SMED30010677
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30010677 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 5
Alignments
SMED30010677 aligns in the following genomic locations:
Homology
BLAST of SMED30010677 vs. TrEMBL
Match: G7YQP5 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_107516 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 8.202e-8 Identity = 31/69 (44.93%), Postives = 44/69 (63.77%), Query Frame = -3 Query: 203 FLSIFIWTILFQSMAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFK 409 F+S+ +++IL QS V+ VTL LK P+ YI YDQ PF I H GISL I Y+IL + + + +I + Sbjct: 4 FVSV-VFSILLQS---VQMVTLEEGLKNPEKYIFYDQNPFNIGMHAGISLLITYSILAIVLTFITIISR 68
BLAST of SMED30010677 vs. TrEMBL
Match: A0A267EQR8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000783g2 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 1.985e-7 Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = -3 Query: 227 MSFLSIFIWTILFQSMAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIW 415 ++FL++ +L V C+TL A +PD YI YD T F I H GISL ICYAIL IW Sbjct: 29 VAFLAVIFVAVLPSG---VDCITLNDARADPDRYILYDTTQFHIGMHCGISLVICYAILCAIW 88
BLAST of SMED30010677 vs. TrEMBL
Match: A0A267EL98 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000783g4 PE=4 SV=1) HSP 1 Score: 57.7658 bits (138), Expect = 2.052e-7 Identity = 30/63 (47.62%), Postives = 37/63 (58.73%), Query Frame = -3 Query: 227 MSFLSIFIWTILFQSMAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIW 415 ++FL++ +L V C+TL A +PD YI YD T F I H GISL ICYAIL IW Sbjct: 30 VAFLAVIFVAVLPSG---VDCITLNDARADPDRYILYDTTQFHIGMHCGISLVICYAILCAIW 89
BLAST of SMED30010677 vs. TrEMBL
Match: A0A074ZEH6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10094 PE=4 SV=1) HSP 1 Score: 56.6102 bits (135), Expect = 6.524e-7 Identity = 32/69 (46.38%), Postives = 42/69 (60.87%), Query Frame = -3 Query: 203 FLSIFIWTILFQSMAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFK 409 F+SI +++IL QS V+ VTL LK P+ YI YDQ PF I H GISL I Y+IL + + I + Sbjct: 4 FVSI-VFSILLQS---VRMVTLEEGLKNPEKYIFYDQNPFNIGMHAGISLLITYSILAIVLGFIATISR 68
BLAST of SMED30010677 vs. Planmine SMEST
Match: SMESG000022725.1 (SMESG000022725.1) HSP 1 Score: 141.354 bits (355), Expect = 7.492e-44 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = -3 Query: 167 MAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFKIRELKKVGTELD 370 MAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFKIRELKKVGTELD Sbjct: 1 MAVVKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFKIRELKKVGTELD 68
BLAST of SMED30010677 vs. Planmine SMEST
Match: SMESG000035183.1 (SMESG000035183.1) HSP 1 Score: 54.299 bits (129), Expect = 6.401e-10 Identity = 25/56 (44.64%), Postives = 37/56 (66.07%), Query Frame = -3 Query: 194 VKCVTLGTALKEPDIYIKYDQTPFRIWFHIGISLAICYAILGTIWSMVNLIFKIRE 361 V+ VTL + P +YIKYD + + HIG+S+ I +AIL IW +VN IFK+++ Sbjct: 24 VQSVTLEDGKQNPGLYIKYDTSEMNLGLHIGLSILITFAILTIIWCIVNAIFKLQK 79 The following BLAST results are available for this feature:
BLAST of SMED30010677 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30010677 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30010677 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 4
BLAST of SMED30010677 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30010677 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30010677 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30010677 ID=SMED30010677|Name=SMED30010677|organism=Schmidtea mediterranea sexual|type=transcript|length=618bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|