, suppressor of mek1 (Dictyostelium) [Source:NCBI gene;Acc:558578])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 304/640 (47.50%), Postives = 437/640 (68.28%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQ+LID++++    +M      ++ G E P C+L+ L E++E+    +  P++RE+LA ALE   Y+++L++LF   EDLE+ + LHHLY+I++ I   NR  L+E++FS+E +MD +G LE++P   +  +HREFLT  A FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L+A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T + +   DD+ T  ++  IVELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   ALR +RK I  K+EF  RYI++N +   VV   LN   +YN++NSAI+E+FE++R E++  L  ++IEN+W+ L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSAYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQELIDESEEERFDDM------SSPGLELPPCELSRLEEVAELVASSLPSPLRREKLALALENEGYIRKLLELFRVCEDLENREGLHHLYDIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPSLPQPRRHREFLTTTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTELFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILQALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEEKPSKDDFQTCQLLALIVELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCALRFMRKIIGLKDEFYNRYIMRNFLFEPVVKAFLNNGSRYNLINSAIIEMFEYVRVEDVKSLTAHIIENYWKGLEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Zebrafish
Match: ppp4r3b (protein phosphatase 4, regulatory subunit 3B [Source:ZFIN;Acc:ZDB-GENE-030131-8142])

HSP 1 Score: 295.819 bits (756), Expect = 1.177e-88
Identity = 156/317 (49.21%), Postives = 218/317 (68.77%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDD-NQFTQHL 985
            TRRRVK+Y LNEERQW+D+GTGHV  +       AL V +E+DGS LLESKI+  TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSV    ++  +  D  + E    S       + P C    L E++E+ + V+  P++RE+LA AL    YL+QL+ LF + E+ E+   L  L++I+R ++  N+  L+E++FSD+ +MD VG LEY+P   +  +HR+FLTK A F+EV P+ ++ L+ KI QTYRVQYIQD  +P PS+F+++  S+L+SF++ NK++I+  LQ+D    T H+
Sbjct:    4 TRRRVKVYTLNEERQWEDRGTGHVCCS---AEDTALSVTAESDGSLLLESKIKPSTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSV----EITQEPVDESEEERCEDSGAECDALDLPECVPERLQELAELVSSVLPSPVRREKLALALVSGGYLRQLLLLFRRCEEQENRPRLQQLFQILRGLLFLNKAALFEVLFSDDCIMDVVGCLEYDPALLQPKRHRDFLTKTARFREVIPIQDSELRQKIHQTYRVQYIQDIILPTPSVFEESFLSTLSSFIFFNKVEIVAMLQEDIRSLTAHI 313          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Match: rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:Xenbase;Acc:XB-GENE-6257583])

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 315/640 (49.22%), Postives = 443/640 (69.22%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS++ +MD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T + +   DD+ TA ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +VIEN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEDCIMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPDLKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKPSKDDFQTAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSVHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVIENYWKALEDVEYVQTFKGLKLRYDQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Match: rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:Xenbase;Acc:XB-GENE-6257583])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 315/640 (49.22%), Postives = 443/640 (69.22%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS++ +MD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T + +   DD+ TA ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +VIEN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEDCIMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPDLKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKPSKDDFQTAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSVHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVIENYWKALEDVEYVQTFKGLKLRYDQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Match: rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:Xenbase;Acc:XB-GENE-6257583])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 315/640 (49.22%), Postives = 443/640 (69.22%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS++ +MD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T + +L   D+ TA ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +VIEN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEDCIMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPDLKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKLNKYDFQTAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSVHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVIENYWKALEDVEYVQTFKGLKLRYDQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Match: rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:Xenbase;Acc:XB-GENE-6257583])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 315/640 (49.22%), Postives = 443/640 (69.22%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS++ +MD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T + +   DD+ TA ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +VIEN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEDCIMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPDLKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKPSKDDFQTAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSVHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVIENYWKALEDVEYVQTFKGLKLRYDQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Match: rprd2 (regulation of nuclear pre-mRNA domain containing 2 [Source:Xenbase;Acc:XB-GENE-6257583])

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 317/648 (48.92%), Postives = 443/648 (68.36%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLV--------DLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS++ +MD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+        D    N L Y D+ TA ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +VIEN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEDCIMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPDLKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKTDFRISNLLNY-DFQTAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSVHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVIENYWKALEDVEYVQTFKGLKLRYDQQRER 644          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Match: Ppp4r3a (protein phosphatase 4 regulatory subunit 3A [Source:MGI Symbol;Acc:MGI:1915984])

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPTLSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Match: Ppp4r3a (protein phosphatase 4 regulatory subunit 3A [Source:MGI Symbol;Acc:MGI:1915984])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 313/653 (47.93%), Postives = 442/653 (67.69%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPN-------------DSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +             D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPTLSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 650          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Match: Ppp4r3b (protein phosphatase 4 regulatory subunit 3B [Source:MGI Symbol;Acc:MGI:2144474])

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 306/654 (46.79%), Postives = 442/654 (67.58%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD--------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+T+VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSV++TQDLID++++    EM  +S       + P C+L+ L EI+++ T V++ PI+RE+LA ALE   Y+K+L+ LF   E+LE+ + LHHLYEI+R I+  N+  L+E++FSDE +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T  + R++L+   KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +++++ +D L IN++I+ MI D D EL     +  +L+ LIDPENM+ +  K EK EFLNFFY   +  LT PL+  T++              N +  D+Y TA ++  I+ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ I  K+EF  RYI K N+   V+  LL+   +YN+LNSA++ELFEFIR E+I  L  +++EN +++L+  +YV TF+ LK +Y+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETS----HLIDLPACELSKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDVLLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNMLGSNTTNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIRVEDIKSLTAHIVENFYKALESIEYVQTFKGLKTKYEQEKDR 653          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Match: Ppp4r3b (protein phosphatase 4 regulatory subunit 3B [Source:MGI Symbol;Acc:MGI:2144474])

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 291/613 (47.47%), Postives = 414/613 (67.54%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD--------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIR 1828
            TRRRVK+Y LNE+RQWDD+GTGHVS+T+VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSV++TQDLID++++    EM  +S       + P C+L+ L EI+++ T V++ PI+RE+LA ALE   Y+K+L+ LF   E+LE+ + LHHLYEI+R I+  N+  L+E++FSDE +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T  + R++L+   KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +++++ +D L IN++I+ MI D D EL     +  +L+ LIDPENM+ +  K EK EFLNFFY   +  LT PL+  T++              N +  D+Y TA ++  I+ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ I  K+EF  RYI K N+   V+  LL+   +YN+LNSA++ELFEFIR
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTYVEELKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVEVTQDLIDESEEERFEEMPETS----HLIDLPACELSKLEEIADLVTSVLSSPIRREKLALALENEGYIKKLLQLFQACENLENTEGLHHLYEIIRGILFLNKATLFEVMFSDECIMDVVGCLEYDPALAQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLSEVFAQLTDEATDDDKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLAKLGILPALEIVMGMDDLQVRSAATDIFSYLVEFSPSMVREFVMQEAQQSDDDVLLINVVIEQMICDTDPELGGAVQLMGLLRTLIDPENMLATTNKTEKSEFLNFFYNHCMHVLTAPLLTNTSEDKCEKDNMLGSNTTNTICPDNYQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEFYNRYITKGNLFEPVINALLDNGTRYNLLNSAVIELFEFIR 612          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Match: 4930415L06Rik (RIKEN cDNA 4930415L06 gene [Source:MGI Symbol;Acc:MGI:3588286])

HSP 1 Score: 447.973 bits (1151), Expect = 3.164e-143
Identity = 249/644 (38.66%), Postives = 391/644 (60.71%), Query Frame = 2
Query:   59 VKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPM-NNALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENP-NDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTA-----DNQLKY--DDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            VK+Y++ E++QW + GTG +S+ + E    + L+V S +DGS ++E KI  +  YQKQQ  +I+WSE  N  +A+ FQE   C +IWE IC +QGKDP V+ITQ+L DD +  + M +  +        E   C+++ L  I+E+F  V   P Q+ERLA  LE   Y+K+L+ LFH  E L++++ L++L+ I++ I+  N   L+ ++FSDE  MD VG LEY+P   +  ++REFLT+ + FKEV P+ ++ L+ KIQQTYR+QY+ D  +P PS+F  N  S + + ++ NKI+IIT +Q+D  F   +F+ L +     E R +LL  LKEFC    +LQ  +K      L     +  +     + D  ++   +DI    +E    +VR + + +++++  ND L INI+I  MI D D E S G I+T +L  L++PENM  + +  E++ FLNFFYK  +  L  P++ +       DN++    D+Y  A ++  ++E+L FCV++HS  +K+Y F NN+L  ++ L  S+H F++  A+R +RK I  K++    YIIK N+   VV   ++   +YNMLNSAI+ELFEFIR ENI  LI N++EN + + +  +YV TF+ LK +Y++  +R
Sbjct:   20 VKVYVMMEDKQWKNVGTGQISSKYSEQLQGVCLLVHSLSDGSPIMECKIHPNVPYQKQQGKIIIWSEAKNHGMAIHFQEPNDCQEIWEDICQIQGKDPHVEITQELTDDLETFEHMPLIWNWV------EMSNCEIHTLKNIAELFPFVFEMPSQKERLALFLENEGYIKKLLQLFHTCEKLKNMEGLYYLHNIIKGILFLNNTRLFNIMFSDEFFMDIVGCLEYDPALDQPKQYREFLTQNSKFKEVIPIIHSQLRQKIQQTYRMQYVHDIMLPTPSIFQTNLLSDITTMIFFNKINIITMIQEDENFLLEVFSQLKDNSIGDERRIELLLFLKEFCEFAKTLQSQKKNELLKTLIKLGIMSVLKVVVHMNDYQIQVGALDIFAYLVEYSPCLVRAYAMEEAQDSEDNDDLLINIMIKQMICDFDPEFSQGIIMTAVLHELLNPENMRTTAKGCERKVFLNFFYKRYMRKLIAPILSIRVKYDSNDNRVYICPDNYQNAQLLGAVLEILTFCVQYHSMYIKHYIFSNNLLRSILVLMSSKHTFLILCAVRFMRKIIGLKDKMYNHYIIKKNLFEPVVNAFMHNGHRYNMLNSAIIELFEFIRKENITSLIVNIVENFFRAFKSIEYVQTFKGLKTKYEEEKKR 657          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q6INN7|PP4R3_XENLA (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Xenopus laevis OX=8355 GN=smek1 PE=2 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 314/640 (49.06%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   YLK+L++LFH  EDLE+++ LHHLYE+++ I   NR  L+E++FS++ MMD +G LEY+P    + KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +T +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T + +   DD+  A ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S H F+   ALR +RK +  K+EF  RYI+K+ +   VV   LN   +YN++NSAILE+FE+IR E+I  L  +V+EN+W++L+  +YV TF+ LK RYDQ  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINTNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAEVVASSLPSPLRREKLAVALENEGYLKKLLELFHVCEDLENIEGLHHLYEVIKGIFLLNRTALFEVMFSEDCMMDIIGCLEYDPSLPTQRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDVVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTELFAHLTDEATDDEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDPQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLTGLLRTLVDPENMLATTNKTEKTEFLGFFYKHCMHVLTAPLLANTTEEKPSKDDFQAAQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLMSSMHSFLGLCALRFMRKIVGLKDEFYNRYIVKSFLFEPVVKAFLNNGSRYNLMNSAILEIFEYIRVEDIKSLTAHVVENYWKALEDVEYVQTFKGLKLRYDQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q6P2K6|P4R3A_MOUSE (Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp4r3a PE=1 SV=1)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 313/640 (48.91%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPTLSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q5SP90|PP4R3_DANRE (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Danio rerio OX=7955 GN=smek1 PE=1 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 304/640 (47.50%), Postives = 437/640 (68.28%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQ+LID++++    +M      ++ G E P C+L+ L E++E+    +  P++RE+LA ALE   Y+++L++LF   EDLE+ + LHHLY+I++ I   NR  L+E++FS+E +MD +G LE++P   +  +HREFLT  A FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L+A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T + +   DD+ T  ++  IVELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   ALR +RK I  K+EF  RYI++N +   VV   LN   +YN++NSAI+E+FE++R E++  L  ++IEN+W+ L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSAYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQELIDESEEERFDDM------SSPGLELPPCELSRLEEVAELVASSLPSPLRREKLALALENEGYIRKLLELFRVCEDLENREGLHHLYDIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPSLPQPRRHREFLTTTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTELFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILQALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEEKPSKDDFQTCQLLALIVELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCALRFMRKIIGLKDEFYNRYIMRNFLFEPVVKAFLNNGSRYNLINSAIIEMFEYVRVEDVKSLTAHIIENYWKGLEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q6IN85|P4R3A_HUMAN (Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens OX=9606 GN=PPP4R3A PE=1 SV=1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 313/653 (47.93%), Postives = 442/653 (67.69%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP--HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPN-------------DSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M      ++ G E P+C+L+ L EI+E+    +  P++RE+LA ALE   Y+K+L++LFH  EDLE+++ LHHLYEI++ I   NR  L+E++FS+E +MD +G LEY+P   +  KHREFLTK A FKEV P+++  LK KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++++N +             D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL FFYK  +  LT PL+  T +++   DD+ TA ++  ++ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR  RK I  K+EF  RYI+K+ +   VV   LN   +YN++NSAI+E+FEFIR E+I  L  +VIEN+W++L+   YV TF+ LK R++Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDM------SSPGLELPSCELSRLEEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEVMFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDVSKKLTEQKITSKDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDFQTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRYIMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLRFEQQRER 650          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Match: sp|Q4S6U8|PP4R3_TETNG (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Tetraodon nigroviridis OX=99883 GN=smek1 PE=3 SV=1)

HSP 1 Score: 586.26 bits (1510), Expect = 0.000e+0
Identity = 301/640 (47.03%), Postives = 442/640 (69.06%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE     +L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQD++D+++D    +M      ++ G E P C+LN L +++E+    +  P++RE+LA A+E   Y+++L+DLFH  EDLE+ + LHH+YEI++ I   NR  L+E++FSDE +MD +G LE++P   +  +HREFLTK A+FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     + ++L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T +++   DD+ T+ ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  S+H F+   ALR +R+ I  K+EF  RYI++N +   V+   LN   +YN++NSAI+E+FE++R E++  L  +++EN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERFKGTSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDVVDESEDERFDDM------SSPGLELPPCELNRLEDLAELVASSLPSPLRREKLALAVENEGYIRKLLDLFHVCEDLENREGLHHIYEIIKGIFLLNRTALFEVMFSDECIMDVIGCLEFDPALPQPRRHREFLTKTAHFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTDLFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDVQVRAAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDTDPELGGAVQLISLLRTLVDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEDKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLTASKHAFLALCALRFMRRIIGLKDEFYNRYIMRNFLFEPVIKAFLNNGSRYNLMNSAIIEMFEYVRVEDVKSLTAHIVENYWKALEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Match: A0A0X3NQB8 (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Schistocephalus solidus OX=70667 GN=PP4R3 PE=4 SV=1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 363/640 (56.72%), Postives = 477/640 (74.53%), Query Frame = 2
Query:   29 SNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNN-QGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDS-LYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGL-LNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYD 1936
            S S+ +TRRRVKLYMLNEERQWDDKGTGHVSA + E N++ALVVISETDGS LLESKIQ DTAYQKQQETLIVWSEGDNMDLALSFQEK GCDDIWEKIC VQGKDPSV+ITQD++D++DDADD+E  T +T  + Q FE P C+L+ L EI+E+  Q      +RER+   LER+ YL+QLVDLFHKAEDLED++SLHHLYEI R ++ FN++NLYE++FSDE++M+ +GILEY+P  R +HREFL  +A FKEV P++N  L NKI QTYRVQYIQD C+PPP LFDD     L SF+ LNKI+II+ LQDD +F   LFN L +  T+   R++L   +KEFC +  S+Q  QK++F N L  + AL  +       D  +K   ++I+  F+ENQ SVVR++   D+   P+D+ + IN++I  ++ND D ELS+ F++  ML++LIDP+NM N+  ++EK EFL+FFYK  I  L KPL D T   +  +DDYHTA+V++N++ELL FC+E H+Y+MKNY  H +++ RV+TL  S HKF+V GALR++R+ ++ KEEF  RY++KNN+   VV L ++   +YNM++SAI+ELF++IR ENIN LI +V+E HW+SL+   YV TF  LK  YD
Sbjct:    2 STSEANTRRRVKLYMLNEERQWDDKGTGHVSALYTEQNNIALVVISETDGSCLLESKIQSDTAYQKQQETLIVWSEGDNMDLALSFQEKAGCDDIWEKICRVQGKDPSVEITQDVVDESDDADDVESYTPNTSQSLQTFELPPCELSRLEEIAELVGQPQGILQKRERIVAILERTNYLRQLVDLFHKAEDLEDIESLHHLYEIFRQLILFNKQNLYEILFSDELIMEVIGILEYSPSGRTRHREFLKNQAKFKEVLPLHNPELVNKIHQTYRVQYIQDCCLPPPCLFDDQTMHVLKSFITLNKIEIISALQDDEEFMLQLFNRLKSPSTSEAYRRELALFVKEFCNL--SVQTDQKDNFLNCLFSHGALSTVEVLLMFDDRDVKAAALEILHAFVENQPSVVREYVYKDNHHLPDDNRILINLMITQLLNDSDPELSDAFLLGYMLRMLIDPDNMNNTGGRSEKTEFLSFFYKRCIGTLAKPLFDNTVHEKPLHDDYHTALVLSNVLELLTFCIENHAYHMKNYCLHRDVVKRVLTLLSSHHKFLVLGALRLLRRVVNLKEEFYNRYLVKNNLFKPVVELFISNGHRYNMIDSAIIELFDYIRAENINLLITHVVEKHWDSLKGVTYVQTFTGLKELYD 639          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Match: A0A0X3PVD7 (Serine/threonine-protein phosphatase 4 regulatory subunit 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=PP4R3 PE=4 SV=1)

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 363/640 (56.72%), Postives = 477/640 (74.53%), Query Frame = 2
Query:   29 SNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNN-QGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDS-LYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGL-LNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYD 1936
            S S+ +TRRRVKLYMLNEERQWDDKGTGHVSA + E N++ALVVISETDGS LLESKIQ DTAYQKQQETLIVWSEGDNMDLALSFQEK GCDDIWEKIC VQGKDPSV+ITQD++D++DDADD+E  T +T  + Q FE P C+L+ L EI+E+  Q      +RER+   LER+ YL+QLVDLFHKAEDLED++SLHHLYEI R ++ FN++NLYE++FSDE++M+ +GILEY+P  R +HREFL  +A FKEV P++N  L NKI QTYRVQYIQD C+PPP LFDD     L SF+ LNKI+II+ LQDD +F   LFN L +  T+   R++L   +KEFC +  S+Q  QK++F N L  + AL  +       D  +K   ++I+  F+ENQ SVVR++   D+   P+D+ + IN++I  ++ND D ELS+ F++  ML++LIDP+NM N+  ++EK EFL+FFYK  I  L KPL D T   +  +DDYHTA+V++N++ELL FC+E H+Y+MKNY  H +++ RV+TL  S HKF+V GALR++R+ ++ KEEF  RY++KNN+   VV L ++   +YNM++SAI+ELF++IR ENIN LI +V+E HW+SL+   YV TF  LK  YD
Sbjct:   45 STSEANTRRRVKLYMLNEERQWDDKGTGHVSALYTEQNNIALVVISETDGSCLLESKIQSDTAYQKQQETLIVWSEGDNMDLALSFQEKAGCDDIWEKICRVQGKDPSVEITQDVVDESDDADDVESYTPNTSQSLQTFELPPCELSRLEEIAELVGQPQGILQKRERIVAILERTNYLRQLVDLFHKAEDLEDIESLHHLYEIFRQLILFNKQNLYEILFSDELIMEVIGILEYSPSGRTRHREFLKNQAKFKEVLPLHNPELVNKIHQTYRVQYIQDCCLPPPCLFDDQTMHVLKSFITLNKIEIISALQDDEEFMLQLFNRLKSPSTSEAYRRELALFVKEFCNL--SVQTDQKDNFLNCLFSHGALSTVEVLLMFDDRDVKAAALEILHAFVENQPSVVREYVYKDNHHLPDDNRILINLMITQLLNDSDPELSDAFLLGYMLRMLIDPDNMNNTGGRSEKTEFLSFFYKRCIGTLAKPLFDNTVHEKPLHDDYHTALVLSNVLELLTFCIENHAYHMKNYCLHRDVVKRVLTLLSSHHKFLVLGALRLLRRVVNLKEEFYNRYLVKNNLFKPVVELFISNGHRYNMIDSAIIELFDYIRAENINLLITHVVEKHWDSLKGVTYVQTFTGLKELYD 682          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Match: A0A504YS50 (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Fasciola gigantica OX=46835 GN=FGIG_06258 PE=4 SV=1)

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 368/703 (52.35%), Postives = 489/703 (69.56%), Query Frame = 2
Query:   29 SNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNN-QGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRE-NPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLL--NENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQS--VERSLKNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMSLMTTNATRLRKDPRSL 2116
            ++S+ STRRRVKLYMLN+ERQWDDKGTGHVSA + E ++MALVVISETDGS+LLESKIQ DTAYQKQQETLIVWSEG+NMDLALSFQEK GCDD+WEKIC VQGKDPSV+ITQ+++D++DD DD +  T S   + Q    P C+L+HL E + M +Q V  P +R+RL   LE + YL QL+DLFHKAEDLED++SLHHLYEIMR ++  N+ +LYE +F+D+M+M+ +GILEYNP  R KHREFL  K  FKEV P+ NA LK+KI QTYRVQYIQD C+PPP LFD+   S L +FV LNK++II  LQDD +F + LF  L +++T    R++L   +KEFC I  S+Q  QKESF N L  + ALK         D  +K   ++I+Q F+E+Q SVVR++   ++     +D L IN++I  +++D D ELS+ F++  ML++LIDP+NM N   + EK EFLNFFY+  I  L +PL D T  + L+ DDYHTA+V+N+I+ELL FC+E H+Y+MKNY  H ++L RV+ L +S HKF+V  ALR++R+ I  KEEF  RY+IKNN+   V+ L   NE+R YN+++SAI+ELF+ IRTE I  LI +V+EN W+ L+   YV TF   K  YD +    R +  T                       V    S++++SL+   ++R ++DPRSL
Sbjct:    2 TSSEASTRRRVKLYMLNDERQWDDKGTGHVSAIYTEQDNMALVVISETDGSYLLESKIQPDTAYQKQQETLIVWSEGENMDLALSFQEKVGCDDVWEKICAVQGKDPSVEITQEVVDESDDVDDADGYTPSLIQSIQPLALPPCELSHLEETAFMISQAVASPQKRDRLVVLLESTNYLNQLMDLFHKAEDLEDMESLHHLYEIMRQVILINKHSLYETLFADDMLMEVIGILEYNPSGRTKHREFLRSKVTFKEVLPLYNADLKSKIHQTYRVQYIQDCCLPPPCLFDEQTLSQLKNFVSLNKMEIIRALQDDEEFMRRLFARLKSVDTDVAHRRELSLFIKEFCNI--SMQTDQKESFLNCLFQHGALKTAEVLLATDDRDMKSAALEILQAFVEHQPSVVREYVYKETAPFRKDDELLINLMIIQLLSDSDPELSDAFLLGYMLRILIDPDNMNNPGARGEKSEFLNFFYRRCINTLVRPLFDNTVKDILEKDDYHTALVLNHILELLTFCIETHTYHMKNYCLHRDLLKRVLVLLQSSHKFLVLTALRLLRRVIHMKEEFYNRYLIKNNLFRPVLKLFVANEHR-YNLVDSAIIELFDHIRTEEITSLITHVVENFWDILKTVTYVPTFIDFKRTYDHTHRPSRPMVGT-----------------------VGQPGSMDVLSLVNVASSRFQRDPRSL 678          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Match: A0A2H1C0X5 (Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Fasciola hepatica OX=6192 GN=D915_007901 PE=4 SV=1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 368/703 (52.35%), Postives = 489/703 (69.56%), Query Frame = 2
Query:   29 SNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNN-QGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRE-NPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLL--NENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQS--VERSLKNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMSLMTTNATRLRKDPRSL 2116
            ++S+ STRRRVKLYMLN+ERQWDDKGTGHVSA + E ++MALVVISETDGS+LLESKIQ DTAYQKQQETLIVWSEG+NMDLALSFQEK GCDD+WEKIC VQGKDPSV+ITQ+++D++DD DD +  T S   + Q    P C+L+HL E + M +Q V  P +R+RL   LE + YL QL+DLFHKAEDLED++SLHHLYEIMR ++  N+ +LYE +F+D+M+M+ +GILEYNP  R KHREFL  K  FKEV P+ NA LK+KI QTYRVQYIQD C+PPP LFD+   S L +FV LNK++II  LQDD +F + LF  L +++T    R++L   +KEFC I  S+Q  QKESF N L  + ALK         D  +K   ++I+Q F+E+Q SVVR++   ++     +D L IN++I  +++D D ELS+ F++  ML++LIDP+NM N   + EK EFLNFFY+  I  L +PL D T  + L+ DDYHTA+V+N+I+ELL FC+E H+Y+MKNY  H ++L RV+ L +S HKF+V  ALR++R+ I  KEEF  RY+IKNN+   V+ L   NE+R YN+++SAI+ELF+ IRTE I  LI +V+EN W+ L+   YV TF   K  YD +    R +  T                       V    S++++SL+   ++R ++DPRSL
Sbjct:    2 TSSEASTRRRVKLYMLNDERQWDDKGTGHVSAIYTEQDNMALVVISETDGSYLLESKIQPDTAYQKQQETLIVWSEGENMDLALSFQEKVGCDDVWEKICAVQGKDPSVEITQEVVDESDDVDDADGYTPSLIQSIQPLALPPCELSHLEETAFMISQAVASPQKRDRLVVLLESTNYLNQLMDLFHKAEDLEDMESLHHLYEIMRQVILINKHSLYETLFADDMLMEVIGILEYNPSGRTKHREFLRSKVTFKEVLPLYNADLKSKIHQTYRVQYIQDCCLPPPCLFDEQTLSQLKNFVSLNKMEIIRALQDDEEFMRRLFARLKSVDTDVAHRRELSLFIKEFCNI--SMQTDQKESFLNCLFQHGALKTAEVLLATDDRDMKSAALEILQAFVEHQPSVVREYVYKETAPFRKDDELLINLMIIQLLSDSDPELSDAFLLGYMLRILIDPDNMNNPGARGEKSEFLNFFYRRCINTLVRPLFDNTVKDILEKDDYHTALVLNHILELLTFCIETHTYHMKNYCLHRDLLKRVLVLLQSSHKFLVLTALRLLRRVIHMKEEFYNRYLIKNNLFRPVLKLFVANEHR-YNLVDSAIIELFDHIRTEEITSLITHVVENFWDILKTVTYVPTFIDFKRTYDHTHRPSRPMVGT-----------------------VGQPGSMDVLSLVNVASSRFQRDPRSL 678          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Match: A0A0R3UJZ0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7862 PE=4 SV=1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 345/642 (53.74%), Postives = 473/642 (73.68%), Query Frame = 2
Query:   29 SNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXX-XXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFI-NDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNEN-RQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQS 1942
            + S+ STRRRVKLYMLN+ERQWDDKGTGHVSA + E N++ALVVISE DGS LLESKIQ +TAYQKQQETLIVWSEG+NMDLALSFQEK GCDDIWEKICNVQGKDPSV+ITQD++D++DD DD+E    +S+ + Q FE P C+L  L EI+E+ +   N   +RERL TA ER+ Y++QL+DLFHKAEDLED+ SLHHLYEI R ++ FN++ LYE +FSD+++MD +GILEY+P  R +HR+FL  +ANFKEV P++N+ L NKI QTYRVQYIQD C+PPP LFDD+  S+L SF+ LNK++II+ LQ+D++    LF  L + ET+   R++L   +KEFC +  S+Q  QKE+F N L  + AL  +       D  +K   ++++Q F+ENQ SV+R+    N ++ + ++++ IN++I  ++ D D EL + + ++ ML+ LIDP+NM N+  ++EK EFL+FFYK  I  LTKPL + T       D+YH A+V++N++ELL FC+E H+Y+MKNY  H +++ RV+ L +S HKF+V  ALR++RK +  KEEF  RY+IKNN+   V+ L   N  +YNM++SAI+ELFE++  E+I  LIN+V++ +W+ L    YVNTF+ LK R+D S
Sbjct:    8 TTSEASTRRRVKLYMLNDERQWDDKGTGHVSALYTEQNTIALVVISENDGSCLLESKIQPETAYQKQQETLIVWSEGENMDLALSFQEKAGCDDIWEKICNVQGKDPSVEITQDVVDESDDTDDVEAYTITSSQSLQAFELPPCELARLEEIAELTSAHPNPLQKRERLVTAFERNNYIRQLIDLFHKAEDLEDMTSLHHLYEIFRQLILFNKQILYETLFSDDVIMDVIGILEYSPAGRTRHRDFLRNQANFKEVLPLHNSELVNKIHQTYRVQYIQDCCLPPPGLFDDHTMSALKSFISLNKMEIISALQEDDECMLRLFTCLKSPETSDSHRRELALFVKEFCSL--SVQTDQKENFLNTLSAHGALSTVETLLTCNDHDVKSAALEVLQAFVENQPSVIREHVCKNSAKMSRDENILINLMITQLLEDPDPELGDAYQLSYMLRFLIDPDNMNNTAGRSEKTEFLSFFYKRCIGTLTKPLFENTIHEVPLNDNYHCALVLSNVLELLIFCIESHTYHMKNYCLHRDLVKRVLVLLRSTHKFLVLSALRLLRKVVQMKEEFYNRYLIKNNLFKPVIDLFAANGHRYNMIDSAIIELFEYLHMEDITSLINHVVKEYWDVLCDITYVNTFKKLKERFDAS 647          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Cavefish
Match: smek1 (protein phosphatase 4 regulatory subunit 3A [Source:NCBI gene;Acc:103035667])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 303/640 (47.34%), Postives = 434/640 (67.81%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQ+LID++++    +M      ++ G E P C+L+ L E++E+    +  P +RE+LA ALE   Y+++L++LF   EDLE+ + LHHLY+I++ I   NR  L+E++FS+E +MD +G LE++P   +  +HREFLT  A FKEV P+ +  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK     L+ PL+  T + +   DD+ T  ++  IVELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   +LR +RK I  K+EF  RYI++N +   VV   LN   +YN++NSAI+E+FE++R E++  L  ++IEN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQELIDESEEERFEDM------SSPGLELPPCELSRLEEVAELVASSLPSPQRREKLALALENEGYIRKLLELFRVCEDLENREGLHHLYDIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPALPQPRRHREFLTTTARFKEVIPITDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTELFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLSFFYKHCTHVLSAPLLANTTEEKPSKDDFQTCQLLALIVELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCSLRFMRKIIGLKDEFYNRYIMRNFLFEPVVKAFLNNGSRYNLINSAIIEMFEYVRVEDVKSLTAHIIENYWKALEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Cavefish
Match: PPP4R3C (protein phosphatase 4 regulatory subunit 3C [Source:HGNC Symbol;Acc:HGNC:33146])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 302/653 (46.25%), Postives = 437/653 (66.92%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRE-NPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+T+VE    ++L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPS++ITQD ID++++    EM  +S       E P C+L  L EI+++ T V++ PI+RE+LA AL    Y+K+L+ LF   ED ++ + LHHLYEI+R ++  N+  L+E++FSD+ +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T    R++L+   KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + + ++ + +D L IN++I  MI D D EL     +  +L+ LIDPENM+    K EK EFL+FFYK  +  LT PL+  TA+            N +  D++ TA ++  I+ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ I  K+E+  RYIIK N+   V+  LL+   +YN+LNSAI+ELFEFI+ E+I  LI ++++N +++L+  +YV TF+ LK RY+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTYVERLKGISLLVRAESDGSLLLESKISPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSLEITQDPIDESEEERFEEMPETS----HLVELPACELARLEEIADLVTSVLSSPIRREKLALALMSEGYIKKLLQLFRTCEDQDNREGLHHLYEIVRGVLFLNKATLFEVMFSDDCIMDVVGCLEYDPALVQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLTEVFAQLTDEATEDGKRRELVNFFKEFCAFSQTLQPQNRDAFFKTLANLGILPALEIIMGMDDLQVRAAATDIFSYLVEFSPSMVREFVMQEPQQADDDDVLLINLVIKQMICDSDPELGGAVQLMGLLRTLIDPENMLAPTNKTEKTEFLSFFYKYCMHVLTAPLLANTAEERKDLPEETTKVNPVCPDNFQTAQLLALILELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEYYNRYIIKGNLFEPVINALLDNGTRYNLLNSAIIELFEFIKVEDIKSLIAHIVDNFYKALESIEYVQTFKGLKGRYEQEKDR 652          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Cavefish
Match: smek1 (protein phosphatase 4 regulatory subunit 3A [Source:NCBI gene;Acc:103035667])

HSP 1 Score: 513.842 bits (1322), Expect = 5.356e-169
Identity = 277/640 (43.28%), Postives = 405/640 (63.28%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE    M+L+V +E+DGS LLESKI  +TAYQKQQ                                 VQGKDPSVDITQ+LID++++    +M      ++ G E P C+L+ L E++E+    +  P +RE+LA ALE   Y+++L++LF   EDLE+ + LHHLY+I++ I   NR  L+E++FS+E +MD +G LE++P   +  +HREFLT  A FKEV P+ +  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK     L+ PL+  T + +   DD+ T  ++  IVELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   +LR +RK I  K+EF  RYI++N +   VV   LN   +YN++NSAI+E+FE++R E++  L  ++IEN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQ---------------------------------VQGKDPSVDITQELIDESEEERFEDM------SSPGLELPPCELSRLEEVAELVASSLPSPQRREKLALALENEGYIRKLLELFRVCEDLENREGLHHLYDIIKGIFLLNRTALFEVMFSEECIMDVIGCLEFDPALPQPRRHREFLTTTARFKEVIPITDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTELFAQLTDEATDDDKRHELVNFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLSFFYKHCTHVLSAPLLANTTEEKPSKDDFQTCQLLALIVELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCSLRFMRKIIGLKDEFYNRYIMRNFLFEPVVKAFLNNGSRYNLINSAIIEMFEYVRVEDVKSLTAHIIENYWKALEDVDYVQTFKGLKLRYEQQRER 604          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Sea Lamprey
Match: ppp4r3b (protein phosphatase 4, regulatory subunit 3B [Source:ZFIN;Acc:ZDB-GENE-030131-8142])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 308/643 (47.90%), Postives = 439/643 (68.27%), Query Frame = 2
Query:   41 VSTRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNP---HKRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNEN-RQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            + TRRRVKLY LNE+RQWDD+GTGHVS+++VE    M+L+V +E+DGS LLESKIQ DTAYQKQQ+TLIVWSE DN+DLALSFQEK GCD+IWEKIC VQGKDPSVDITQD+ ++  + + +E        +   + P C+L  L E++ + T ++  PI+RERLATA+E+  Y+K+L++LF   EDLE+ + LHHL+EI+R +   N+  L+E++FSD+ +MD VG LE++P   H R +HREFLTK A FKEV P+ +  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQ+D +F   LF  L + ET  + R++L+  LKEFC    +LQP  ++SFF  L     L A+       D  ++ V  DI    +E   S+VR+F + ++++N +D L IN+LI+ MI D D EL     +  +L+VL+DPENM+ +  K EK EFL+FFY+  +  L+ PL+  T +N L  DD+ TA ++  I+ELL FCVE H+Y++KNY    ++L +V+ L  S+H F+   ALR +R+ +  K+EF  RYI++ N+   V+ +   N  +YN+LNSAI+E+FEFIR ENI  L  +V+EN  ++L+   YV TF+ LK  Y+Q   R
Sbjct:    2 MDTRRRVKLYTLNEDRQWDDRGTGHVSSSYVERLKGMSLLVRAESDGSVLLESKIQQDTAYQKQQDTLIVWSEADNVDLALSFQEKAGCDEIWEKICEVQGKDPSVDITQDVGEEESEEERLEDVPEPAVTSACVDLPPCELGRLGELAALVTSILPSPIRRERLATAIEKQGYVKKLLELFSVCEDLENTEGLHHLHEIVRGLFLLNKTPLFEVMFSDDCIMDVVGCLEFDPSLSHPR-RHREFLTKIAKFKEVIPIRDPELRQKIHQTYRVQYIQDVVLPTPSIFEENMLSTLSSFIFFNKVEIVGMLQEDEKFLTELFAQLTDTETEDDKRRELVNFLKEFCAFSQTLQPQNRDSFFKTLANLGVLSALEVILGSEDPDVRNVATDIFSYIVEYSPSMVREFVMQEAQQNDDDILLINLLIEQMICDSDPELGGAVQLMGLLRVLVDPENMMATANKTEKTEFLSFFYRRCMHILSAPLLANTTENSLCKDDFQTAQLLALILELLTFCVEHHTYHIKNYILTKDLLRKVLVLTTSRHAFLTLSALRFMRRIVGMKDEFYNRYILRGNLFEPVIKVFMSNGPRYNLLNSAIIEIFEFIRVENIKSLTVHVVENFCKALEDVDYVQTFRALKLCYEQERGR 643          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Sea Lamprey
Match: smek1 (SMEK homolog 1, suppressor of mek1 (Dictyostelium) [Source:NCBI gene;Acc:558578])

HSP 1 Score: 516.538 bits (1329), Expect = 1.515e-172
Identity = 282/647 (43.59%), Postives = 403/647 (62.29%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQ------------------------------------------------LKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIR 1828
            TRRRVKLY LNE+RQWDD+GTGHVS+++VE    M+L+V +E+DGS LLESKI+ +TAYQKQQ+TLIVWSE +N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQDL+D++++    +M  ++       E P C+L  L++I+E+ +  +  P++RE+L   LE   Y+K+L++LFH  EDLE+   LHHL++I + I   N   ++E++ SD  +MD VG LEY+P   +  +HR+FL   A FKEV P+ +  LK KI QTYR QYIQD  +P PSLF++N  S L+S+++ NK+DI+  LQ+D ++   LF  L +  T  E R++L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + ++ +N +D L IN++I+ MI D D EL     +  +L+ LIDPENM+ +  K EK EFL+FFYK  +  LT PL+  TA+++                                                L  DD+ TA +++  +ELL FCVE H+Y++KNY  + ++L RV+ L  S+H F+   ALR +R+ +  K+E   RYIIK N+   VV   LN   +YN+LNSA++ELF+FIR
Sbjct:    4 TRRRVKLYALNEDRQWDDRGTGHVSSSYVEKLKGMSLLVRAESDGSVLLESKIKPNTAYQKQQDTLIVWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLLDESEEERYDDMPEAAPA----VELPPCELGRLVDIAELVSTSLAMPVRREKLMLVLETEGYIKKLLELFHMCEDLENTDGLHHLFQIFKGIFLLNSTAIFEVMLSDSCVMDVVGCLEYDPSLPEPKRHRDFLNTTARFKEVIPICDPELKQKIHQTYRAQYIQDVILPTPSLFEENLVSCLSSYIFFNKVDIVKLLQEDEKYLTELFAQLTDEATDDEKRRELVNFLKEFCAFSQTLQPQDRDNFFKALSCLGILPALEVVLGMDDAQVRNAATDIFSYIVEYSPSMVREFVVQEALQNDDDILLINLIIEQMICDTDPELGGAVQLVALLRTLIDPENMLATANKTEKTEFLSFFYKHCMHVLTAPLLANTAEDKPGKDFFYSSFPVESFFFKRLLNTSPQAYNVRMASVKWHRICCNVSEKFLPADDFQTAQLLSLTLELLTFCVEHHTYHIKNYIMNKDLLRRVLVLMNSRHSFLALCALRFMRRIVGMKDELYNRYIIKGNLFDPVVRAFLNNGSRYNLLNSAVIELFDFIR 646          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001734.1 (pep scaffold:Pmarinus_7.0:GL489500:2907:7048:-1 gene:ENSPMAG00000001566.1 transcript:ENSPMAT00000001734.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 1.637e-21
Identity = 45/96 (46.88%), Postives = 66/96 (68.75%), Query Frame = 2
Query: 1667 ALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            ALR +R+ +  K+E   RYIIK N+   VV   LN   +YN+LNSA++ELF+FIRTE++  LI +++EN ++  +   YVNTF+ LK RY+Q  +R
Sbjct:    1 ALRFMRRIVGMKDELYNRYIIKGNLFDPVVRAFLNNGSRYNLLNSAVIELFDFIRTEDMKPLIMHIVENFYKGFEDIDYVNTFKGLKMRYEQERDR 96          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Yeast
Match: PSY2 (Subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form the active complex, Psy4p may provide additional substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; Pph3p and Psy2p localize to foci on meiotic chromosomes; putative homolog of mammalian R3 [Source:SGD;Acc:S000005145])

HSP 1 Score: 135.961 bits (341), Expect = 4.051e-33
Identity = 122/432 (28.24%), Postives = 212/432 (49.07%), Query Frame = 2
Query:   53 RRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSH--LLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPS----VXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYN---PHKRVKHREFL-TKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQ--HLFNGLLNIETTSE------SRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKV-ADESLKPVCIDIIQIFIENQASVV-----RDFFINDSRENPND 1273
            +RVK+Y+L E  +W D GTG      V+    A +V+S+ D     LL+SK++ +  YQ+Q+ETLIVW +    D+ALSF+E  GCD + E I +VQ    S    V +           D +    +   N+Q     T     LLE  ++  +  ++   +      + +S Y+  L+  FHKAE+ +  K L  L  I++ ++ +N+R++ E +  D+ +M  VGILEY+   P  +  HR++L +K  NFKEV P+ N  LK  +++ +R+Q+++D  +      DD+  + ++  V   +  II  LQ      +   L++     E++SE       RKD + LL++   +  +L    +  F+  L      K + Y+F +  D +++ +  D I   IE+   ++      D F    +  P+D
Sbjct:   29 KRVKVYIL-ENNEWKDTGTGFCIGE-VDEGKFAYLVVSDEDSPTETLLKSKLEGNIEYQRQEETLIVWKDLGGKDIALSFEESMGCDTLCEFIVHVQRNIESNISLVTVKSSDNGLGSVHDIITGPVTLPSNDQQQNSQT-----LLEALKILNENTSFDFLKNETIEFILQSNYIDTLISHFHKAEEEKIPKDLFLLSNIIKTLILYNKRDILESMVEDDRIMGIVGILEYDTEYPTSKANHRKYLGSKGPNFKEVIPLENEDLKIIMKKCFRLQFLKDVVL--VRFLDDHNFNLISEIVMDLETCIIDFLQVGTFLDRLIELYDTKTLPESSSEKEKFVQKRKDGIRLLQQCVQMSINLDAVDRSKFYKTLVRKGLFKVLDYAFHMETDSNVRILATDTIITIIEHDILLIHNVQNEDSFKRQHKSAPDD 451          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Nematostella
Match: EDO36775 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHQ4])

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 296/640 (46.25%), Postives = 429/640 (67.03%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNEN-RQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+++VE    M+++V SE DGS LLESKIQ  TAYQKQQETLIVWSEG+N DLALSFQEK GCD+IWEK+C VQG+DPS  ITQ+++DD +  D  E    ++G     E P C+L+ L EISE F   V  P  RE++A A+E+  Y+K+L+DLFH  EDLE++  LHHLY+I +++   N+ +L E++ +D+M+ D +G LE +P+  +  +HR FL + A+F EV P+ NA L  KI QT+RVQYI D  +PPP++F++N  +SL+S+++ NKI+I+T LQ+D++F + LF  L + ET+ E R  L+  LKE     + LQ   K+ FF  +  +  L A+       ++S+K   +++I   ++    +VRDF + D +    D + +N LID+MI+D DS   + + + +++K L+DPENM     K EK EFL+FFYK S+  LT PL   TAD   K DDY T++ + +I+ELL FC+E H+Y++KNY  + ++L R +   +S+HKF+V  ALR  RK +  K+EF  RYIIK  ++  ++    EN  +YN+LNSAI+ELFEFIR E+I  L ++V E + +  +   YV+TF+ L  RY+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSSYVERLQGMSIMVRSEEDGSILLESKIQSHTAYQKQQETLIVWSEGENCDLALSFQEKAGCDEIWEKVCQVQGRDPSCTITQEILDDDESEDRFEEVLDTSG---PIELPPCELSKLEEISE-FLSGVPPPAIREKIALAIEQDNYIKKLLDLFHMCEDLENIDGLHHLYDIFKSLFFMNKPSLLEIMLADDMLFDVIGCLENDPNHPEPRRHRRFLRETAHFTEVLPITNAELVAKIHQTFRVQYIYDVILPPPTVFEENMLASLHSYIFFNKIEIVTHLQEDDKFLRDLFMELNDDETSEERRMKLVAFLKELVHFASQLQVHHKDEFFKTVSFHGLLPALEMLLAYDNKSIKQAAVEMISQLVDISPYLVRDFIMKDGKTQ-EDEMLVNQLIDYMISDGDS--GDAYQLASLIKSLLDPENMALGPNKMEKSEFLSFFYKHSMHVLTAPLFAATADKVYK-DDYVTSVTLGHIIELLTFCIEHHTYHIKNYVINRDLLRRALATMRSKHKFLVLNALRFCRKIVGLKDEFYNRYIIKGKLVEPIITAFKENGNRYNLLNSAIVELFEFIRVEDIKSLSSHVCEEYRQFFKDVDYVSTFKGLVLRYEQEKDR 635          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Match: smek1 (protein phosphatase 4 regulatory subunit 3A [Source:NCBI gene;Acc:101174718])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 300/640 (46.88%), Postives = 438/640 (68.44%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE     +L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSEG+N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQD++D++++    +M      ++ G E P C+LN L +++E+    +  P++RE+LA A+E   Y+++L++LF   EDL++ + LHHLYEI++ I   NR  L+E++FSDE +MD +G LE++P   +  +HREFLTK A FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T + +   DD+ T+ ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   ALR +R+ I  K+EF  RYI++N +   VV   L    +YN++NSAI+E+FE++R E++  L  +++EN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSAYVERLKGTSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEGENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDVVDESEEERFDDM------SSPGLELPPCELNRLEDLAELVASSLPSPLRREKLALAVENEGYIRKLLELFRICEDLDNREGLHHLYEIIKGIFLLNRTALFEVMFSDECIMDVIGCLEFDPSLLQPRRHREFLTKTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTDLFAQLTDESTDDDKRHELVSFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDSDPELGGAVQLMGLLRTLLDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEEKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCALRFMRRIIGLKDEFYNRYIMRNFLFEPVVKAFLKNGSRYNLMNSAIIEMFEYVRVEDVKSLTAHIVENYWKALEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Match: smek1 (protein phosphatase 4 regulatory subunit 3A [Source:NCBI gene;Acc:101174718])

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 300/640 (46.88%), Postives = 438/640 (68.44%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE     +L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSEG+N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQD++D++++    +M      ++ G E P C+LN L +++E+    +  P++RE+LA A+E   Y+++L++LF   EDL++ + LHHLYEI++ I   NR  L+E++FSDE +MD +G LE++P   +  +HREFLTK A FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L+  LKEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T + +   DD+ T+ ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   ALR +R+ I  K+EF  RYI++N +   VV   L    +YN++NSAI+E+FE++R E++  L  +++EN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSAYVERLKGTSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEGENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDVVDESEEERFDDM------SSPGLELPPCELNRLEDLAELVASSLPSPLRREKLALAVENEGYIRKLLELFRICEDLDNREGLHHLYEIIKGIFLLNRTALFEVMFSDECIMDVIGCLEFDPSLLQPRRHREFLTKTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTDLFAQLTDESTDDDKRHELVSFLKEFCAFSQTLQPQNRDAFFKTLSNMGILPALEVILGMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDSDPELGGAVQLMGLLRTLLDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEEKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCALRFMRRIIGLKDEFYNRYIMRNFLFEPVVKAFLKNGSRYNLMNSAIIEMFEYVRVEDVKSLTAHIVENYWKALEDVDYVQTFKGLKLRYEQQRER 637          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Match: PPP4R3C (protein phosphatase 4 regulatory subunit 3B [Source:NCBI gene;Acc:101159769])

HSP 1 Score: 567.385 bits (1461), Expect = 0.000e+0
Identity = 302/654 (46.18%), Postives = 437/654 (66.82%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD--------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+TFVE    ++L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE DN DLALSFQEK GCD+IWE+IC VQGKDP++DITQD ID++++    E+  +S       E P C+L  L EI+++ T V++ PI+RE+LA AL    Y+K+L+ LF   EDL++ + LHHLYE++R ++  N+  L+E++FSD+ +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T    R++L+  +KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + + ++  +D L IN++I  MI D D EL     +  +L+ LIDPENM+ S  K EK EFL+FFYK  +  LT PL+  TA               N +  D++ TA ++  I+ELL FCVE H+Y++K Y  + ++L RV+ L  S+H F+   ALR +R+ I  K+E+  RYIIK N+   V+  LL+   +YN+LNSAI+ELFEFI+ E+I  LI ++++N +++L+  +YV TF+ LK RY+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTFVERLRGISLLVRAESDGSLLLESKISPNTAYQKQQDTLIVWSEADNYDLALSFQEKAGCDEIWERICQVQGKDPALDITQDPIDESEEDHFEEIPETS----HLVELPPCELGRLEEIADLVTSVLSSPIRREKLALALMSEGYIKKLLGLFRVCEDLDNREGLHHLYEVVRGVLFLNKAALFEVMFSDDCIMDVVGCLEYDPALVQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLTEVFAQLTDEATDDSKRRELVNFVKEFCAFSQTLQPQNRDAFFKTLANLGILPALEIVMGMNDLQVRAAATDIFSYLVEFSPSMVREFVMQEPQQTDDDVLLINVVIKQMICDSDPELGGAVQLMGLLRTLIDPENMLASTNKTEKTEFLSFFYKYCMHVLTAPLLANTAHDKTTKDQQDGSTKINPVCPDNFQTAQLLALILELLTFCVEHHTYHIKTYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEYYNRYIIKGNLFEPVINALLDNGTRYNLLNSAIIELFEFIKVEDIKSLIAHIVDNFYKALEPIEYVQTFKGLKGRYEQEKDR 653          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Match: PPP4R3C (protein phosphatase 4 regulatory subunit 3B [Source:NCBI gene;Acc:101159769])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 302/654 (46.18%), Postives = 437/654 (66.82%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTAD--------------NQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+TFVE    ++L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSE DN DLALSFQEK GCD+IWE+IC VQGKDP++DITQD ID++++    E+  +S       E P C+L  L EI+++ T V++ PI+RE+LA AL    Y+K+L+ LF   EDL++ + LHHLYE++R ++  N+  L+E++FSD+ +MD VG LEY+P   +  +HREFLTK A FKEV P+ ++ L+ KI QTYRVQYIQD  +P PS+F++N  S+L SF++ NK++I++ LQ+D +F   +F  L +  T    R++L+  +KEFC    +LQP  +++FF  L     L A+     + D  ++    DI    +E   S+VR+F + + ++  +D L IN++I  MI D D EL     +  +L+ LIDPENM+ S  K EK EFL+FFYK  +  LT PL+  TA               N +  D++ TA ++  I+ELL FCVE H+Y++K Y  + ++L RV+ L  S+H F+   ALR +R+ I  K+E+  RYIIK N+   V+  LL+   +YN+LNSAI+ELFEFI+ E+I  LI ++++N +++L+  +YV TF+ LK RY+Q  +R
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSTFVERLRGISLLVRAESDGSLLLESKISPNTAYQKQQDTLIVWSEADNYDLALSFQEKAGCDEIWERICQVQGKDPALDITQDPIDESEEDHFEEIPETS----HLVELPPCELGRLEEIADLVTSVLSSPIRREKLALALMSEGYIKKLLGLFRVCEDLDNREGLHHLYEVVRGVLFLNKAALFEVMFSDDCIMDVVGCLEYDPALVQPKRHREFLTKTAKFKEVIPITDSELRQKIHQTYRVQYIQDIILPTPSVFEENFLSTLTSFIFFNKVEIVSMLQEDEKFLTEVFAQLTDEATDDSKRRELVNFVKEFCAFSQTLQPQNRDAFFKTLANLGILPALEIVMGMNDLQVRAAATDIFSYLVEFSPSMVREFVMQEPQQTDDDVLLINVVIKQMICDSDPELGGAVQLMGLLRTLIDPENMLASTNKTEKTEFLSFFYKYCMHVLTAPLLANTAHDKTTKDQQDGSTKINPVCPDNFQTAQLLALILELLTFCVEHHTYHIKTYIMNKDLLRRVLVLMNSKHTFLALCALRFMRRIIGLKDEYYNRYIIKGNLFEPVINALLDNGTRYNLLNSAIIELFEFIKVEDIKSLIAHIVDNFYKALEPIEYVQTFKGLKGRYEQEKDR 653          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Match: smek1 (protein phosphatase 4 regulatory subunit 3A [Source:NCBI gene;Acc:101174718])

HSP 1 Score: 543.117 bits (1398), Expect = 2.745e-180
Identity = 287/640 (44.84%), Postives = 419/640 (65.47%), Query Frame = 2
Query:   47 TRRRVKLYMLNEERQWDDKGTGHVSATFVEN-NSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPH--KRVKHREFLTKKANFKEVFPMNNA-LKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVV-GLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVER 1951
            TRRRVK+Y LNE+RQWDD+GTGHVS+ +VE     +L+V +E+DGS LLESKI  +TAYQKQQ+TLIVWSEG+N DLALSFQEK GCD+IWEKIC VQGKDPSVDITQD++D++++    +M      ++ G E P C+LN L +++E+    +  P++RE+LA A+E   Y+++L++LF   EDL++ + LHHLYEI++ I   NR  L+E++FSDE +MD +G LE++P   +  +HREFLTK A FKEV P+++  L+ KI QTYRVQYIQD  +P PS+F++N  S+L+SF++ NK++I+  LQDD +F   LF  L +  T  + R +L                                        + D  ++    DI    +E   S+VR+F + +S++N +D L IN++I+HMI D D EL     +  +L+ L+DPENM+ +  K EK EFL+FFYK  +  L+ PL+  T + +   DD+ T+ ++  I+ELL FCVE H+Y++KNY  + +IL RV+ L  SQH F+   ALR +R+ I  K+EF  RYI++N +   VV   L    +YN++NSAI+E+FE++R E++  L  +++EN+W++L+   YV TF+ LK RY+Q  ER
Sbjct:    4 TRRRVKVYTLNEDRQWDDRGTGHVSSAYVERLKGTSLLVRAESDGSLLLESKINPNTAYQKQQDTLIVWSEGENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDVVDESEEERFDDM------SSPGLELPPCELNRLEDLAELVASSLPSPLRREKLALAVENEGYIRKLLELFRICEDLDNREGLHHLYEIIKGIFLLNRTALFEVMFSDECIMDVIGCLEFDPSLLQPRRHREFLTKTARFKEVIPISDPELRQKIHQTYRVQYIQDMVLPTPSVFEENMLSTLHSFIFFNKVEIVGMLQDDEKFLTDLFAQLTDESTDDDKRHEL---------------------------------------GMDDVQVRGAATDIFSYLVEYNPSMVREFVMQESQQNDDDILLINLIIEHMICDSDPELGGAVQLMGLLRTLLDPENMLATANKTEKTEFLSFFYKHCMHVLSAPLLANTTEEKPSKDDFQTSQLLALILELLTFCVEHHTYHIKNYIINKDILRRVLVLTASQHAFLALCALRFMRRIIGLKDEFYNRYIMRNFLFEPVVKAFLKNGSRYNLMNSAIIEMFEYVRVEDVKSLTAHIVENYWKALEDVDYVQTFKGLKLRYEQQRER 598          
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Planmine SMEST
Match: SMESG000060526.1 (SMESG000060526.1)

HSP 1 Score: 1706.03 bits (4417), Expect = 0.000e+0
Identity = 924/930 (99.35%), Postives = 926/930 (99.57%), Query Frame = 2
Query:   23 MSSNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVXXXXXXXXXXXXXXXXXXXXSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVERSLKNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMSLMTTNATRLRKDPRSLXXXXXXXXXXXXXXXXXSINNYQNTAPAALSSPTPFIERYTARLATGGSVVTNANGITGSNSIAITSAKTATDSVPFKLGNRYGKEQHIPINIKXXXXXXXXXXXXXXXXXXIDTCQELNGSFDIDYNRLTNGEIDKVSSISSDEQHQKECLTTSATSIIISDKLIDSTAISSEVAQKANEQQPPCCMLTGLVDYSSDDEEENEITSNTDNNTSKEAAEWGSVSSPKRLKID 2812
            MSSNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVDITQDLIDDADDADDMEMDTSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLN+ETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVV GALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVERSLKNTAAVSAASAVSVVSSNNNNNAGNSVIASSSVNMMSLMTTNATRLRKDPRSLDEDEEQWYDQDDEDEDDSINNYQNTAPAALSSPTPFIERY+ARLAT GSVVTNANGITGSNSIAITSAKTATDSVPFKLGNRYGKEQHIPINIKSTSLTLGSVSSTSSGAGTIDTCQELNGSFDIDYNRLTNGEIDKVSSISSDEQHQ ECLTTSATSI ISDKLIDSTAISSEVAQKANEQQPPCCMLTGLVDYSSDDEEENEITSNTDNNTSKEAAEWGSVSSPKRLKID
Sbjct:    1 MSSNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISETDGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEKICNVQGKDPSVDITQDLIDDADDADDMEMDTSSTGNNQGFEFPTCDLNHLLEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLHHLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTKKANFKEVFPMNNALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFVYLNKIDIITKLQDDNQFTQHLFNGLLNLETTSESRKDLLFLLKEFCIIVNSLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQASVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLIDPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTAMVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVLGALRVIRKFISSKEEFNYRYIIKNNILSSVVGLLNENRQYNMLNSAILELFEFIRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVERSLKNTAAVSAASAVSVVSSNNNNNAGNSVIASSSVNMMSLMTTNATRLRKDPRSLDEDEEQWYDQDDEDEDDSINNYQNTAPAALSSPTPFIERYSARLATSGSVVTNANGITGSNSIAITSAKTATDSVPFKLGNRYGKEQHIPINIKSTSLTLGSVSSTSSGAGTIDTCQELNGSFDIDYNRLTNGEIDKVSSISSDEQHQNECLTTSATSITISDKLIDSTAISSEVAQKANEQQPPCCMLTGLVDYSSDDEEENEITSNTDNNTSKEAAEWGSVSSPKRLKID 930          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP4R3A0.000e+048.91protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
PPP4R3A0.000e+048.91protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
PPP4R3A0.000e+047.93protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
PPP4R3B0.000e+047.09protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
PPP4R3B0.000e+045.04protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smk-15.386e-13736.89SMEK (Dictyostelium Suppressor of MEK null) homolo... [more]
smk-15.400e-11935.43SMEK (Dictyostelium Suppressor of MEK null) homolo... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
flfl0.000e+045.40gene:FBgn0024555 transcript:FBtr0344783[more]
flfl0.000e+045.40gene:FBgn0024555 transcript:FBtr0082817[more]
flfl0.000e+045.40gene:FBgn0024555 transcript:FBtr0114604[more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smek10.000e+047.50SMEK homolog 1, suppressor of mek1 (Dictyostelium)... [more]
ppp4r3b1.177e-8849.21protein phosphatase 4, regulatory subunit 3B [Sour... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rprd20.000e+049.22regulation of nuclear pre-mRNA domain containing 2... [more]
rprd20.000e+049.22regulation of nuclear pre-mRNA domain containing 2... [more]
rprd20.000e+049.22regulation of nuclear pre-mRNA domain containing 2... [more]
rprd20.000e+049.22regulation of nuclear pre-mRNA domain containing 2... [more]
rprd20.000e+048.92regulation of nuclear pre-mRNA domain containing 2... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp4r3a0.000e+048.91protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
Ppp4r3a0.000e+047.93protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
Ppp4r3b0.000e+046.79protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
Ppp4r3b0.000e+047.47protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
4930415L06Rik3.164e-14338.66RIKEN cDNA 4930415L06 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6INN7|PP4R3_XENLA0.000e+049.06Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q6P2K6|P4R3A_MOUSE0.000e+048.91Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q5SP90|PP4R3_DANRE0.000e+047.50Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q6IN85|P4R3A_HUMAN0.000e+047.93Serine/threonine-protein phosphatase 4 regulatory ... [more]
sp|Q4S6U8|PP4R3_TETNG0.000e+047.03Serine/threonine-protein phosphatase 4 regulatory ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NQB80.000e+056.72Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A0X3PVD70.000e+056.72Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A504YS500.000e+052.35Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A2H1C0X50.000e+052.35Serine/threonine-protein phosphatase 4 regulatory ... [more]
A0A0R3UJZ00.000e+053.74Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smek10.000e+047.34protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
PPP4R3C0.000e+046.25protein phosphatase 4 regulatory subunit 3C [Sourc... [more]
smek15.356e-16943.28protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppp4r3b0.000e+047.90protein phosphatase 4, regulatory subunit 3B [Sour... [more]
smek11.515e-17243.59SMEK homolog 1, suppressor of mek1 (Dictyostelium)... [more]
ENSPMAT00000001734.11.637e-2146.88pep scaffold:Pmarinus_7.0:GL489500:2907:7048:-1 ge... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PSY24.051e-3328.24Subunit of protein phosphatase PP4 complex; Pph3p ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO367750.000e+046.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smek10.000e+046.88protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
smek10.000e+046.88protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
PPP4R3C0.000e+046.18protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
PPP4R3C0.000e+046.18protein phosphatase 4 regulatory subunit 3B [Sourc... [more]
smek12.745e-18044.84protein phosphatase 4 regulatory subunit 3A [Sourc... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 4 regulatory subunit 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000060526.10.000e+099.35SMESG000060526.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010680 ID=SMED30010680|Name=Serine/threonine-protein phosphatase 4 regulatory subunit 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2915bp
TCTATATAAATCTTATATGTAAATGTCTTCAAATTCGGATGTCAGTACAA
GAAGAAGAGTTAAATTATACATGCTAAATGAAGAAAGACAGTGGGACGAT
AAAGGCACTGGACATGTGTCAGCGACGTTTGTTGAAAACAACTCAATGGC
ATTGGTTGTTATTTCTGAAACTGATGGTTCACATTTATTAGAATCCAAAA
TACAACATGACACAGCGTATCAAAAACAACAAGAAACTCTTATAGTATGG
TCAGAAGGAGATAACATGGATCTTGCGTTGTCATTTCAAGAAAAAACTGG
TTGTGATGATATTTGGGAAAAAATTTGCAACGTCCAAGGAAAAGATCCTT
CTGTTGACATAACTCAAGATTTAATTGATGATGCTGACGATGCAGATGAT
ATGGAAATGGACACAAGTTCTACAGGTAACAATCAAGGATTTGAGTTCCC
AACCTGTGATTTAAACCATTTATTGGAAATCAGTGAAATGTTTACACAAG
TCGTTAATTATCCTATTCAAAGAGAACGATTAGCGACAGCTCTTGAAAGA
TCTCAGTATTTAAAACAATTAGTTGATTTATTTCACAAAGCCGAAGATCT
GGAAGACTTGAAATCTTTACATCATTTATATGAAATAATGCGTGCTATTG
TTCAGTTCAACCGTAGGAATTTGTACGAATTAATTTTCTCAGATGAAATG
ATGATGGACACAGTTGGTATACTTGAGTATAACCCACATAAACGAGTGAA
ACATAGAGAGTTTCTAACCAAAAAAGCCAATTTCAAAGAAGTATTTCCGA
TGAATAATGCATTAAAAAACAAAATCCAGCAGACATATCGAGTTCAGTAT
ATACAAGATTCTTGCATGCCACCACCGTCATTATTTGATGACAATGCCGC
ATCTTCATTAAATTCGTTTGTATACCTTAATAAAATAGATATTATTACAA
AATTACAAGATGATAATCAGTTTACTCAACATCTGTTTAATGGATTATTA
AACATTGAAACCACATCCGAAAGCAGGAAAGATCTTTTGTTCTTGCTGAA
AGAATTCTGTATAATTGTCAATTCATTACAGCCATCTCAGAAAGAATCGT
TTTTCAATTTTCTCTGCCTAAACCGAGCTCTCAAAGCAATATTTTACTCA
TTTAAAGTCGCAGATGAATCATTAAAACCAGTTTGTATAGATATTATTCA
GATTTTCATTGAAAATCAAGCAAGTGTCGTTCGAGACTTTTTTATTAATG
ACTCTCGGGAAAACCCGAACGATTCGCTTTACATCAACATTCTCATCGAC
CACATGATCAACGATCTCGATTCCGAACTCAGTAATGGATTTATAATCAC
CAACATGCTGAAAGTATTGATCGATCCTGAAAATATGATAAACTCGAATC
AGAAAAACGAAAAGCAGGAATTTCTGAATTTCTTCTACAAATGCAGCATT
GCACATTTGACAAAACCGCTTGTGGATTTAACTGCAGATAATCAATTGAA
ATATGATGATTACCACACAGCAATGGTGATGAATAATATTGTGGAGTTGC
TGGCATTCTGTGTTGAATTTCATTCATATAACATGAAGAATTATGCGTTT
CACAACAACATTTTGCTTCGTGTCGTCACGCTGTTCAAATCCCAGCATAA
GTTCGTTGTCTTTGGTGCATTGCGCGTCATTAGGAAATTCATCAGCTCCA
AAGAAGAATTCAATTATCGATATATAATCAAGAACAACATCCTTAGCAGT
GTTGTTGGCCTGCTCAATGAGAACCGTCAGTATAACATGCTCAACTCGGC
TATTTTGGAATTGTTCGAATTTATCCGCACGGAAAACATTAACTGTTTGA
TCAATAACGTGATCGAGAACCATTGGGAGAGTTTGCAGCTACACAAATAT
GTCAACACATTCCAGACTCTCAAGGCCCGATACGATCAGAGCGTTGAGAG
GTCACTCAAGAATACCGCCGCAGTGTCGGCTGCGTCTGCGGTTTCGGTCG
TCTCGTCGAATAATAACAATAATGCGGGTAATTCTGTGATCGCGTCCAGC
TCTGTCAATATGATGTCGCTTATGACAACCAATGCGACCCGATTGCGGAA
AGATCCCCGCTCATTGGATGAGGATGAAGAGCAGTGGTATGATCAAGATG
ATGAGGATGAGGATGACTCCATAAACAATTATCAGAATACCGCTCCTGCT
GCGCTTAGCTCTCCTACGCCGTTTATCGAGCGGTATACCGCCAGGCTCGC
AACCGGTGGTTCGGTGGTAACTAACGCCAACGGAATTACCGGAAGCAACA
GTATTGCAATTACCAGTGCCAAAACAGCGACAGACTCGGTGCCATTCAAA
CTCGGCAATCGATACGGTAAAGAGCAACATATTCCCATCAATATCAAGAG
CACCAGTTTGACGCTAGGTTCAGTTTCGTCGACCAGTAGTGGAGCAGGAA
CTATCGATACTTGTCAGGAACTGAATGGTAGTTTCGATATAGATTACAAC
AGATTGACAAATGGCGAGATCGATAAGGTCTCCTCCATCAGTTCAGATGA
ACAGCATCAGAAGGAATGTTTAACCACCAGCGCTACCAGTATCATTATCA
GTGACAAGTTGATCGATTCTACTGCCATCAGTTCAGAAGTAGCTCAAAAA
GCCAATGAACAGCAGCCACCCTGCTGTATGCTGACCGGACTCGTAGATTA
CTCATCAGACGATGAGGAAGAAAATGAAATCACATCAAACACAGACAACA
ATACCAGCAAGGAAGCTGCCGAATGGGGCTCCGTTTCTAGTCCGAAAAGA
TTGAAAATAGACTAATTTTATTCGAAGAGTAAAATTTTCAATGATCTAGT
TTTGGTTGTTAAATAAACGATGTGATTAGCAAGCAATAATATAGCAGCAG
CATTATGTATTGTAC
back to top

protein sequence of SMED30010680-orf-1

>SMED30010680-orf-1 ID=SMED30010680-orf-1|Name=SMED30010680-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MVLDHVIDQTVNVFRADKFEQFQNSRVEHVILTVLIEQANNTAKDVVLDY
ISIIEFFFGADEFPNDAQCTKDNELMLGFEQRDDTKQNVVVKRIILHVI*
back to top

protein sequence of SMED30010680-orf-2

>SMED30010680-orf-2 ID=SMED30010680-orf-2|Name=SMED30010680-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=931bp
MSSNSDVSTRRRVKLYMLNEERQWDDKGTGHVSATFVENNSMALVVISET
DGSHLLESKIQHDTAYQKQQETLIVWSEGDNMDLALSFQEKTGCDDIWEK
ICNVQGKDPSVDITQDLIDDADDADDMEMDTSSTGNNQGFEFPTCDLNHL
LEISEMFTQVVNYPIQRERLATALERSQYLKQLVDLFHKAEDLEDLKSLH
HLYEIMRAIVQFNRRNLYELIFSDEMMMDTVGILEYNPHKRVKHREFLTK
KANFKEVFPMNNALKNKIQQTYRVQYIQDSCMPPPSLFDDNAASSLNSFV
YLNKIDIITKLQDDNQFTQHLFNGLLNIETTSESRKDLLFLLKEFCIIVN
SLQPSQKESFFNFLCLNRALKAIFYSFKVADESLKPVCIDIIQIFIENQA
SVVRDFFINDSRENPNDSLYINILIDHMINDLDSELSNGFIITNMLKVLI
DPENMINSNQKNEKQEFLNFFYKCSIAHLTKPLVDLTADNQLKYDDYHTA
MVMNNIVELLAFCVEFHSYNMKNYAFHNNILLRVVTLFKSQHKFVVFGAL
RVIRKFISSKEEFNYRYIIKNNILSSVVGLLNENRQYNMLNSAILELFEF
IRTENINCLINNVIENHWESLQLHKYVNTFQTLKARYDQSVERSLKNTAA
VSAASAVSVVSSNNNNNAGNSVIASSSVNMMSLMTTNATRLRKDPRSLDE
DEEQWYDQDDEDEDDSINNYQNTAPAALSSPTPFIERYTARLATGGSVVT
NANGITGSNSIAITSAKTATDSVPFKLGNRYGKEQHIPINIKSTSLTLGS
VSSTSSGAGTIDTCQELNGSFDIDYNRLTNGEIDKVSSISSDEQHQKECL
TTSATSIIISDKLIDSTAISSEVAQKANEQQPPCCMLTGLVDYSSDDEEE
NEITSNTDNNTSKEAAEWGSVSSPKRLKID*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0000794condensed nuclear chromosome
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0030289protein phosphatase 4 complex
Vocabulary: biological process
TermDefinition
GO:0006974cellular response to DNA damage stimulus
GO:0043666regulation of phosphoprotein phosphatase activity
GO:0072462signal transduction involved in meiotic recombination checkpoint
GO:1902660negative regulation of glucose mediated signaling pathway
GO:2000002negative regulation of DNA damage checkpoint
GO:2001034positive regulation of double-strand break repair via nonhomologous end joining
GO:0006470protein dephosphorylation
GO:0045722positive regulation of gluconeogenesis
Vocabulary: molecular function
TermDefinition
GO:0019888protein phosphatase regulator activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006887DUF625
IPR011993PH-like_dom_sf
IPR000697WH1/EVH1_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 7..126
e-value: 9.3E-38
score: 130.9
IPR006887Domain of unknown function DUF625PFAMPF04802SMK-1coord: 177..363
e-value: 8.8E-60
score: 201.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 691..714
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 891..930
NoneNo IPR availablePANTHERPTHR23318ATP SYNTHASE GAMMA-RELATEDcoord: 5..914
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 8..105
IPR000697WH1/EVH1 domainPROSITEPS50229WH1coord: 1..108
score: 9.67