SPATA6 domain-containing protein

Overview
NameSPATA6 domain-containing protein
Smed IDSMED30010674
Uniprot Best hitSpermatogenesis-associated protein 6 OS=Bos taurus OX=9913 GN=SPATA6 PE=2 SV=2 (E=1.94612e-20)
Length (bp)1263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SPATA6 domain-containing protein (SMED30010674) t-SNE clustered cells

Violin plots show distribution of expression levels for SPATA6 domain-containing protein (SMED30010674) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SPATA6 domain-containing protein (SMED30010674) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SPATA6 domain-containing protein (SMED30010674) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010674

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010674SMESG000053714.1 SmedASXL_004198SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30010674SMESG000053714.1 dd_Smed_v4_10543_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010674SMESG000053714.1 dd_Smed_v6_10543_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010674SMESG000053714.1 dd_Smed_v4_10543_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010674SMESG000053714.1 dd_Smed_v4_10543_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 98.5969 bits (244), Expect = 1.451e-22
Identity = 73/246 (29.67%), Postives = 111/246 (45.12%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSN-RELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGID------DREPFVVRKV 804
            ++  E+ I  I+ PG +LP + D+YL V   NQ   T      FP+   E   FEK+F S  DP  VV  +E      EL Q+         L+Y++ N RDF +P   L P      RE+LM   + FPGI+PK+EFS+   +    +C     +     +   SRRP      S  HEP +  +T+   L+  + + + + M          +H  +D+  +   G +       + PFVVR V
Sbjct:    4 EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVPPVWDE--LAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIR---ECVFLHRNRF-LEERHESRRPL-----STSHEPIFPLNTIKMKLKENNLNRLPKGMQARAPSQYSTRHFFQDQPAQLNLGNNFKISGGSKPPFVVRHV 238          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 90.8929 bits (224), Expect = 4.524e-21
Identity = 52/140 (37.14%), Postives = 72/140 (51.43%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSN-RELLMIRTVDFPGISPKVEFSS 504
            ++  E+ I  I+ PG +LP + D+YL V   NQ   T      FP+   E   FEK+F S  DP  VV  +E      EL Q+         L+Y++ N RDF +P   L P      RE+LM   + FPGI+PK+EFS+
Sbjct:    4 EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVPPVWDE--LAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFST 141          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 90.8929 bits (224), Expect = 4.524e-21
Identity = 52/140 (37.14%), Postives = 72/140 (51.43%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSN-RELLMIRTVDFPGISPKVEFSS 504
            ++  E+ I  I+ PG +LP + D+YL V   NQ   T      FP+   E   FEK+F S  DP  VV  +E      EL Q+         L+Y++ N RDF +P   L P      RE+LM   + FPGI+PK+EFS+
Sbjct:    4 EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVPPVWDE--LAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFST 141          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 90.5077 bits (223), Expect = 3.060e-19
Identity = 70/246 (28.46%), Postives = 107/246 (43.50%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSN-RELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGID------DREPFVVRKV 804
            ++  E+ I  I+ PG +LP + D+YL V   NQ   T      FP+   E   FEK+F S  DP  VV  +E                    L+Y++ N RDF +P   L P      RE+LM   + FPGI+PK+EFS+   +    +C     +     +   SRRP      S  HEP +  +T+   L+  + + + + M          +H  +D+  +   G +       + PFVVR V
Sbjct:    4 EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLE----------------MWDELAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIR---ECVFLHRNRF-LEERHESRRPL-----STSHEPIFPLNTIKMKLKENNLNRLPKGMQARAPSQYSTRHFFQDQPAQLNLGNNFKISGGSKPPFVVRHV 224          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6 (spermatogenesis associated 6 [Source:HGNC Symbol;Acc:HGNC:18309])

HSP 1 Score: 90.5077 bits (223), Expect = 4.935e-19
Identity = 50/139 (35.97%), Postives = 77/139 (55.40%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     G +P++EFS+  V+
Sbjct:   13 LEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. Ensembl Fly
Match: CG14079 (gene:FBgn0036849 transcript:FBtr0075027)

HSP 1 Score: 66.2402 bits (160), Expect = 5.588e-12
Identity = 44/143 (30.77%), Postives = 69/143 (48.25%), Query Frame = 1
Query:   85 YKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVA-DIYLGGTLLSYFDTNARDFFYPC-SNLCPRSVSNRELLMIRTVDFPGI-SPKVEFSS 504
            + +  ++ +H +T PG WL +   L  T+ +     RT    P FP+  H++FT E  F S       V  +E++   ++  Q+   ++  G  L+YF  +  D   P    L     SN +LLM  T  FPGI +PKVE S+
Sbjct:    6 FYVKLDLQLHALTCPGVWLCSHGYLEATIKTLGYYFRTGPMEPRFPMLCHDQFTMEGYFKS-------VGCLEEMHELLKAEQLEITVWQNGRRLAYFVGSLSDVMQPTFPRLSCAHSSNVQLLMKATPAFPGILAPKVELSA 141          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6 (spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-GENE-050417-351])

HSP 1 Score: 120.939 bits (302), Expect = 8.993e-30
Identity = 84/251 (33.47%), Postives = 127/251 (50.60%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVS-NRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPAD----------KVYPSIFHEPSYSKHTVNSALRSRSPSPMD-REMAKGHVITDIIQHRVKDKQLK---YQTGIDDREPFVV 795
            K   E+ +  IT PG  LP+++D+YL+V    Q +++K   P FPL  HEK  F K F    DP  V   +E+   ++EL Q+  +   G +L+ F+ + R+F YP   L PRS    RE+LM R++ FPGISP+VEFS+  +++   +C V  G     S    S +P+           K          Y K TV S  RSR+PSP   R+M +   +++  + R+   +L    +Q     + PFVV
Sbjct:    7 KCTVELKVQAITCPGVMLPSQEDIYLSVRIMGQYQKSKCVPPVFPLLLHEKMVFVKTFVGMLDPAAVAEHLENDTTSLELIQL--VPPEGEILATFEADTREFLYPGPRLTPRSPGPEREILMKRSISFPGISPRVEFSTTSIIE---ECDVKHGQSAVSSHGRSSAKPSSMRTCLSSAKKKKKSDKVSSCGYEKSTVAS--RSRAPSPYTHRKMCQ---LSEEARQRLSHLKLGPYTFQKETAPQAPFVV 247          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 97.0561 bits (240), Expect = 5.401e-22
Identity = 53/147 (36.05%), Postives = 83/147 (56.46%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPR-SVSNRELLMIRTVDFPGISPKVEFSSYCVMDKM 525
            K+  E+ +  IT PG  LP +DD+YL+V   N+ ++++     FP+   EK  FEKI     DP+ +   ++   V +EL Q+  I   G +L+ F+ +AR F +P   L P  S   RE+LM R   FPGISP++EFS+   + ++
Sbjct:    7 KVIVELHLRAITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQL--IPPAGEILASFEEDARSFLFPEPKLVPSFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEI 151          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 93.2041 bits (230), Expect = 1.958e-21
Identity = 51/137 (37.23%), Postives = 78/137 (56.93%), Query Frame = 1
Query:  118 ITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPR-SVSNRELLMIRTVDFPGISPKVEFSSYCVMDKM 525
            IT PG  LP +DD+YL+V   N+ ++++     FP+   EK  FEKI     DP+ +   ++   V +EL Q+  I   G +L+ F+ +AR F +P   L P  S   RE+LM R   FPGISP++EFS+   + ++
Sbjct:    7 ITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQL--IPPAGEILASFEEDARSFLFPEPKLVPSFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEI 141          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 48.1358 bits (113), Expect = 3.522e-7
Identity = 22/58 (37.93%), Postives = 34/58 (58.62%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIF 261
            K+  E+ +  IT PG  LP +DD+YL+V   N+ ++++     FP+   EK  FEK F
Sbjct:    7 KVIVELHLRAITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKCF 64          
BLAST of SPATA6 domain-containing protein vs. Ensembl Xenopus
Match: spata6l (spermatogenesis associated 6-like [Source:NCBI gene;Acc:779679])

HSP 1 Score: 104.76 bits (260), Expect = 3.666e-24
Identity = 56/148 (37.84%), Postives = 78/148 (52.70%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVS-NRELLMIRTVDFPGISPKVEFSSYCVMDKMP 528
            KI  E+ IH +T PG +LP +DD+ L V    Q K T      FPL FHEK  FEK+F    DP  +  ++E+     EL Q+        +L+ F+ N R F +P   L P     +RE+LM     FPGI+PK+EFS+   + + P
Sbjct:    4 KIVIELQIHAVTCPGVFLPEKDDILLNVSILGQHKETGCLPSVFPLLFHEKMRFEKVFLKAVDPAALAQSLENHITRFELIQLTH---SADILAVFEENTRQFLFPEPKLTPAYPGVDREVLMKTVNGFPGIAPKIEFSTRTTIKEKP 148          
BLAST of SPATA6 domain-containing protein vs. Ensembl Xenopus
Match: spata6l (spermatogenesis associated 6-like [Source:NCBI gene;Acc:779679])

HSP 1 Score: 87.8113 bits (216), Expect = 1.838e-18
Identity = 50/139 (35.97%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  115 HITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVS-NRELLMIRTVDFPGISPKVEFSSYCVMDKMP 528
             +T PG +LP +DD+ L V    Q K T      FPL FHEK  FEK+F    DP  +  ++E            DI      L+ F+ N R F +P   L P     +RE+LM     FPGI+PK+EFS+   + + P
Sbjct:    2 QVTCPGVFLPEKDDILLNVSILGQHKETGCLPSVFPLLFHEKMRFEKVFLKAVDPAALAQSLE-----------TDI------LAVFEENTRQFLFPEPKLTPAYPGVDREVLMKTVNGFPGIAPKIEFSTRTTIKEKP 123          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 94.7449 bits (234), Expect = 1.755e-22
Identity = 57/171 (33.33%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPS 612
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+      G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+    +C ++       S+ CR++  +  +  S
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVPPV--GETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVIT---ECLIS-------SRKCRTQEASKNLCGS 171          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 94.7449 bits (234), Expect = 1.350e-20
Identity = 52/139 (37.41%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 94.7449 bits (234), Expect = 1.396e-20
Identity = 52/139 (37.41%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: 4430402I18Rik (RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:MGI:1918036])

HSP 1 Score: 90.1225 bits (222), Expect = 2.803e-19
Identity = 55/178 (30.90%), Postives = 85/178 (47.75%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVS-NRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVY 606
             PM ++  E+ I  I+ PG +LP+++ +YL V   NQ   T    P FP+   +   F K+F    DP  V   +E      EL Q+  +      L+Y++ N RDF +P   L    +   RE+LM   + FPGI+PK+EFS+   +    +C     +   C + CR  R   K +
Sbjct:    1 MPM-EVVVELQIRAISCPGVFLPDKEAVYLGVYLLNQYLETDCFPPVFPVVIQQSMRFVKVFEEAIDPGAVAELLESFLTRFELVQL--VSPAWEELAYYEKNTRDFLFPEPRLASSHLGMQREVLMKTAIWFPGIAPKIEFSTRTAIL---ECVFPCKNRFICEERCRLERSVSKSH 172          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 62.3882 bits (150), Expect = 6.723e-12
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARD 393
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E               LG TL +Y D N RD
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLE---------------LGETLSTY-DENTRD 93          
BLAST of SPATA6 domain-containing protein vs. UniProt
Match: sp|Q2KJG1|SPAT6_BOVIN (Spermatogenesis-associated protein 6 OS=Bos taurus OX=9913 GN=SPATA6 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 1.946e-20
Identity = 53/139 (38.13%), Postives = 79/139 (56.83%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+    NFPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPANFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTALFELIQL--VPPVGETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. UniProt
Match: sp|Q99MU5|SPAT6_RAT (Spermatogenesis-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 6.768e-20
Identity = 52/139 (37.41%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+
Sbjct:   13 LEIRSVTCPGVLLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. UniProt
Match: sp|Q3U6K5|SPAT6_MOUSE (Spermatogenesis-associated protein 6 OS=Mus musculus OX=10090 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 9.442e-20
Identity = 52/139 (37.41%), Postives = 78/139 (56.12%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     GI+PK+EFS+  V+
Sbjct:   13 LEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. UniProt
Match: sp|Q8N4H0|SPA6L_HUMAN (Spermatogenesis associated 6-like protein OS=Homo sapiens OX=9606 GN=SPATA6L PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.469e-18
Identity = 70/246 (28.46%), Postives = 107/246 (43.50%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSN-RELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGID------DREPFVVRKV 804
            ++  E+ I  I+ PG +LP + D+YL V   NQ   T      FP+   E   FEK+F S  DP  VV  +E                    L+Y++ N RDF +P   L P      RE+LM   + FPGI+PK+EFS+   +    +C     +     +   SRRP      S  HEP +  +T+   L+  + + + + M          +H  +D+  +   G +       + PFVVR V
Sbjct:    4 EVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLE----------------MWDELAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIR---ECVFLHRNRF-LEERHESRRPL-----STSHEPIFPLNTIKMKLKENNLNRLPKGMQARAPSQYSTRHFFQDQPAQLNLGNNFKISGGSKPPFVVRHV 224          
BLAST of SPATA6 domain-containing protein vs. UniProt
Match: sp|Q9NWH7|SPAT6_HUMAN (Spermatogenesis-associated protein 6 OS=Homo sapiens OX=9606 GN=SPATA6 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.370e-18
Identity = 50/139 (35.97%), Postives = 77/139 (55.40%), Query Frame = 1
Query:  103 ITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSN-LCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            + I  +T PG  L +++D+YL++  F Q K+T+     FPL F+ +  FEK+F    DP DVV+ +E      EL Q+  +   G  LS +D N RDF +P  N +     SNR++ M R     G +P++EFS+  V+
Sbjct:   13 LEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQL--VPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVI 149          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17204859 (tr|Q5DFK1|Q5DFK1_SCHJA SJCHGC05424 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.075e-58
Identity = 100/235 (42.55%), Postives = 146/235 (62.13%), Query Frame = 1
Query:   79 PMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMD------------KMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDK 747
            PMY+   ++TIH + SPGTWL NRD+LYLT+++F  +KRT+L +  FPL  HEKF+F+K F++     +VV  +ED  VT+E+RQ+AD+YLGGTLL+Y+ TNA++FF PCS +C R++  R+LLMI+T+DFPG+SP++E+S    +              +P+C         C   C        +Y  +   PSY + TVNSALRSR P   +   +K H+ +D   H  K +
Sbjct:    2 PMYRFEGDVTIHCVYSPGTWLINRDNLYLTIETFGIIKRTQLQNAIFPLLIHEKFSFDKTFYTALSASNVVDRLEDFTVTIEIRQIADVYLGGTLLAYYTTNAKEFFSPCSKMCLRTLPKRDLLMIKTIDFPGVSPRLEYSVSSAIKCHSSSCYCSCCYSLPQCC--------CYDPC--------LYKPMTPTPSYHRATVNSALRSRYP---EITGSKCHIASDTANHLAKSQ 217          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17178337 (tr|A0A4Z2D8X1|A0A4Z2D8X1_SCHJA Spermatogenesis associated 6-like protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_003597 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 6.535e-58
Identity = 100/236 (42.37%), Postives = 146/236 (61.86%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMD------------KMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDK 747
             PMY+   ++TIH + SPGTWL NRD+LYLT+++F  +KRT+L +  FPL  HEKF+F+K F++     +VV  +ED  VT+E+RQ+AD+YLGGTLL+Y+ TNA++FF PCS +C R++  R+LLMI+T+DFPG+SP++E+S    +              +P+C         C   C        +Y  +   PSY + TVNSALRSR P   +   +K H+ +D   H  K +
Sbjct:    1 MPMYRFEGDVTIHCVYSPGTWLINRDNLYLTIETFGIIKRTQLQNAIFPLLIHEKFSFDKTFYTALSASNVVDRLEDFTVTIEIRQIADVYLGGTLLAYYTTNAKEFFSPCSKMCLRTLPKRDLLMIKTIDFPGVSPRLEYSVSSAIKCHSSSCYCSCCYSLPQCC--------CYDPC--------LYKPMTPTPSYHRATVNSALRSRYP---EITGSKCHIASDTANHLAKSQ 217          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17209348 (tr|A0A4Z2D862|A0A4Z2D862_SCHJA Spermatogenesis associated 6-like protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_003597 PE=4 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 3.676e-57
Identity = 100/236 (42.37%), Postives = 145/236 (61.44%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMD------------KMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDK 747
             PMY+   ++TIH + SPGTWL NRD+LYLT+++F  +KRT+L +  FPL  HEKF+F+K F++     +VV  +ED  VT+E+RQ+AD+YLGGTLL+Y+ TNA++FF PCS +C R++  R+LLMI+T+DFPG+SP++E+S    +              +P+C         C   C        +Y  +   PSY + TVNSALRSR P       +K H+ +D   H  K +
Sbjct:    1 MPMYRFEGDVTIHCVYSPGTWLINRDNLYLTIETFGIIKRTQLQNAIFPLLIHEKFSFDKTFYTALSASNVVDRLEDFTVTIEIRQIADVYLGGTLLAYYTTNAKEFFSPCSKMCLRTLPKRDLLMIKTIDFPGVSPRLEYSVSSAIKCHSSSCYCSCCYSLPQCC--------CYDPC--------LYKPMTPTPSYHRATVNSALRSRYPEITG---SKCHIASDTANHLAKSQ 217          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|17184549 (tr|C1LEY0|C1LEY0_SCHJA Spermatogenesis-associated protein 6 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 199.519 bits (506), Expect = 4.407e-57
Identity = 100/236 (42.37%), Postives = 145/236 (61.44%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMD------------KMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDK 747
             PMY+   ++TIH + SPGTWL NRD+LYLT+++F  +KRT+L +  FPL  HEKF+F+K F++     +VV  +ED  VT+E+RQ+AD+YLGGTLL+Y+ TNA++FF PCS +C R++  R+LLMI+T+DFPG+SP++E+S    +              +P+C         C   C        +Y  +   PSY + TVNSALRSR P       +K H+ +D   H  K +
Sbjct:    1 MPMYRFEGDVTIHCVYSPGTWLINRDNLYLTIETFGIIKRTQLQNAIFPLLIHEKFSFDKTFYTALSASNVVDRLEDFTVTIEIRQIADVYLGGTLLAYYTTNAKEFFSPCSKMCLRTLPKRDLLMIKTIDFPGVSPRLEYSVSSAIKCHSSSCYCSCCYSLPQCC--------CYDPC--------LYKPMTPTPSYHRATVNSALRSRYPEITG---SKYHIASDTANHIAKSQ 217          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16057020 (tr|G4VSB1|G4VSB1_SCHMA SPATA6 domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_148160 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.344e-53
Identity = 94/229 (41.05%), Postives = 142/229 (62.01%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHE-----PSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDK 747
             P+Y+   ++ I+ + SPGTWL NRD+LYLT++ F  +KRT+L +  FPL  HEKF+F+K F++     +VV  +ED  VT+E+RQ+AD+YLGGTLL+Y+ TNA++FF PCS +C R++  R+LLM++T+DFPG+SP++E+S    +   P           C  +C    P    Y    ++     PSY + TVNSALR R P   + + +K  + +D   H  K +
Sbjct:    1 MPVYRFEGDVNINCVYSPGTWLINRDNLYLTIEVFGIIKRTRLLNAIFPLLIHEKFSFDKTFYTALSACNVVDRLEDYTVTIEIRQIADVYLGGTLLAYYSTNAKEFFTPCSKMCLRTIPKRDLLMLKTIDFPGVSPRLEYSVSSAIKCHP---------ASCYCTCCYSSPQCCCYDPCLYKPMTPTPSYYRATVNSALRCRYP---ESDGSKYTIASDTANHIAKSQ 217          
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Match: spata6 (spermatogenesis associated 6 [Source:NCBI gene;Acc:103025219])

HSP 1 Score: 117.472 bits (293), Expect = 1.536e-28
Identity = 83/247 (33.60%), Postives = 125/247 (50.61%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRS-VSNRELLMIRTVDFPGISPKVEFSSYCVMD----KMPKCTVNQGDVVKCSKSCRSRRPADK--VYPSIFHEPSYSKHTVNSALRSRSPSP-MDREMAKGHVITDIIQHRVKDKQL---KYQTGIDDREPFVV 795
            ++  ++ +H +T PG  LP+ +D+YL+V    +  +TK     FPL  HEK  F KIF    DP D+   +E+     EL Q+  +   G +L+    N RDF YP   L P +  S RE+LM ++V FPGISP+VEFS+  V++    K  + T +  +       C    PA K  + PS      Y + TV S  +SRSPSP   R M +   +++  + R+   QL    ++     + PFVV
Sbjct:   14 QVTVQLKLHAVTCPGVLLPSHEDVYLSVRMMGRYHKTKCVPSVFPLLLHEKMVFTKIFSGAVDPGDIADHLENDTTCFELIQL--VPPEGEILATLQENTRDFLYPGPRLTPPAPGSEREILMKKSVSFPGISPRVEFSTTSVIEECDLKASQSTFSPSNSSPTKPCCVKTSPAGKSRMKPSTAPLCGYQQPTVAS--QSRSPSPYTHRRMCQ---LSEDTRQRLSHLQLGPYNFKKETAPQPPFVV 253          
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Match: spata6l (spermatogenesis associated 6-like protein [Source:NCBI gene;Acc:103039467])

HSP 1 Score: 95.9005 bits (237), Expect = 1.843e-21
Identity = 54/144 (37.50%), Postives = 79/144 (54.86%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPR-SVSNRELLMIRTVDFPGISPKVEFSSYCVM 516
            K+  E+ I  IT PG  L  +DD+YL+    NQ +++      FPL F  K  FEKIF    DP  +   ++   V +EL Q+  I   G +L+ ++ NAR F +P   L P  S  +RE+LM R  +F GISP++EFS+   +
Sbjct:    7 KVFVELHIRAITCPGVHLTAKDDIYLSACLLNQYRKSDCLPAVFPLLFRTKMRFEKIFKYAIDPAAIAEILQCETVKIELIQL--IRPAGEILATYEENARSFLFPEPKLVPSFSGGDREVLMTRDPNFSGISPRLEFSTRTTI 148          
BLAST of SPATA6 domain-containing protein vs. Ensembl Nematostella
Match: EDO34010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL7])

HSP 1 Score: 89.3521 bits (220), Expect = 2.636e-19
Identity = 53/152 (34.87%), Postives = 80/152 (52.63%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDF-----PGISPKVEFSSYCVMDKMP 528
            K+  E+ +H IT PGT+L +   +YL V+       TK   P FP+ FHE+  FE++F SC DP  V   ++   V VELRQ  D    G ++ ++  NARDF YP     P   + REL + +T  F      G   ++EF++   + ++P
Sbjct:  194 KVIVELDVHTITCPGTFLRDYGYVYLKVNCMGLEVNTKSVPPTFPVFFHERLRFERVFKSCQDPAYVSIHLKGEDVLVELRQHDDYISDGYVIGHYANNARDFLYPAVPTYPG--TGRELTLFKTSLFNPIRITGQPLRLEFTTKTTIKEVP 343          
BLAST of SPATA6 domain-containing protein vs. Ensembl Medaka
Match: spata6 (spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-GENE-050417-351])

HSP 1 Score: 72.7886 bits (177), Expect = 1.285e-13
Identity = 62/243 (25.51%), Postives = 107/243 (44.03%), Query Frame = 1
Query:  178 FNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCT------------VNQGDVVKCSKSCRSRRPADKVYPSI---------FHEPSYSKHTVNSALRSRSPSP-MDREMAKGHVITDIIQHRVKDKQL---KYQTGIDDREPFVVRKVQDDMFVRKP 831
              Q + T    P FP+    K TFEK F    DP DV   +E    + +L Q+  +     +L+  +  +RDF +P   L     + RE+L+ R+  FPGISP+VEF++  +M+                  ++     + S +C  + PA K + S+              Y + TV S  R+R+PSP   R+M +   +++  + R+   QL   ++      + PF+V + ++      P
Sbjct:    1 MGQRRTTASFPPLFPVLLQSKLTFEKTFSGVVDPADVADLLEGDTTSFQLIQL--VSPEAQILATMEERSRDFLFPPPRLISTKGAWREVLLKRSPSFPGISPRVEFTTTSIMEGSDGADAASPTSCPSPVRLSLAQTSRSSPAC-GKGPAFKAHQSLPENAKGRKRTEAAGYQQPTVAS--RARTPSPYTHRKMCQ---LSEDARQRLAHLQLGPHRFMKETKLQPPFLVPRCRNASVAGTP 235          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000053714.1 (SMESG000053714.1)

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 335/336 (99.70%), Postives = 336/336 (100.00%), Query Frame = 1
Query:   82 MYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGIDDREPFVVRKVQDDMFVRKPKFHKHCQFNDNKPFRSSVMCHPKCHSPFRVHSPTLEERLDNPKSRRNINRTVRSLSRPVSPLGYERMSLDSLKRDLLKTRIKRRYP 1089
            MYKIHCEITIHHITSPGTWLPNRDDLYLT+DSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGIDDREPFVVRKVQDDMFVRKPKFHKHCQFNDNKPFRSSVMCHPKCHSPFRVHSPTLEERLDNPKSRRNINRTVRSLSRPVSPLGYERMSLDSLKRDLLKTRIKRRYP
Sbjct:    1 MYKIHCEITIHHITSPGTWLPNRDDLYLTIDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPKCTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGIDDREPFVVRKVQDDMFVRKPKFHKHCQFNDNKPFRSSVMCHPKCHSPFRVHSPTLEERLDNPKSRRNINRTVRSLSRPVSPLGYERMSLDSLKRDLLKTRIKRRYP 336          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000013811.1 (SMESG000013811.1)

HSP 1 Score: 124.405 bits (311), Expect = 1.767e-31
Identity = 95/294 (32.31%), Postives = 145/294 (49.32%), Query Frame = 1
Query:  100 EITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMP----------KCTVNQ----------GDVVKCSKSCRSRRPADK--VYPSIFHE------PSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHR----VKDKQLKYQTGIDDRE--PFVVRKVQDDMFVRKPKFHKHCQFNDNKPFRS 879
            E+ +H ++S G        +YL+V+ F  V +TK     +PL F+E   F+K F+S ++  +V+  +ED  V +ELR++   +  G LLSYFD NA++F +   +  P S++ +E+ + RTVDF G +P++ +S +  + K+           K  VN              V  S   +SRR   K   Y S   E      P Y++ TV SALRSRSPSP         VI     +R    +KD ++      DD +  PFVVRKV D +  R PK H     ++++  RS
Sbjct:   11 ELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSP---------VINKSSDYRDDSGIKDSEMS-DVAYDDYQKPPFVVRKVPDSLITRAPKLHDSIARSNSRKSRS 294          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000073102.1 (SMESG000073102.1)

HSP 1 Score: 103.605 bits (257), Expect = 4.889e-25
Identity = 67/186 (36.02%), Postives = 96/186 (51.61%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYC-VMDKMPKCTVNQGDVV---KCSKSCRSRRPA--DKVYPSI 615
             P + I  EI +  I+SPGT L  R+ +++ +D   + + +   SPNFP+   E F F K    C+D    +  +E +P ++ELRQ   ++  G LL+YFD+N  D     SN     + NRELLMIR+  F GISPK+ FSS   V+   P       + +   KC   CR R P   D V P +
Sbjct:    1 MPCFDIVGEIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKLIFSSCVEVISSNPGSRPRGRNCIRPQKCLPVCRPRLPLCRDGVTPDM 186          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000017199.1 (SMESG000017199.1)

HSP 1 Score: 77.0258 bits (188), Expect = 4.131e-15
Identity = 72/276 (26.09%), Postives = 119/276 (43.12%), Query Frame = 1
Query:   88 KIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFP-GISPKVEF--------SSYCVMDKMPK-----CTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSR-SPSPMDREMAKGHVITDIIQHRVKDKQLKYQTGIDD-------------REPFVVRKVQDDMFVRKP 831
            KI  E+ +  I  P + L   D +Y+ V+ F + ++TKL  P FP+  ++ F FEKI WS    K+    +++ PV++ELR   +      LL Y D+NA +F          SV   + + +   ++  G SPK++F        S   V+D++ +     C   Q    +C     SR     V     +  +   H       S  +    DR ++    + +   +++K+K  +Y+  I D             R PFVVRKV  D+  R P
Sbjct:    7 KIASEMQLKMICVPHSKLCKFDHIYINVELFGETQKTKLMHPYFPIKSNDSFHFEKILWSPHTKKEAFKLLKESPVSIELRHFMNGSSDSVLLGYADSNAYEFLIAGGEHEKDSVCVEKQIELNQTEYHCGPSPKLQFIIRTAIKCSEAPVIDELLQYYSGPCRCCQAVYNRCHS---SRGGQYLVANGDLYSCNCELHRSERDGTSHCNVCHQDRTLS----VCENCLYKLKNKSKEYEDEISDFEEAKPNVNAEKMRPPFVVRKVPQDIVARIP 275          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000002798.1 (SMESG000002798.1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.737e-12
Identity = 41/159 (25.79%), Postives = 77/159 (48.43%), Query Frame = 1
Query:   76 FPMYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMI-RTVDFPGISPKVEFSSYCVMDKMPKCTVNQG 549
             P +K+  ++ I  I   G+ +  R ++ L ++ FN++K +K     FP+   E F F+++F+ C +   V+  + D PVT+EL +V       + ++YFD N  D    C ++ P    +R + MI +       SP + +S    +  +  C+   G
Sbjct:    1 MPNFKVEIDLEIEKINYCGSKIDCRTEVSLRIEIFNKIKYSKYRQAQFPIRLCEHFCFKELFFDCPNSMTVLQRLNDCPVTIELIEVGS-SCQDSSVAYFDGNVYDITELC-DMGPARCYSRTINMINKNFIKSYTSPSICYSCTSSVSNLLSCSSETG 157          
The following BLAST results are available for this feature:
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPATA6L1.451e-2229.67spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L4.524e-2137.14spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L4.524e-2137.14spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L3.060e-1928.46spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA64.935e-1935.97spermatogenesis associated 6 [Source:HGNC Symbol;A... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG140795.588e-1230.77gene:FBgn0036849 transcript:FBtr0075027[more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spata68.993e-3033.47spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-... [more]
spata6l5.401e-2236.05spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
spata6l1.958e-2137.23spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
spata6l3.522e-737.93spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata6l3.666e-2437.84spermatogenesis associated 6-like [Source:NCBI gen... [more]
spata6l1.838e-1835.97spermatogenesis associated 6-like [Source:NCBI gen... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spata61.755e-2233.33spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata61.350e-2037.41spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata61.396e-2037.41spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
4430402I18Rik2.803e-1930.90RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:... [more]
Spata66.723e-1236.08spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2KJG1|SPAT6_BOVIN1.946e-2038.13Spermatogenesis-associated protein 6 OS=Bos taurus... [more]
sp|Q99MU5|SPAT6_RAT6.768e-2037.41Spermatogenesis-associated protein 6 OS=Rattus nor... [more]
sp|Q3U6K5|SPAT6_MOUSE9.442e-2037.41Spermatogenesis-associated protein 6 OS=Mus muscul... [more]
sp|Q8N4H0|SPA6L_HUMAN1.469e-1828.46Spermatogenesis associated 6-like protein OS=Homo ... [more]
sp|Q9NWH7|SPAT6_HUMAN2.370e-1835.97Spermatogenesis-associated protein 6 OS=Homo sapie... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|172048593.075e-5842.55tr|Q5DFK1|Q5DFK1_SCHJA SJCHGC05424 protein OS=Schi... [more]
gnl|BL_ORD_ID|171783376.535e-5842.37tr|A0A4Z2D8X1|A0A4Z2D8X1_SCHJA Spermatogenesis ass... [more]
gnl|BL_ORD_ID|172093483.676e-5742.37tr|A0A4Z2D862|A0A4Z2D862_SCHJA Spermatogenesis ass... [more]
gnl|BL_ORD_ID|171845494.407e-5742.37tr|C1LEY0|C1LEY0_SCHJA Spermatogenesis-associated ... [more]
gnl|BL_ORD_ID|160570204.344e-5341.05tr|G4VSB1|G4VSB1_SCHMA SPATA6 domain-containing pr... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata61.536e-2833.60spermatogenesis associated 6 [Source:NCBI gene;Acc... [more]
spata6l1.843e-2137.50spermatogenesis associated 6-like protein [Source:... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340102.636e-1934.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spata61.285e-1325.51spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053714.10.000e+099.70SMESG000053714.1[more]
SMESG000013811.11.767e-3132.31SMESG000013811.1[more]
SMESG000073102.14.889e-2536.02SMESG000073102.1[more]
SMESG000017199.14.131e-1526.09SMESG000017199.1[more]
SMESG000002798.13.737e-1225.79SMESG000002798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010674 ID=SMED30010674|Name=SPATA6 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1263bp
GTTGTTATAGCAAATAATACTTAATCAATTCAAATTACAATTTGTGTTTC
ATTGAAATAATTCAATAAAATTTAATTTCCAATGTATAAAATTCATTGCG
AGATAACCATTCATCATATTACATCTCCAGGAACGTGGTTACCAAATCGT
GATGATCTTTATTTAACTGTTGATTCGTTTAATCAAGTTAAACGTACAAA
GCTGTCATCTCCAAACTTCCCATTAAGTTTTCATGAAAAATTTACCTTCG
AAAAAATATTTTGGAGTTGTGCTGATCCTAAAGATGTTGTTTCAGCAATG
GAAGATATCCCGGTGACAGTCGAATTGAGACAAGTTGCCGATATTTATCT
AGGTGGTACATTATTGAGTTATTTCGATACAAATGCTCGTGACTTTTTCT
ATCCATGCTCAAACCTTTGTCCAAGATCTGTATCCAATCGAGAACTTCTA
ATGATACGCACTGTTGATTTTCCGGGAATTTCTCCGAAAGTCGAATTCTC
AAGCTACTGTGTTATGGATAAAATGCCAAAATGTACTGTCAATCAAGGCG
ACGTCGTGAAATGCAGTAAATCCTGCCGATCTAGGAGACCGGCAGACAAA
GTCTATCCTTCTATATTCCATGAGCCAAGTTATAGCAAACACACAGTTAA
TAGCGCTCTCAGATCACGATCACCTTCTCCAATGGACCGAGAAATGGCTA
AAGGTCACGTAATTACCGACATAATACAGCATAGGGTGAAGGACAAGCAA
TTGAAGTACCAAACTGGAATTGATGATCGGGAGCCATTTGTTGTCAGAAA
GGTGCAAGACGACATGTTTGTGCGGAAGCCAAAGTTTCATAAGCATTGCC
AATTTAATGACAACAAACCATTTCGCTCATCCGTAATGTGTCATCCAAAA
TGCCATTCTCCATTTCGAGTCCATTCGCCAACACTGGAAGAAAGATTGGA
CAATCCAAAATCTAGGAGAAATATCAATCGAACTGTAAGAAGTCTCAGTA
GACCTGTTTCTCCCCTGGGATACGAAAGAATGTCACTTGATTCCCTGAAG
AGGGACCTCCTGAAAACCAGAATTAAAAGGAGATATCCATAAAATTATAC
TAATGAGGAAATGTTTCTTTTTATTTGTAACATTCAGGTTATTCAGATCA
TTTTTGTCTTTAAAAATCCGATAAATTAATGATAGAACAAATTGACATTT
GTGATTTATCTATTTGCTGATCCATACAACTCGTAGGCAGACATATCATG
CATTATTCACTAG
back to top

protein sequence of SMED30010674-orf-1

>SMED30010674-orf-1 ID=SMED30010674-orf-1|Name=SMED30010674-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=337bp
MYKIHCEITIHHITSPGTWLPNRDDLYLTVDSFNQVKRTKLSSPNFPLSF
HEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDT
NARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMPK
CTVNQGDVVKCSKSCRSRRPADKVYPSIFHEPSYSKHTVNSALRSRSPSP
MDREMAKGHVITDIIQHRVKDKQLKYQTGIDDREPFVVRKVQDDMFVRKP
KFHKHCQFNDNKPFRSSVMCHPKCHSPFRVHSPTLEERLDNPKSRRNINR
TVRSLSRPVSPLGYERMSLDSLKRDLLKTRIKRRYP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
Vocabulary: molecular function
TermDefinition
GO:0032027myosin light chain binding
Vocabulary: cellular component
TermDefinition
GO:0097224sperm connecting piece
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042769SPATA6_fam
IPR032732SPATA6_N
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032732Spermatogenesis-associated protein 6, N-terminalPFAMPF14909SPATA6coord: 7..143
e-value: 1.8E-42
score: 144.7
IPR042769SPATA6 familyPANTHERPTHR16435SPERMATOGENESIS-ASSOCIATED PROTEIN 6 SPATA6coord: 3..303