MAGUK p55 subfamily member 5

Overview
NameMAGUK p55 subfamily member 5
Smed IDSMED30010668
Length (bp)2507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MAGUK p55 subfamily member 5 (SMED30010668) t-SNE clustered cells

Violin plots show distribution of expression levels for MAGUK p55 subfamily member 5 (SMED30010668) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MAGUK p55 subfamily member 5 (SMED30010668) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MAGUK p55 subfamily member 5 (SMED30010668) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010668

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30010668SMESG000017294.1 dd_Smed_v6_6790_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30010668SMESG000043684.1 isotig12304be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30010668SMESG000019904.1 dd_Smed_v4_4689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30010668SMESG000017294.1 dd_Smed_v4_6790_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 294.664 bits (753), Expect = 2.496e-88
Identity = 210/639 (32.86%), Postives = 324/639 (50.70%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  A+  +      PP    S+AQ   ++V   L       K  H+K + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                      Y  I     +  +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    D    G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  109 SQEDISLLLQLVQNKDFQNAFKIHNAI-TVHMNKASPPFPLISNAQDLAQEVQTVL-------KPVHHK-EGQELTALLNTPHIQALLLAHDKVAEQEMQLE---------------------------PITDER---------------------VYESIGQYGGET-VKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 640          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 295.049 bits (754), Expect = 3.774e-88
Identity = 210/639 (32.86%), Postives = 323/639 (50.55%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  A+  +      PP    S+AQ   ++V   L       K  H+K + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    D    G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNKDFQNAFKIHNAI-TVHMNKASPPFPLISNAQDLAQEVQTVL-------KPVHHK-EGQELTALLNTPHIQALLLAHDKVAEQEMQLE---------------------------PITDERVYESI---------------GQYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Match: MPP3 (membrane palmitoylated protein 3 [Source:HGNC Symbol;Acc:HGNC:7221])

HSP 1 Score: 196.823 bits (499), Expect = 3.258e-53
Identity = 148/478 (30.96%), Postives = 231/478 (48.33%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYA--STRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKL----RMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV L K K PLGAT+R ++   AV+V RI+ GG A +SGL+  GDEL  VN + +  K  +E+S ILA+  G++   +           +R +    + ++ALF Y P +D  IPC + GL F R ++L V +  DP WWQA R       G     AGLIPS  +Q +R      LS   AA  + +  S R+        K   + + +  G +V  +  + +L   E                  +      P + TYEEV  +  QP  R R +VL+G      H+L + ++A +P+ F +   HTT     H KEG  Y  VSK+ F+   +  +F+E   +++N YG S   ++ ++   K  L+ ++PE+L+ +R + F PY+IF+ P  +I+  RK         +   P D++       A  ID  +G   D+VLV   L  A      +++ L +D  WVP  W+
Sbjct:  135 VKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEE----DRLKES-KVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR------VGDTNLRAGLIPSKGFQERR------LSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRERLGGSQE---------GKMSSGAESPELLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALKQLRTSEFKPYIIFVKP--AIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVLEKLSKDTHWVPVSWV 584          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Match: MPP3 (membrane palmitoylated protein 3 [Source:HGNC Symbol;Acc:HGNC:7221])

HSP 1 Score: 196.823 bits (499), Expect = 4.267e-53
Identity = 148/478 (30.96%), Postives = 231/478 (48.33%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYA--STRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKL----RMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV L K K PLGAT+R ++   AV+V RI+ GG A +SGL+  GDEL  VN + +  K  +E+S ILA+  G++   +           +R +    + ++ALF Y P +D  IPC + GL F R ++L V +  DP WWQA R       G     AGLIPS  +Q +R      LS   AA  + +  S R+        K   + + +  G +V  +  + +L   E                  +      P + TYEEV  +  QP  R R +VL+G      H+L + ++A +P+ F +   HTT     H KEG  Y  VSK+ F+   +  +F+E   +++N YG S   ++ ++   K  L+ ++PE+L+ +R + F PY+IF+ P  +I+  RK         +   P D++       A  ID  +G   D+VLV   L  A      +++ L +D  WVP  W+
Sbjct:  160 VKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEE----DRLKES-KVFMRALFHYNPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR------VGDTNLRAGLIPSKGFQERR------LSYRRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKGHYVAGLRRSFRLGCRERLGGSQE---------GKMSSGAESPELLTYEEVARYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVPHTTRPRKSHEKEGVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALKQLRTSEFKPYIIFVKP--AIQEKRKTPPMSPACEDTAAPFDEQQQEMAASAAFIDRHYGHLVDAVLVKEDLQGAYSQLKVVLEKLSKDTHWVPVSWV 609          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Match: MPP4 (membrane palmitoylated protein 4 [Source:HGNC Symbol;Acc:HGNC:13680])

HSP 1 Score: 182.956 bits (463), Expect = 2.542e-48
Identity = 144/491 (29.33%), Postives = 236/491 (48.07%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEA--XXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDY--QYQREMLKKQLSGNEAAL--NIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXT-YCPADLELNQIDPNISTYEEVQMFIPQPHRK-RPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKI-------RPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQ 2280
            ++IV L K + PLGAT++  +    ++V RI+ GG+A +SGLL  GD+L+ VN + + G D  +V  ILA   GT+ F V  V+D    S         ++++A+  Y P +D  IPC+D GL F +G+IL + +  D  WWQA +  D       A  AGL+PS     + QRE    Q       L   +Y  T         + +K  +  +    ++     + +L   +++    +     T  C + +         + YEEV  +  +P  K R IVL+GP  +G ++L + +I  +P  F     HTT   K     G  Y  VSKE F+ +      +E   ++ + YG S   ++ ++  GK  ++ L+P+ ++ +R     PYVIFI P +++  +++ R   + I       +  D++L    + A  ++  FGQFFD V+V  SL  A    L  I+    +PQWVP+ W+     SQ
Sbjct:  152 MRIVCLVKNQQPLGATIKRHEMTGDILVARIIHGGLAERSGLLYAGDKLVEVNGVSVEGLDPEQVIHILAMSRGTIMFKVVPVSDPPVNSQQ------MVYVRAMTEYWPQEDPDIPCMDAGLPFQKGDILQIVDQNDALWWQARKISDP------ATCAGLVPSNHLLKRKQREFWWSQPYQPHTCLKSTLYEET--------FESDKEEFVGYGQKFFIAGFRRSMRLCRRKSHLSPLHASVCCTGSCYSAVG--------APYEEVVRYQRRPSDKYRLIVLMGPSGVGVNELRRQLIEFNPSHFQSAVPHTTRTKKSYEMNGREYHYVSKETFENLIYSHRMLEYGEYKGHLYGTSVDAVQTVLVEGKICVMDLEPQDIQGVRTHELKPYVIFIKP-SNMRCMKQSRKNAKVITDYYVDMKFKDEDLQEMENLAQRMETQFGQFFDHVIVNDSLHDACAQLLSAIQKAQEEPQWVPATWISSDTESQ 613          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12406131:-1 gene:WBGene00002991.1 transcript:F17E5.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 145.206 bits (365), Expect = 5.580e-36
Identity = 118/479 (24.63%), Postives = 211/479 (44.05%), Query Frame = 1
Query:  865 IKIVVLEK-GKHPLGATVR-NEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAG--------LAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSK----EGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +++V  +K  + P+G T++ NE     V RI+ GG+ H+   L  GDE+  +N + +  + V  + ++L    G V F +         S         I ++A F Y+P  D  IPC   G+ F  G+IL V +  D NWWQA         G+ +         +AGLIPSP+ Q  R                       ++ L ++++K    T  +  W             + +                   +Q+D  + TYEEV M + Q +R++ +VL+G   +GR  +   +I   P +FA    HTT   +    +G +Y  V+ E+        E++E  T E++ YG     ++ I  +GK A+L ++P++L+ +R   + P+V+FI+ P            L+ ++  D  L   ++ ++ +   FG  FD ++    +D  +    ++++ L   PQW+P  W+
Sbjct:  203 LRLVQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIP-------SYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWR-----------------------TACLAMERSKNTCNT--HCMWFNKKKKYYTTKYLQKHSAL---------------FDQLD--LVTYEEV-MRLSQ-YRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAP-----------NLQGMQDPDGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWV 619          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12414037:-1 gene:WBGene00002991.1 transcript:F17E5.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 145.206 bits (365), Expect = 2.538e-35
Identity = 118/479 (24.63%), Postives = 211/479 (44.05%), Query Frame = 1
Query:  865 IKIVVLEKG-KHPLGATVR-NEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAG--------LAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSK----EGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +++V  +K  + P+G T++ NE     V RI+ GG+ H+   L  GDE+  +N + +  + V  + ++L    G V F +         S         I ++A F Y+P  D  IPC   G+ F  G+IL V +  D NWWQA         G+ +         +AGLIPSP+ Q  R                       ++ L ++++K    T  +  W             + +                   +Q+D  + TYEEV M + Q +R++ +VL+G   +GR  +   +I   P +FA    HTT   +    +G +Y  V+ E+        E++E  T E++ YG     ++ I  +GK A+L ++P++L+ +R   + P+V+FI+ P            L+ ++  D  L   ++ ++ +   FG  FD ++    +D  +    ++++ L   PQW+P  W+
Sbjct:  544 LRLVQFQKDTQEPMGITLKVNEDGRCFVARIMHGGMIHRQATLHVGDEIREINGMSVANRSVESLQEMLRDARGQVTFKIIP-------SYRSAPPACEIFVRAQFDYEPSQDDLIPCPQAGIPFKTGDILQVISKDDHNWWQARFVSSFPSIGNSSNAQRSNQQQVAGLIPSPELQEWR-----------------------TACLAMERSKNTCNT--HCMWFNKKKKYYTTKYLQKHSAL---------------FDQLD--LVTYEEV-MRLSQ-YRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAP-----------NLQGMQDPDGSLEKLLNESDVLRQAFGHLFDFIITNSDIDDTIAQLERLVEKLPAYPQWLPVTWV 960          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 129.798 bits (325), Expect = 6.592e-31
Identity = 81/166 (48.80%), Postives = 101/166 (60.84%), Query Frame = 1
Query:  901 LGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGS-MNRPQNGVTI--------HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQ 1371
            LGATVRNE   +IVGR+V GGI  K  L +EGDELL +N   L GK VNE+ DIL  +SG + F VA   +  +    +   N VT         HL+ALF Y P+DD Y+PC ++ + F RG+ILHV N +D NWWQAYR  DG D      LAGLIPS  ++ Q
Sbjct:  246 LGATVRNENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYR--DGEDIQH--SLAGLIPSSSFRQQ 407          

HSP 2 Score: 128.642 bits (322), Expect = 1.719e-30
Identity = 70/211 (33.18%), Postives = 115/211 (54.50%), Query Frame = 1
Query: 1636 TYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRW 2256
            TYEEV + +P+   +RPIVL G E +G   L   ++ SD    A    +T+   KEG     +Y  VSK++F       +F+E   ++K WYG +K ++  +I+ GKT ++ L+ ESL AIR     PY+IFI+ P S+ +LR+ R         DDEL   + ++ +I+  +G  FD ++V    + +     +I+  ++ +P WVP+ W
Sbjct:  456 TYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAP-SLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 129.798 bits (325), Expect = 6.592e-31
Identity = 81/166 (48.80%), Postives = 101/166 (60.84%), Query Frame = 1
Query:  901 LGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGS-MNRPQNGVTI--------HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQ 1371
            LGATVRNE   +IVGR+V GGI  K  L +EGDELL +N   L GK VNE+ DIL  +SG + F VA   +  +    +   N VT         HL+ALF Y P+DD Y+PC ++ + F RG+ILHV N +D NWWQAYR  DG D      LAGLIPS  ++ Q
Sbjct:  246 LGATVRNENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYR--DGEDIQH--SLAGLIPSSSFRQQ 407          

HSP 2 Score: 128.642 bits (322), Expect = 1.719e-30
Identity = 70/211 (33.18%), Postives = 115/211 (54.50%), Query Frame = 1
Query: 1636 TYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRW 2256
            TYEEV + +P+   +RPIVL G E +G   L   ++ SD    A    +T+   KEG     +Y  VSK++F       +F+E   ++K WYG +K ++  +I+ GKT ++ L+ ESL AIR     PY+IFI+ P S+ +LR+ R         DDEL   + ++ +I+  +G  FD ++V    + +     +I+  ++ +P WVP+ W
Sbjct:  456 TYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAP-SLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 665          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 130.568 bits (327), Expect = 8.317e-31
Identity = 81/166 (48.80%), Postives = 101/166 (60.84%), Query Frame = 1
Query:  901 LGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGS-MNRPQNGVTI--------HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQ 1371
            LGATVRNE   +IVGR+V GGI  K  L +EGDELL +N   L GK VNE+ DIL  +SG + F VA   +  +    +   N VT         HL+ALF Y P+DD Y+PC ++ + F RG+ILHV N +D NWWQAYR  DG D      LAGLIPS  ++ Q
Sbjct:  408 LGATVRNENNKIIVGRVVKGGIVEKMNLFQEGDELLELNGSSLKGKQVNEICDILRNLSGPITFVVAPKEEQDTEQPTDTATNTVTAKKSQQHVQHLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYR--DGEDIQH--SLAGLIPSSSFRQQ 569          

HSP 2 Score: 128.642 bits (322), Expect = 3.134e-30
Identity = 70/211 (33.18%), Postives = 115/211 (54.50%), Query Frame = 1
Query: 1636 TYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRW 2256
            TYEEV + +P+   +RPIVL G E +G   L   ++ SD    A    +T+   KEG     +Y  VSK++F       +F+E   ++K WYG +K ++  +I+ GKT ++ L+ ESL AIR     PY+IFI+ P S+ +LR+ R         DDEL   + ++ +I+  +G  FD ++V    + +     +I+  ++ +P WVP+ W
Sbjct:  618 TYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAP-SLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGHLFDGIIVNIDFEKSFRELKQILMKVNTEPMWVPATW 827          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0089975)

HSP 1 Score: 282.337 bits (721), Expect = 5.159e-82
Identity = 175/506 (34.58%), Postives = 282/506 (55.73%), Query Frame = 1
Query:  814 PLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTV-------------ASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIY----ASTRQQSSILCLKKNKRNYQTFNN--GGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDP-NISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            P+  C+    L+D++  I+I+ +EK   PLGATVRNE EAV++GRIV GG A KSGLL EGDE+L VN  EL GK VNEV  +L  + GT+ F +              +     +G     ++   +H++A F Y P+DD YIPC ++G++F +G++LHV + +DPNWWQAYR+ +   +     LAGLIPS  +Q+QRE +K  ++  EA L        S  + +++LC +K ++  +  ++  G  +Y                       +T  P     ++ DP  I TYEEV ++ P+   KRPIVL+GP  IGRH+L + ++A D E+F+    HT+   +EG     +Y  ++++ F+       F+E   +EK +YG S   ++ ++ +GK  +L L P+SL+ +R +   PYV+ ++PP+  +L +K     E  +  ++EL   I  A  ++  +G  FD +++ +  + A    L  I SL+R+PQWVP++W+
Sbjct:  406 PMSACFGT--LNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQT-----LAGLIPSQSFQHQRETMKLAIA-EEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLY-----------------------ATTAP-----DETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA-DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFK--EEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV 872          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0308219)

HSP 1 Score: 282.337 bits (721), Expect = 5.159e-82
Identity = 175/506 (34.58%), Postives = 282/506 (55.73%), Query Frame = 1
Query:  814 PLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTV-------------ASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIY----ASTRQQSSILCLKKNKRNYQTFNN--GGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDP-NISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            P+  C+    L+D++  I+I+ +EK   PLGATVRNE EAV++GRIV GG A KSGLL EGDE+L VN  EL GK VNEV  +L  + GT+ F +              +     +G     ++   +H++A F Y P+DD YIPC ++G++F +G++LHV + +DPNWWQAYR+ +   +     LAGLIPS  +Q+QRE +K  ++  EA L        S  + +++LC +K ++  +  ++  G  +Y                       +T  P     ++ DP  I TYEEV ++ P+   KRPIVL+GP  IGRH+L + ++A D E+F+    HT+   +EG     +Y  ++++ F+       F+E   +EK +YG S   ++ ++ +GK  +L L P+SL+ +R +   PYV+ ++PP+  +L +K     E  +  ++EL   I  A  ++  +G  FD +++ +  + A    L  I SL+R+PQWVP++W+
Sbjct:  406 PMSACFGT--LNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQT-----LAGLIPSQSFQHQRETMKLAIA-EEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLY-----------------------ATTAP-----DETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA-DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFK--EEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV 872          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0100375)

HSP 1 Score: 281.567 bits (719), Expect = 5.942e-82
Identity = 175/506 (34.58%), Postives = 282/506 (55.73%), Query Frame = 1
Query:  814 PLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTV-------------ASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAAL----NIYASTRQQSSILCLKKNKRNYQTFNN--GGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDP-NISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            P+  C+    L+D++  I+I+ +EK   PLGATVRNE EAV++GRIV GG A KSGLL EGDE+L VN  EL GK VNEV  +L  + GT+ F +              +     +G     ++   +H++A F Y P+DD YIPC ++G++F +G++LHV + +DPNWWQAYR+ +   +     LAGLIPS  +Q+QRE +K  ++  EA L        S  + +++LC +K ++  +  ++  G  +Y                       +T  P     ++ DP  I TYEEV ++ P+   KRPIVL+GP  IGRH+L + ++A D E+F+    HT+   +EG     +Y  ++++ F+       F+E   +EK +YG S   ++ ++ +GK  +L L P+SL+ +R +   PYV+ ++PP+  +L +K     E  +  ++EL   I  A  ++  +G  FD +++ +  + A    L  I SL+R+PQWVP++W+
Sbjct:  386 PMSACFGT--LNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQT-----LAGLIPSQSFQHQRETMKLAIA-EEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLY-----------------------ATTAP-----DETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA-DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFK--EEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV 852          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0111034)

HSP 1 Score: 281.182 bits (718), Expect = 2.806e-81
Identity = 175/506 (34.58%), Postives = 282/506 (55.73%), Query Frame = 1
Query:  814 PLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTV-------------ASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAAL----NIYASTRQQSSILCLKKNKRNYQTFNN--GGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDP-NISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            P+  C+    L+D++  I+I+ +EK   PLGATVRNE EAV++GRIV GG A KSGLL EGDE+L VN  EL GK VNEV  +L  + GT+ F +              +     +G     ++   +H++A F Y P+DD YIPC ++G++F +G++LHV + +DPNWWQAYR+ +   +     LAGLIPS  +Q+QRE +K  ++  EA L        S  + +++LC +K ++  +  ++  G  +Y                       +T  P     ++ DP  I TYEEV ++ P+   KRPIVL+GP  IGRH+L + ++A D E+F+    HT+   +EG     +Y  ++++ F+       F+E   +EK +YG S   ++ ++ +GK  +L L P+SL+ +R +   PYV+ ++PP+  +L +K     E  +  ++EL   I  A  ++  +G  FD +++ +  + A    L  I SL+R+PQWVP++W+
Sbjct:  461 PMSACFGT--LNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQT-----LAGLIPSQSFQHQRETMKLAIA-EEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLY-----------------------ATTAP-----DETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA-DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFK--EEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV 927          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0340142)

HSP 1 Score: 281.952 bits (720), Expect = 2.593e-80
Identity = 175/506 (34.58%), Postives = 282/506 (55.73%), Query Frame = 1
Query:  814 PLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTV-------------ASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAAL----NIYASTRQQSSILCLKKNKRNYQTFNN--GGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDP-NISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGG----NYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            P+  C+    L+D++  I+I+ +EK   PLGATVRNE EAV++GRIV GG A KSGLL EGDE+L VN  EL GK VNEV  +L  + GT+ F +              +     +G     ++   +H++A F Y P+DD YIPC ++G++F +G++LHV + +DPNWWQAYR+ +   +     LAGLIPS  +Q+QRE +K  ++  EA L        S  + +++LC +K ++  +  ++  G  +Y                       +T  P     ++ DP  I TYEEV ++ P+   KRPIVL+GP  IGRH+L + ++A D E+F+    HT+   +EG     +Y  ++++ F+       F+E   +EK +YG S   ++ ++ +GK  +L L P+SL+ +R +   PYV+ ++PP+  +L +K     E  +  ++EL   I  A  ++  +G  FD +++ +  + A    L  I SL+R+PQWVP++W+
Sbjct:  700 PMSACFGT--LNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNGQELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSVGVMGGTTGSQLAGLGGAHRDTAVLHVRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQT-----LAGLIPSQSFQHQRETMKLAIA-EEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLY-----------------------ATTAP-----DETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMA-DSERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFK--EEELKDIIATARDMEARWGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWV 1166          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Match: mpp5a (membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) [Source:NCBI gene;Acc:252845])

HSP 1 Score: 289.271 bits (739), Expect = 5.664e-86
Identity = 174/470 (37.02%), Postives = 261/470 (55.53%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK K  PLGATVRN+ ++V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVNEV DILA + G + F +       S     P     +H+KA F Y P DD Y+PC ++GL F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KK K+  +        YN + N    N E                           I TYEE+ ++    +RKRPI L+GP   G+++L + +++++P++FA    HTT    D    G +Y  VS++ F+      +FIE+  FEKN+YG S   ++ +I+ GK  LL +  +SL+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++  +G  FD+ +V   LD + +  L++I  LD +PQWVPS WL
Sbjct:  282 VKIVRIEKAKDIPLGATVRNDMDSVVISRIVKGGAAERSGLLHEGDEILEINGVEIRGKDVNEVFDILADMHGVLSFVLIPSAQIKSP----PIKETVVHVKAHFDYDPSDDPYVPCRELGLCFQKGDILHIISQDDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKTKKKRKKMQ-----YNANKNDDFDNEE---------------------------ILTYEEMALYHQPANRKRPIALIGPPNCGQNELRQRLLSTEPDRFAGPVPHTTRSRRDAEANGRDYHFVSRQAFEMDSAAGKFIESGEFEKNFYGTSTDSVRQVINTGKICLLCVHTQSLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDIIEKAREMEQNYGHLFDAAIVNTDLDKSYQELLRLINKLDTEPQWVPSSWL 702          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Match: mpp5a (membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) [Source:NCBI gene;Acc:252845])

HSP 1 Score: 289.271 bits (739), Expect = 5.664e-86
Identity = 174/470 (37.02%), Postives = 261/470 (55.53%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK K  PLGATVRN+ ++V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVNEV DILA + G + F +       S     P     +H+KA F Y P DD Y+PC ++GL F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KK K+  +        YN + N    N E                           I TYEE+ ++    +RKRPI L+GP   G+++L + +++++P++FA    HTT    D    G +Y  VS++ F+      +FIE+  FEKN+YG S   ++ +I+ GK  LL +  +SL+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++  +G  FD+ +V   LD + +  L++I  LD +PQWVPS WL
Sbjct:  282 VKIVRIEKAKDIPLGATVRNDMDSVVISRIVKGGAAERSGLLHEGDEILEINGVEIRGKDVNEVFDILADMHGVLSFVLIPSAQIKSP----PIKETVVHVKAHFDYDPSDDPYVPCRELGLCFQKGDILHIISQDDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKTKKKRKKMQ-----YNANKNDDFDNEE---------------------------ILTYEEMALYHQPANRKRPIALIGPPNCGQNELRQRLLSTEPDRFAGPVPHTTRSRRDAEANGRDYHFVSRQAFEMDSAAGKFIESGEFEKNFYGTSTDSVRQVINTGKICLLCVHTQSLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDIIEKAREMEQNYGHLFDAAIVNTDLDKSYQELLRLINKLDTEPQWVPSSWL 702          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Match: mpp5a (membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) [Source:NCBI gene;Acc:252845])

HSP 1 Score: 289.271 bits (739), Expect = 5.664e-86
Identity = 174/470 (37.02%), Postives = 261/470 (55.53%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK K  PLGATVRN+ ++V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVNEV DILA + G + F +       S     P     +H+KA F Y P DD Y+PC ++GL F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KK K+  +        YN + N    N E                           I TYEE+ ++    +RKRPI L+GP   G+++L + +++++P++FA    HTT    D    G +Y  VS++ F+      +FIE+  FEKN+YG S   ++ +I+ GK  LL +  +SL+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++  +G  FD+ +V   LD + +  L++I  LD +PQWVPS WL
Sbjct:  282 VKIVRIEKAKDIPLGATVRNDMDSVVISRIVKGGAAERSGLLHEGDEILEINGVEIRGKDVNEVFDILADMHGVLSFVLIPSAQIKSP----PIKETVVHVKAHFDYDPSDDPYVPCRELGLCFQKGDILHIISQDDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKTKKKRKKMQ-----YNANKNDDFDNEE---------------------------ILTYEEMALYHQPANRKRPIALIGPPNCGQNELRQRLLSTEPDRFAGPVPHTTRSRRDAEANGRDYHFVSRQAFEMDSAAGKFIESGEFEKNFYGTSTDSVRQVINTGKICLLCVHTQSLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDIIEKAREMEQNYGHLFDAAIVNTDLDKSYQELLRLINKLDTEPQWVPSSWL 702          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Match: mpp5b (membrane protein, palmitoylated 5b (MAGUK p55 subfamily member 5) [Source:ZFIN;Acc:ZDB-GENE-060531-2])

HSP 1 Score: 254.218 bits (648), Expect = 1.541e-73
Identity = 158/476 (33.19%), Postives = 254/476 (53.36%), Query Frame = 1
Query:  868 KIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRK--------LRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRW 2256
            K+V LEK +  PLG TVRNE++ V++ R+V GG A KS LL EGDE+L +N + + GK VN+V D+L+ + G++ F +   N      ++RP     +H+KA F+Y P +D Y+PC ++GL+F RG+ILHVT+  DPNWWQAYR  +G D      LAGLIP  ++Q  RE +KK ++          +   +  + C  ++K++ +       +YN + N                           +     +I TYEEV ++   P RKRP+ L+GP   G+ +L + +++S+PE+FA    HTT     H   G  Y  VS++ F+   +  +FIE+  +  N YG +   ++ ++++GK  LL LQP SL+ +  +   PY+IFI P                 L   ++K  P D  +   +++A  ++  +G  FD+ +  +  + ++   L II+ LD +PQW+PS W
Sbjct:  212 KLVSLEKIRDIPLGVTVRNEQDCVVISRVVSGGTAEKSNLLSEGDEILEINNIPVRGKTVNDVHDLLSSMYGSLTFLLIP-NSHNKLPLDRP---TVMHVKANFSYDPSEDPYVPCKELGLSFQRGDILHVTSQDDPNWWQAYR--EGHDDQK--PLAGLIPGKNFQQHREAMKKTITDK--------NEEYKGKLWCAIRSKKHRKKL-----LYNPNKN---------------------------IEHYSEDILTYEEVSLYRQPPDRKRPVALIGPANSGQDELRQRLLSSEPERFAAAVPHTTRSPRVHEVNGREYNFVSRQSFESELSAGKFIESGEYGNNLYGTNADSVRQVVNSGKICLLCLQPRSLQVLCSSDLKPYIIFIRPSPPPLSPPPPQERFSTMLARGVKKRMPED--VREMMEKAREMEDSYGHLFDTFITNNEPEKSVCELLSIIQKLDNEPQWIPSAW 637          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Match: mpp4l (membrane protein, palmitoylated 4-like [Source:ZFIN;Acc:ZDB-GENE-091118-7])

HSP 1 Score: 181.8 bits (460), Expect = 1.430e-49
Identity = 146/487 (29.98%), Postives = 218/487 (44.76%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXX--XAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVT-IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKI------RPSDDELVTTI-DRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQ 2280
            ++IV L K   PLGAT+R +     +    V    +A +SGLL  GD L+ VN   + G +  ++  ILA   GT+ F V  + D       RP N  T ++++A+  Y P  D  IPC D G+AF +G+IL + +  D  WWQA +        S +  AGLIPS        +LK+       +   +  T       C+K   R  Q F    +                         S  CPA    +  +P    YE+V  +   P H  R I L+GP  +G ++L + +I  +P+ +     HTT     H + G  Y  VS+E+F  M     FIE      + YGIS   +K ++ +GK  ++ ++P  +R         YVIFI PPT +E +++ RM    I      RP  DE    I D    ++  + QFFD V+V   L +A    L  ++    +PQWVP+ W+  RP  Q
Sbjct:    1 MRIVCLVKNNQPLGATIRRDDVTGEIYIARVIHGGLADRSGLLHAGDRLVEVNGQPVFGLEPEQIIQILAHSHGTIMFKVVPITD-------RPVNNQTMLYVRAMVDYSPQADPSIPCADAGMAFRKGDILEIVDQSDSLWWQAVK------LPSTSACAGLIPS------TSLLKRSQKEFWWSQPYHPHT-------CVKS--RKGQAFGTSQFC------------------------SLRCPASCYSSLSNP----YEDVVRYQHHPEHTHRLIALIGPSGVGVNELRRKLIEINPKVYQGPVPHTTRPPKCHEEAGREYHFVSREQFDSMVCNHRFIEFGELRGHLYGISVDAVKDVLTSGKICVIDIEPYVMRT---PELRAYVIFIKPPT-VEQMKRTRMNSNIITNYYTSRPFRDEDFLEIEDAGRKMEQHYCQFFDHVIVNDGLQAACVQLLTAVRRAQDEPQWVPTSWI--RPTDQ 425          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Match: mpp5 (membrane protein, palmitoylated 5 [Source:NCBI gene;Acc:100145156])

HSP 1 Score: 295.819 bits (756), Expect = 1.995e-88
Identity = 213/639 (33.33%), Postives = 324/639 (50.70%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L +  Q+  FQ+++K+  AV  +      PP     +AQ   ++V   L + H        + + QEL  +L+ P ++AL  A+D+ A                  + ++ P          P S+          EN          G Y        D  +KIV +EK +  PLGATVRN+ ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV ++LA + G + F +     S       P     +H+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++ ++PE+FA    HTT   +E    G +Y  VS++ F    +  +FIE   FEKN YG S   ++ +I++ K  LL L  +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++A  ++   G FFD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  146 SQEDISVLLQLAQNVDFQNAFKIHNAV-AVHMNKTSPPYPLVPNAQDLTQEVQQVLKSSH--------QKEGQELSALLNTPHIQALLLAHDKVA------------------EQEMMPE---------PASDD------YFYENI---------GLYG-------DETVKIVRIEKARDIPLGATVRNDGDSVIISRIVKGGAAEKSGLLHEGDEILQINGMEIRGKDVNEVFELLADMHGNLSFLLIPGQQSKPP----PSKETVVHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQSCGQNELRQRLMTNEPERFAAAVPHTTRSRRENELAGRDYHFVSRQTFDADISAGKFIEFGEFEKNLYGTSIDSVRQVINSSKICLLCLHTQSLKMLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGRNPKPEELREIIEKAREMEQNNGHFFDTAIVNTDLDKAYQELLRLINKLDTEPQWVPSSWL 677          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Match: mpp5 (membrane protein, palmitoylated 5 [Source:NCBI gene;Acc:100145156])

HSP 1 Score: 295.819 bits (756), Expect = 2.063e-88
Identity = 213/639 (33.33%), Postives = 324/639 (50.70%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L +  Q+  FQ+++K+  AV  +      PP     +AQ   ++V   L + H        + + QEL  +L+ P ++AL  A+D+ A                  + ++ P          P S+          EN          G Y        D  +KIV +EK +  PLGATVRN+ ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV ++LA + G + F +     S       P     +H+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++ ++PE+FA    HTT   +E    G +Y  VS++ F    +  +FIE   FEKN YG S   ++ +I++ K  LL L  +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++A  ++   G FFD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISVLLQLAQNVDFQNAFKIHNAV-AVHMNKTSPPYPLVPNAQDLTQEVQQVLKSSH--------QKEGQELSALLNTPHIQALLLAHDKVA------------------EQEMMPE---------PASDD------YFYENI---------GLYG-------DETVKIVRIEKARDIPLGATVRNDGDSVIISRIVKGGAAEKSGLLHEGDEILQINGMEIRGKDVNEVFELLADMHGNLSFLLIPGQQSKPP----PSKETVVHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQSCGQNELRQRLMTNEPERFAAAVPHTTRSRRENELAGRDYHFVSRQTFDADISAGKFIEFGEFEKNLYGTSIDSVRQVINSSKICLLCLHTQSLKMLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGRNPKPEELREIIEKAREMEQNNGHFFDTAIVNTDLDKAYQELLRLINKLDTEPQWVPSSWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Match: mpp5 (membrane protein, palmitoylated 5 [Source:NCBI gene;Acc:100145156])

HSP 1 Score: 294.664 bits (753), Expect = 7.711e-88
Identity = 213/639 (33.33%), Postives = 324/639 (50.70%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L +  Q+  FQ+++K+  AV  +      PP     +AQ   ++V   L + H        + + QEL  +L+ P ++AL  A+D+ A                  + ++ P          P S+          EN          G Y        D  +KIV +EK +  PLGATVRN+ ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV ++LA + G + F +     S       P     +H+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++ ++PE+FA    HTT   +E    G +Y  VS++ F    +  +FIE   FEKN YG S   ++ +I++ K  LL L  +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++A  ++   G FFD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  170 SQEDISVLLQLAQNVDFQNAFKIHNAV-AVHMNKTSPPYPLVPNAQDLTQEVQQVLKSSH--------QKEGQELSALLNTPHIQALLLAHDKVA------------------EQEMMPE---------PASDD------YFYENI---------GLYG-------DETVKIVRIEKARDIPLGATVRNDGDSVIISRIVKGGAAEKSGLLHEGDEILQINGMEIRGKDVNEVFELLADMHGNLSFLLIPGQQSKPP----PSKETVVHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQSCGQNELRQRLMTNEPERFAAAVPHTTRSRRENELAGRDYHFVSRQTFDADISAGKFIEFGEFEKNLYGTSIDSVRQVINSSKICLLCLHTQSLKMLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGRNPKPEELREIIEKAREMEQNNGHFFDTAIVNTDLDKAYQELLRLINKLDTEPQWVPSSWL 701          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Match: mpp5 (membrane protein, palmitoylated 5 [Source:NCBI gene;Acc:100145156])

HSP 1 Score: 290.812 bits (743), Expect = 8.471e-87
Identity = 180/473 (38.05%), Postives = 266/473 (56.24%), Query Frame = 1
Query:  856 DIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            D  +KIV +EK +  PLGATVRN+ ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV ++LA + G + F +     S       P     +H+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++ ++PE+FA    HTT   +E    G +Y  VS++ F    +  +FIE   FEKN YG S   ++ +I++ K  LL L  +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++A  ++   G FFD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  225 DETVKIVRIEKARDIPLGATVRNDGDSVIISRIVKGGAAEKSGLLHEGDEILQINGMEIRGKDVNEVFELLADMHGNLSFLLIPGQQSKPP----PSKETVVHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQSCGQNELRQRLMTNEPERFAAAVPHTTRSRRENELAGRDYHFVSRQTFDADISAGKFIEFGEFEKNLYGTSIDSVRQVINSSKICLLCLHTQSLKMLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGRNPKPEELREIIEKAREMEQNNGHFFDTAIVNTDLDKAYQELLRLINKLDTEPQWVPSSWL 648          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Match: pex13 (peroxisomal biogenesis factor 13 [Source:Xenbase;Acc:XB-GENE-1013577])

HSP 1 Score: 201.06 bits (510), Expect = 4.926e-55
Identity = 149/484 (30.79%), Postives = 240/484 (49.59%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNE--AALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRK-RPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKI---------RP-SDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KI+ L K + PLGAT++ +++  A++V RI+ GG A +SGL+  GDEL  VN + +  K   E+  ILA+  G + F +       S     P N   + +KALF Y P++D  IPC + GL+F +G+IL + +  D  WWQA  + D          AGLIPS  +Q +R  L+K +  N+     N  +S  ++S  L  K  K N        ++Y    + +                  Y  AD         + TYEEV ++  +P+ K R ++LVGP  +G ++L + ++  + + + +   HTT        +G  Y  +SK  F+   +  +FIE   ++ N+YG S   ++ ++   K  LL +QP SL+ +R + F P+VIFI PPT IE LR+ R   + I         +P SD++    I  A A++  +  FFD+ +V   L +A       ++ L+ +  WVP  WL
Sbjct:  117 VKIIRLVKNREPLGATIKKDEKTGAIVVARIMRGGAADRSGLIHVGDELREVNGISVEDKKPEEIIHILAQSQGAITFKIIP-----SIKEEPPNNDGKMFVKALFDYYPNEDKAIPCKEAGLSFRKGDILQIMSQDDATWWQAKHEGDANPR------AGLIPSKQFQERRFALRKPVVSNQPQKVPNRKSSGFRRSFRLSRKDRKTN-------KFMYECKKSDQ------------------YDTAD---------VPTYEEVALYQRKPNEKYRLVILVGPVGVGVNELKRKVLIGNSQHYGVTVPHTTRGKRSQENDGVEYIFISKHLFETDIHNNKFIEYGEYKNNYYGTSLDSVRSVLAKNKICLLDVQPNSLKHLRTSEFKPFVIFIKPPT-IERLRETRRNAKVISGKDERGAAKPFSDEDFEEMIQSAEAMEAQYDHFFDTTIVNDDLSAAYNELRSTLERLEMEGFWVPVSWL 554          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Match: Mpp5 (membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) [Source:MGI Symbol;Acc:MGI:1927339])

HSP 1 Score: 295.434 bits (755), Expect = 2.064e-88
Identity = 208/639 (32.55%), Postives = 322/639 (50.39%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  AV  +      PP    ++ Q  +++V   L   H        + + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    DH   G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNRDFQNAFKIHNAV-TVHMSKASPPFPLIANVQDLVQEVQTVLKPVH--------QKEGQELTALLNAPHIQALLLAHDKVAEQEMQLE---------------------------PITDERVYESI---------------GHYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Match: Mpp3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) [Source:MGI Symbol;Acc:MGI:1328354])

HSP 1 Score: 204.142 bits (518), Expect = 5.549e-56
Identity = 152/483 (31.47%), Postives = 236/483 (48.86%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVN---DSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDR--------ANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV L K K PLGAT+R ++   AV+V RI+ GG A +SGL+  GDEL  VN + +  K  +E+S ILA+  G++   +       D +  S         + ++ALF Y P +D  IPC + GL F R ++L V +  DP WWQA R       G     AGLIPS  +Q +R   ++      +  N       Q       K   +   +  G +V  +  + +L   E        K      P   E +Q+   + TYEEV  +  QP  R R +VL+G      H+L + ++A DP+QFA+   HTT     H ++G  Y  VSK+ F+   +  +F+E   +++N YG S   ++ ++   K  L+ ++PE+LR +R   F PYVIF+ P  +I+  RK       + P  +++ +++D         A  ID  +G   D+VLV   L  A      +I++L +D  WVP  W+
Sbjct:  135 VKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDS--------KVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR------VGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPC----DKETCDCDGYFKGHYVAGLRRSFRLGCRERLGGSQEAK-----VPTGAE-SQV---LLTYEEVARYQHQPGERPRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKP--AIQERRK----TPPVSPDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEACSQLRAVIETLSKDTSWVPISWV 584          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Match: Mpp3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) [Source:MGI Symbol;Acc:MGI:1328354])

HSP 1 Score: 204.142 bits (518), Expect = 5.549e-56
Identity = 152/483 (31.47%), Postives = 236/483 (48.86%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVN---DSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDR--------ANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV L K K PLGAT+R ++   AV+V RI+ GG A +SGL+  GDEL  VN + +  K  +E+S ILA+  G++   +       D +  S         + ++ALF Y P +D  IPC + GL F R ++L V +  DP WWQA R       G     AGLIPS  +Q +R   ++      +  N       Q       K   +   +  G +V  +  + +L   E        K      P   E +Q+   + TYEEV  +  QP  R R +VL+G      H+L + ++A DP+QFA+   HTT     H ++G  Y  VSK+ F+   +  +F+E   +++N YG S   ++ ++   K  L+ ++PE+LR +R   F PYVIF+ P  +I+  RK       + P  +++ +++D         A  ID  +G   D+VLV   L  A      +I++L +D  WVP  W+
Sbjct:  135 VKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDS--------KVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR------VGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPC----DKETCDCDGYFKGHYVAGLRRSFRLGCRERLGGSQEAK-----VPTGAE-SQV---LLTYEEVARYQHQPGERPRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKP--AIQERRK----TPPVSPDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEACSQLRAVIETLSKDTSWVPISWV 584          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Match: Mpp3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) [Source:MGI Symbol;Acc:MGI:1328354])

HSP 1 Score: 204.142 bits (518), Expect = 5.549e-56
Identity = 152/483 (31.47%), Postives = 236/483 (48.86%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVN---DSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQP-HRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDR--------ANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV L K K PLGAT+R ++   AV+V RI+ GG A +SGL+  GDEL  VN + +  K  +E+S ILA+  G++   +       D +  S         + ++ALF Y P +D  IPC + GL F R ++L V +  DP WWQA R       G     AGLIPS  +Q +R   ++      +  N       Q       K   +   +  G +V  +  + +L   E        K      P   E +Q+   + TYEEV  +  QP  R R +VL+G      H+L + ++A DP+QFA+   HTT     H ++G  Y  VSK+ F+   +  +F+E   +++N YG S   ++ ++   K  L+ ++PE+LR +R   F PYVIF+ P  +I+  RK       + P  +++ +++D         A  ID  +G   D+VLV   L  A      +I++L +D  WVP  W+
Sbjct:  135 VKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVGDELREVNGIAVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKDS--------KVFMRALFHYDPREDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKR------VGDTNLRAGLIPSKQFQERRLSYRRTTGTLPSPQNFKKPPYDQPC----DKETCDCDGYFKGHYVAGLRRSFRLGCRERLGGSQEAK-----VPTGAE-SQV---LLTYEEVARYQHQPGERPRLVVLIGSLGAHLHELKQRVVAEDPQQFAVAVPHTTRPRKSHERDGVEYHFVSKQAFEADVHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCLVDVEPEALRHLRTPEFKPYVIFVKP--AIQERRK----TPPVSPDSEDIASSLDEQQQEMAASAAFIDQHYGHLIDTVLVRQDLQEACSQLRAVIETLSKDTSWVPISWV 584          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Match: Mpp7 (membrane protein, palmitoylated 7 (MAGUK p55 subfamily member 7) [Source:MGI Symbol;Acc:MGI:1922989])

HSP 1 Score: 194.512 bits (493), Expect = 9.302e-53
Identity = 146/490 (29.80%), Postives = 227/490 (46.33%), Query Frame = 1
Query:  844 LSDRDIPIKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKK-QLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRK-RPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDE----------LVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            + D +  +KI+ L K   PLGAT++ +++  A+ V RI+ GG A +SGL+  GDEL  VN + +  K   E+  IL++  G + F +       S     P     I +KALF Y P +D  IPC + GL+F +G+IL + +  D  WWQA  + D          AGLIPS  +Q +R  L++ ++      L+   S+  + S    +KNK+  ++          DT                                  ++ TYEEV  +  Q H K R IVLVGP  +G ++L + ++ SD + + ++  HTT        +G  Y  +SK  F+      +FIE   ++ N+YG S   ++ ++   K  LL +QP +++ +R   F PYVIFI PP SIE LR+ R   + I   DD+              I  A  ++  +G  FD +++   L  A          L+ D  WVP  WL
Sbjct:  130 IDDEEDSVKIIRLVKNSEPLGATIKKDEQTGAITVARIMRGGAADRSGLIHVGDELREVNGIPVEDKRPEEIIKILSQSKGAITFKIIP-----STKEETPSKEGKIFIKALFDYDPKEDKAIPCKEAGLSFRKGDILQIMSQDDVTWWQAKHEGDANPR------AGLIPSKHFQERRLALRRPEIVVQPLKLSNTKSSGFRRSFRLSRKNKKINKSMYECKKSEQYDT---------------------------------ADVPTYEEVTPYRRQIHDKYRLIVLVGPVGVGLNELKRKLLMSDAQHYGVIVPHTTRARRSQESDGVEYIFISKHLFETDVQNNKFIEYGEYKNNYYGTSIDSVRSVLAKNKVCLLDVQPHTVKHLRTLEFKPYVIFIKPP-SIERLRETRKNAKIISSRDDQGTAKPFTEEDFQEMIKSAQIMESQYGHLFDKIIINDDLTVAFNELKTTFDKLETDTHWVPVSWL 574          
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Match: sp|Q5RDQ2|MPP5_PONAB (MAGUK p55 subfamily member 5 OS=Pongo abelii OX=9601 GN=MPP5 PE=2 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 4.441e-89
Identity = 212/639 (33.18%), Postives = 325/639 (50.86%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+ GFQ+++K+  A+  +      PP    S+AQ   ++V   L       K  H+K + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                      Y  I     +  +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+LA + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    D    G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNKGFQNAFKIHNAI-TVHMNKASPPFPLISNAQDLAQEVQTVL-------KPVHHK-EGQELTALLNTPHIQALLLAHDKVAEQEMQLE---------------------------PITDER---------------------VYESIGQYGGET-VKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLADMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Match: sp|E2QY99|MPP5_CANLF (MAGUK p55 subfamily member 5 OS=Canis lupus familiaris OX=9615 GN=MPP5 PE=3 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 2.495e-88
Identity = 212/639 (33.18%), Postives = 323/639 (50.55%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  AV  +      PP    S+AQ   ++V   L       K  H+K + QEL  +LS P ++AL  A+D+ A     +E                           P +++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILH+ + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    DH   G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNKDFQNAFKIHNAV-TVHMNKASPPFPLISNAQDLAQEVQTVL-------KPVHHK-EGQELTALLSAPHVQALLLAHDKVAEQEMQLE---------------------------PFTDERVYESI---------------GQYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHIISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSSWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Match: sp|Q9JLB2|MPP5_MOUSE (MAGUK p55 subfamily member 5 OS=Mus musculus OX=10090 GN=Mpp5 PE=1 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 1.444e-87
Identity = 208/639 (32.55%), Postives = 322/639 (50.39%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  AV  +      PP    ++ Q  +++V   L   H        + + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    DH   G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNRDFQNAFKIHNAV-TVHMSKASPPFPLIANVQDLVQEVQTVLKPVH--------QKEGQELTALLNAPHIQALLLAHDKVAEQEMQLE---------------------------PITDERVYESI---------------GHYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Match: sp|Q8N3R9|MPP5_HUMAN (MAGUK p55 subfamily member 5 OS=Homo sapiens OX=9606 GN=MPP5 PE=1 SV=3)

HSP 1 Score: 295.049 bits (754), Expect = 1.812e-87
Identity = 210/639 (32.86%), Postives = 323/639 (50.55%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  A+  +      PP    S+AQ   ++V   L       K  H+K + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    D    G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNKDFQNAFKIHNAI-TVHMNKASPPFPLISNAQDLAQEVQTVL-------KPVHHK-EGQELTALLNTPHIQALLLAHDKVAEQEMQLE---------------------------PITDERVYESI---------------GQYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Match: sp|B4F7E7|MPP5_RAT (MAGUK p55 subfamily member 5 OS=Rattus norvegicus OX=10116 GN=Mpp5 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.138e-87
Identity = 208/639 (32.55%), Postives = 322/639 (50.39%), Query Frame = 1
Query:  358 SKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            S+ D+  L + +Q+  FQ+++K+  AV  +      PP    ++ Q  +++V   L   H        + + QEL  +L+ P ++AL  A+D+ A     +E                           P++++R                    G Y           +KIV +EK +  PLGATVRNE ++VI+ RIV GG A KSGLL EGDE+L +N +E+ GKDVNEV D+L+ + GT+ F +             P     IH+KA F Y P DD Y+PC ++GL+F +G+ILHV + +DPNWWQAYR+ D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI+L+GP+  G+++L + ++  + ++FA    HTT    DH   G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  LL L+ +SL+ +R +   PY+IFI+PP+  E LR L +  E   P  +EL   I++   ++   G +FD+ +V   LD A +  L++I  LD +PQWVPS WL
Sbjct:  143 SQEDISLLLQLVQNRDFQNAFKIHNAV-TVHMNKASPPFPLIANVQDLVQEVQTVLKPVH--------QKEGQELTALLNAPHIQALLLAHDKVAEQEMQLE---------------------------PITDERVYESI---------------GHYG-------GETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPP----PAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKV-----LYNANKNDDYDNEE---------------------------ILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRNRRDHEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRAQSLKTLRNSDLKPYIIFIAPPSQ-ERLRAL-LAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWL 674          
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Match: V5IGJ8 (Putative calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.269e-94
Identity = 187/469 (39.87%), Postives = 276/469 (58.85%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            IKIV ++K   PLGATVRNE E+VI+GRIV GG A KSGLL EGDE+L VN + + GK VNEV D+LA ++GT+ F +            R  +   IH+KA F Y+P++D YIPC ++G+ F +G++LHV N  DPNWWQAYR  +   +     LAGLIPS  +Q QRE +K+ L+G +AA      T++ +  LC KK+ +  +   +G       T G +   E                      +    + TYEEV +F P+P+ KRP+VLVGP  IGRH+L + ++  D E+FA    HT+    D   +G +Y  +S+ +F+      +F+E   +E+N+YG S   ++ ++ +GK  +L L P+SL+ ++ +   PYV+F++PP S+E LR+ RM  + +   +DEL  TI+RA  ++  +G +FD V+V   LD A    LK +  L+R+PQWVPS WL
Sbjct:    5 IKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEVLEVNGIGMRGKSVNEVCDLLATMTGTLTFLIVPCGHEVIAP--RSTDTGMIHVKAHFDYEPEEDPYIPCRELGIPFQKGDVLHVINRDDPNWWQAYRQGEEDQT-----LAGLIPSKSFQQQREAMKQALAGGDAATK--EKTKRAAKFLCAKKHHKKKKKKTSG-------TPGLITGEEP---------------------ETGEPVPTYEEVSLFYPRPNCKRPVVLVGPSNIGRHELRQKLM-EDTERFAAAVPHTSRPRKDSELDGLDYHFISRPQFEADILAGKFVEHGEYERNYYGTSLGAIRSVVGSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPP-SLEKLRQHRMR-QGVPVREDELRETIERARQMEDSYGHYFDMVIVNSDLDRAYSELLKEVAILEREPQWVPSAWL 433          
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Match: L7MFE5 (Putative calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 3.285e-91
Identity = 221/640 (34.53%), Postives = 340/640 (53.12%), Query Frame = 1
Query:  370 LDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRI--IKSPLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLP-NTEXXXXXXXXXXXXTYCP---ADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            L  +   ++  GFQ +  +S  VQ+   CY  PP    S+AQ   ++V + L    L         +  +L   LS  D++ L  ++D+ A         R   +        +P  P  A        +     S  SE++++I  I    E   A +        IKIV ++K   PLGATVRNE E+VI+GRIV GG A KSGLL EGDE+L VN + + GK VNEV D+LA ++GT+ F +   N        R  +   IH+KA F Y+PD+D YIPC ++G+ F +G++LHV N  DPNWWQAYR  +   +     LAGLIPS  +Q QRE +K+ L+G +A         ++   LC KK+ +  +  + G         G L  ++E N      ++ S Y P       +  + P+    EEV ++ P+P+ KRP+VLVGP  IGRH+L + ++  D E+FA    HT+    D   +G +Y  +S+ +F+      +F+E   +E+N+YG S   ++ ++++GK  +L L P+SL+ ++ +   PYV+F++PP S+E LR+ R   + +   ++EL  TI+RA  ++  +G +FD V+V   LD A    LK +  L+ +PQWVPS WL
Sbjct:   16 LACVANLLKEPGFQGALAVSNNVQQAW-CYQRPPTPVCSNAQDLAQEVLSLLEGCPLA--------EAMQLQDFLSRLDVDGLLLSHDRIAA--------RCGASPRLAH---SPPGPGGAH-------EALDRASHYSEDSIKIVHIDKTNEPLGATVRNEGXXDSIKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEILEVNGIGMRGKSVNEVCDLLATMTGTLTFLIVPCNQET--ITPRSTDTGIIHVKAHFDYEPDEDLYIPCRELGIPFQKGDVLHVINRDDPNWWQAYRQGEEDQT-----LAGLIPSKSFQQQREAMKQALAGGDAG---SKEKTKRGKFLCAKKHHKKKKKKSGG-------MTGTLGDDSEANEPVPTYEEVSLYYPRPNCKRPVVLVGPSXXXXEEVSLYYPRPNCKRPVVLVGPSNIGRHELRQKLM-EDTERFAAAVPHTSRPRKDSEIDGVDYHFISRPQFEADILAGKFVEHGEYERNYYGTSLDAIRSVVNSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPP-SLEKLRQHRAR-QGVPVREEELRETIERARQMEETYGHYFDMVIVNSDLDRAYSELLKEVGILEEEPQWVPSAWL 608          
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Match: A0A4D5RIY0 (Putative calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase (Fragment) OS=Ixodes scapularis OX=6945 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 1.254e-90
Identity = 187/469 (39.87%), Postives = 276/469 (58.85%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            IKIV ++K   PLGATVRNE E+VI+GRIV GG A KSGLL EGDE+L VN + + GK VNEV D+LA ++GT+ F +            R  +   IH+KA F Y+P++D YIPC ++G+ F +G++LHV N  DPNWWQAYR  +   +     LAGLIPS  +Q QRE +K+ L+G +AA      T++ +  LC KK+ +  +   +G       T G +   E                      +    + TYEEV +F P+P+ KRP+VLVGP  IGRH+L + ++  D E+FA    HT+    D   +G +Y  +S+ +F+      +F+E   +E+N+YG S   ++ ++ +GK  +L L P+SL+ ++ +   PYV+F++PP S+E LR+ RM  + +   +DEL  TI+RA  ++  +G +FD V+V   LD A    LK +  L+R+PQWVPS WL
Sbjct:  439 IKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEVLEVNGIGMRGKSVNEVCDLLATMTGTLTFLIVPCGHEVIAP--RSTDTGMIHVKAHFDYEPEEDPYIPCRELGIPFQKGDVLHVINRDDPNWWQAYRQGEEDQT-----LAGLIPSKSFQQQREAMKQALAGGDAATK--EKTKRAAKFLCAKKHHKKKKKKTSG-------TPGLITGEEP---------------------ETGEPVPTYEEVSLFYPRPNCKRPVVLVGPSNIGRHELRQKLM-EDTERFAAAVPHTSRPRKDSELDGLDYHFISRPQFEADILAGKFVEHGEYERNYYGTSLGAIRSVVGSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPP-SLEKLRQHRMR-QGVPVREDELRETIERARQMEDSYGHYFDMVIVNSDLDRAYSELLKEVAILEREPQWVPSAWL 867          
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Match: A0A131Y0C0 (Putative calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 1.863e-90
Identity = 188/469 (40.09%), Postives = 278/469 (59.28%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            IKIV ++K   PLGATVRNE E+VI+GRIV GG A KSGLL EGDE+L VN + + GK VNEV D+LA ++GT+ F +  V   +     R  +   IH+KA F Y+P++D YIPC ++G+ F +G++LHV N  DPNWWQAYR  +   +     LAGLIPS  +Q QRE +K+ L+G +AA      T++ +  LC KK+ +  +   +G       T G +   E                      +    + TYEEV +F P+P+ KRP+VLVGP  IGRH+L + ++  D E+FA    HT+    D   +G +Y  +S+ +F+      +F+E   +E+N+YG S   ++ ++ +GK  +L L P+SL+ ++ +   PYV+F++PP S+E LR+ RM  + +   +DEL  TI+RA  ++  +G +FD V+V   LD A    LK +  L+R+PQWVPS WL
Sbjct:  426 IKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEVLEVNGIGMRGKSVNEVCDLLATMTGTLTFLI--VPCGHEVIAPRSTDTGMIHVKAHFDYEPEEDPYIPCRELGIPFQKGDVLHVINRDDPNWWQAYRQGEEDQT-----LAGLIPSKSFQQQREAMKQALAGGDAATK--EKTKRAAKFLCAKKHHKKKKKKTSG-------TPGLITGDEP---------------------ETGEPVPTYEEVSLFYPRPNCKRPVVLVGPSNIGRHELRQKLM-EDTERFAAAVPHTSRPRKDSELDGLDYHFISRPQFEADILAGKFVEHGEYERNYYGTSLGAIRSVVGSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPP-SLEKLRQHRMR-QGVPVREDELRETIERARQMEDSYGHYFDMVIVNSDLDRAYSELLKEVAILEREPQWVPSAWL 854          
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Match: A0A224Z1B0 (MAGUK p55 subfamily member 5 OS=Rhipicephalus zambeziensis OX=60191 PE=3 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.953e-89
Identity = 187/469 (39.87%), Postives = 276/469 (58.85%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            IKIV ++K   PLGATVRNE E+VI+GRIV GG A KSGLL EGDE+L VN + + GK VNEV D+LA ++GT+ F +   N        R  +   IH+KA F Y+PD+D YIPC ++G+ F +G++LHV N  DPNWWQAYR  +   +     LAGLIPS  +Q QRE +K+ L+G +A         ++   LC KK+ +  +  +         T G L +                   D E N+  P   TYEEV ++ P+P+ KRP+VLVGP  IGRH+L + ++  D E+FA    HT+    D   +G +Y  +S+ +F+      +F+E   +E+N+YG S   ++ ++++GK  +L L P+SL+ ++ +   PYV+F++PP S+E LR+ R   + +   ++EL  TI+RA  ++  +G +FD V+V   LD A    LK +  L+R+PQWVPS WL
Sbjct:  388 IKIVHIDKTNEPLGATVRNEGESVIIGRIVKGGAAEKSGLLHEGDEILEVNGIGMRGKSVNEVCDLLATMTGTLTFLIVPCNQET--ITPRTTDTGMIHVKAHFDYEPDEDLYIPCRELGIPFQKGDVLHVINRDDPNWWQAYRQGEEDQT-----LAGLIPSKSFQQQREAMKQALAGGDAG---SKEKTKRGKFLCAKKHHKKKKKKSGA-------TTGTLGD-------------------DSEANEPVP---TYEEVSLYYPRPNCKRPVVLVGPSNIGRHELRQKLM-EDTERFAAAVPHTSRPRKDSEIDGVDYHFISRPQFEADILAGKFVEHGEYERNYYGTSLDAIRSVVNSGKVCVLNLHPQSLKMLKHSDLKPYVVFVAPP-SLEKLRQHRAR-QGVPVREEELRETIERARQMEETYGHYFDMVIVNSDLDRAYSELLKEVAILEREPQWVPSAWL 814          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Match: mpp5a (MAGUK p55 subfamily member 5-A [Source:NCBI gene;Acc:103043088])

HSP 1 Score: 287.73 bits (735), Expect = 2.931e-85
Identity = 177/470 (37.66%), Postives = 262/470 (55.74%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK K  PLGATVRN+ ++VI+ RIV GG A +SGLL EGDE+L +N +E+ GKDVNEV DILA + GT+ F +     +       P     +H+KA F Y P DD Y+PC ++GL F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI L+GP   G+++L + ++++DP++F     HTT    D    G +Y  VS++ F+      +FIE+  FEKN YG S   ++ +I++GK  LL L  +SL+ +R +   PY+IFI+PP S E LR L +  +   P  +EL   I++A  ++  FG  FD+ +V    + A +  +++I  LD +PQWVPS WL
Sbjct:  292 VKIVRIEKAKDIPLGATVRNDMDSVIISRIVKGGAAERSGLLHEGDEVLEINGVEIRGKDVNEVFDILAEMHGTLTFILIPSQQTKP----PPIKETVVHVKAHFDYDPSDDPYVPCRELGLCFQKGDILHIISQDDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKL-----LYNANKNDDYDNEE---------------------------ILTYEEMALYHQPANRKRPIALIGPPNCGQNELRQRLLSNDPDRFGGAVPHTTRSRRDGEVNGRDYHFVSRQAFEVDAAAGKFIESGEFEKNLYGTSTDSVRQLINSGKICLLCLHTQSLKVLRSSDLKPYIIFIAPP-SQERLRAL-LAKDNKNPKPEELRDIIEKAREMEQNFGHLFDAAIVNTDQEKAYQELVRLIDKLDTEPQWVPSSWL 712          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Match: mpp5b (membrane palmitoylated protein 5 [Source:NCBI gene;Acc:103036100])

HSP 1 Score: 258.07 bits (658), Expect = 3.455e-75
Identity = 171/471 (36.31%), Postives = 248/471 (52.65%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTI-HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +K+V LEK +  PLGATVRNE + V+V R+V GG A +SGLL EGDE+L +N + + GK++NEV DIL+ + G + F +       S     P +  T+ H++A F+Y P DD Y+PC ++GLAF +G+ILHV +  DPNWWQAY+D D  +      LAGLIP   +Q QRE LKK  +                                      N D  GKL  T+  ++   K     Y P+   +     ++ TYEE+ ++    +RKRPI L+GP   G  DL + +++ +P +FA    HTT     H   G  Y  VS+  F+      +FIE   +E+N YG S   ++ + +AG+  LL L   SL  +R +   PYVIFI+PP   +L   L    + ++  D + VT   +A  ++  +G  FD+V+V    D A    L++I+ LD  PQWVPS WL
Sbjct:  212 VKLVRLEKARDIPLGATVRNEHDCVMVSRVVKGGAADRSGLLIEGDEILEINGIPVRGKNINEVHDILSDMHGPLTFLLIP-----SSRHKAPAHRQTVMHVRANFSYDPADDPYLPCRELGLAFQKGDILHVLSQDDPNWWQAYKDGDDDNQ----RLAGLIPGKSFQQQRETLKKTTTER------------------------------------NPDNPGKLWYTKKIKKPRKKSF---YNPSR-NVESYTEDVLTYEEMTLYHQAGNRKRPIALIGPAHSGHDDLRQRLLSVEPGRFAGAVPHTTRSPRAHELNGREYHFVSRSNFEADVAAGKFIEYGEYERNLYGTSVDSVRQVANAGRICLLSLHTRSLCVLRSSNLKPYVIFIAPPPPDQLRTLLSKEGKNLQSEDLKEVT--QKAREMEQNYGHLFDAVVVNSDEDMAFFQLLRLIEKLDTQPQWVPSSWL 631          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Match: mpp5b (membrane palmitoylated protein 5 [Source:NCBI gene;Acc:103036100])

HSP 1 Score: 258.07 bits (658), Expect = 6.947e-75
Identity = 171/471 (36.31%), Postives = 248/471 (52.65%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTI-HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +K+V LEK +  PLGATVRNE + V+V R+V GG A +SGLL EGDE+L +N + + GK++NEV DIL+ + G + F +       S     P +  T+ H++A F+Y P DD Y+PC ++GLAF +G+ILHV +  DPNWWQAY+D D  +      LAGLIP   +Q QRE LKK  +                                      N D  GKL  T+  ++   K     Y P+   +     ++ TYEE+ ++    +RKRPI L+GP   G  DL + +++ +P +FA    HTT     H   G  Y  VS+  F+      +FIE   +E+N YG S   ++ + +AG+  LL L   SL  +R +   PYVIFI+PP   +L   L    + ++  D + VT   +A  ++  +G  FD+V+V    D A    L++I+ LD  PQWVPS WL
Sbjct:  238 VKLVRLEKARDIPLGATVRNEHDCVMVSRVVKGGAADRSGLLIEGDEILEINGIPVRGKNINEVHDILSDMHGPLTFLLIP-----SSRHKAPAHRQTVMHVRANFSYDPADDPYLPCRELGLAFQKGDILHVLSQDDPNWWQAYKDGDDDNQ----RLAGLIPGKSFQQQRETLKKTTTER------------------------------------NPDNPGKLWYTKKIKKPRKKSF---YNPSR-NVESYTEDVLTYEEMTLYHQAGNRKRPIALIGPAHSGHDDLRQRLLSVEPGRFAGAVPHTTRSPRAHELNGREYHFVSRSNFEADVAAGKFIEYGEYERNLYGTSVDSVRQVANAGRICLLSLHTRSLCVLRSSNLKPYVIFIAPPPPDQLRTLLSKEGKNLQSEDLKEVT--QKAREMEQNYGHLFDAVVVNSDEDMAFFQLLRLIEKLDTQPQWVPSSWL 657          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Match: mpp5b (membrane palmitoylated protein 5 [Source:NCBI gene;Acc:103036100])

HSP 1 Score: 258.07 bits (658), Expect = 6.947e-75
Identity = 171/471 (36.31%), Postives = 248/471 (52.65%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTI-HLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +K+V LEK +  PLGATVRNE + V+V R+V GG A +SGLL EGDE+L +N + + GK++NEV DIL+ + G + F +       S     P +  T+ H++A F+Y P DD Y+PC ++GLAF +G+ILHV +  DPNWWQAY+D D  +      LAGLIP   +Q QRE LKK  +                                      N D  GKL  T+  ++   K     Y P+   +     ++ TYEE+ ++    +RKRPI L+GP   G  DL + +++ +P +FA    HTT     H   G  Y  VS+  F+      +FIE   +E+N YG S   ++ + +AG+  LL L   SL  +R +   PYVIFI+PP   +L   L    + ++  D + VT   +A  ++  +G  FD+V+V    D A    L++I+ LD  PQWVPS WL
Sbjct:  238 VKLVRLEKARDIPLGATVRNEHDCVMVSRVVKGGAADRSGLLIEGDEILEINGIPVRGKNINEVHDILSDMHGPLTFLLIP-----SSRHKAPAHRQTVMHVRANFSYDPADDPYLPCRELGLAFQKGDILHVLSQDDPNWWQAYKDGDDDNQ----RLAGLIPGKSFQQQRETLKKTTTER------------------------------------NPDNPGKLWYTKKIKKPRKKSF---YNPSR-NVESYTEDVLTYEEMTLYHQAGNRKRPIALIGPAHSGHDDLRQRLLSVEPGRFAGAVPHTTRSPRAHELNGREYHFVSRSNFEADVAAGKFIEYGEYERNLYGTSVDSVRQVANAGRICLLSLHTRSLCVLRSSNLKPYVIFIAPPPPDQLRTLLSKEGKNLQSEDLKEVT--QKAREMEQNYGHLFDAVVVNSDEDMAFFQLLRLIEKLDTQPQWVPSSWL 657          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Match: mpp5a (MAGUK p55 subfamily member 5-A [Source:NCBI gene;Acc:103043088])

HSP 1 Score: 244.973 bits (624), Expect = 4.879e-70
Identity = 155/403 (38.46%), Postives = 225/403 (55.83%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKL 2058
            +KIV +EK K  PLGATVRN+ ++VI+ RIV GG A +SGLL EGDE+L +N +E+ GKDVNEV DILA + GT+ F +     +       P     +H+KA F Y P DD Y+PC ++GL F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNK+  +       +YN + N    N E                           I TYEE+ ++    +RKRPI L+GP   G+++L + ++++DP++F     HTT    D    G +Y  VS++ F+      +FIE+  FEKN YG S   ++ +I++GK  LL L  +SL+ +R +   PY+IFI+PP S E LR L
Sbjct:  292 VKIVRIEKAKDIPLGATVRNDMDSVIISRIVKGGAAERSGLLHEGDEVLEINGVEIRGKDVNEVFDILAEMHGTLTFILIPSQQTKP----PPIKETVVHVKAHFDYDPSDDPYVPCRELGLCFQKGDILHIISQDDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKKKRKKL-----LYNANKNDDYDNEE---------------------------ILTYEEMALYHQPANRKRPIALIGPPNCGQNELRQRLLSNDPDRFGGAVPHTTRSRRDGEVNGRDYHFVSRQAFEVDAAAGKFIESGEFEKNLYGTSTDSVRQLINSGKICLLCLHTQSLKVLRSSDLKPYIIFIAPP-SQERLRAL 646          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 199.134 bits (505), Expect = 3.543e-55
Identity = 150/480 (31.25%), Postives = 230/480 (47.92%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKE--AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKR-NYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRK-RPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKI---RP----SDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KI+ L K K PLGAT+R  +E  A++V RI+ GG A +SGL+  GDEL  VN + +  K+  EV  ILA+    + F +       S S +       I+L+  F Y P  D  IPC + GL F RGE+L V +  D  WWQA R +           AGLIPS  Y      ++++L+  + A         +S +  L+++ R + Q+      +Y    + +   +E                           +STYEEV  +  QP  K R IVLVGP  +G ++L + +IASDP  ++     TT     H K+   Y  VS+  F+   +   F+E   F+ N YG S   ++ +++AGK  LL + P ++++IR   F P+VIF+ PP S+E LR+ R   +      P    +D++    +  A  ++  FG  FD  +V   L +A         SL+R+  WVP  W+
Sbjct:  137 VKIIRLVKNKEPLGATIRRHEETGAIVVARIMRGGAADRSGLINVGDELKEVNGVRVDNKEPEEVIQILAQSQSAITFKIVPAFKDESQSKD-----TKIYLRTFFDYNPRGDVAIPCKEAGLPFLRGEVLQVVSQDDSMWWQAKRTEQSNMR------AGLIPSKHY------MERRLAARQPASPPIVQKSSKSRLSGLRRSFRLSRQSRKTSKLMYESKRSAEYDASE---------------------------VSTYEEVLQYQHQPGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVSRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPP-SLERLRQTRGAAKSSGDKNPARNFTDEDFQEMLGTAARMEAQFGYLFDKTVVNDELAAAYRELRAAADSLERETMWVPLSWV 571          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008487.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.851 bits (416), Expect = 1.621e-43
Identity = 131/475 (27.58%), Postives = 222/475 (46.74%), Query Frame = 1
Query:  865 IKIVVLEKGK-HPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMT-----LEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            I++V + K +  PLG T R E   +++ RI+ GG+  + GLL  GD +  VN     G DV+    +L   +G+V   V  +  SY+     PQN   + +K  F Y P DD  IPC + GL F++G++L + +  DP+WWQA +  DG       G AGL+PS   + +R+   +Q       +N    T      LC     +  +       +Y    N +    E                           I  YEE+      P +++ +VL+G + +GR  L   ++ S+P ++ +    T+    D  K+G  Y  V++ + +       ++E+  +E N YG +K E   ++ AGK  +L + P++L+ +R   F+PYV+FI+ P S+E+LR +        L     +D +L  T+D +  I   +  +FD  +V  ++D A       ++ L ++PQWVP  W+
Sbjct:  132 IRMVGIRKMEGEPLGVTFRVESNELVIARILRGGMIDQQGLLHVGDVIREVN-----GCDVSN-DPVLREATGSV---VLKILPSYT----LPQNPAPLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKAQDG-------GSAGLVPSQTLEEKRKAYVRQ------EMNF---TSASGGALCGVLGGKKKKKL-----MYMSTKNAEFDRHE---------------------------ILIYEEMAKM--PPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYG-TKIESHGVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAP-SVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWV 541          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008482.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 1.243e-39
Identity = 131/489 (26.79%), Postives = 221/489 (45.19%), Query Frame = 1
Query:  865 IKIVVLEKGK-HPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIH--------------LKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMT-----LEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            I++V + K +  PLG T R E   +++ RI+ GG+  + GLL  GD +  VN     G DV+     L   +G+V   V  +  SY+     PQN   +               +K  F Y P DD  IPC + GL F++G++L + +  DP+WWQA +  DG       G AGL+PS   + +R+   +Q       +N    T      LC     +  +       +Y    N +    E                           I  YEE+      P +++ +VL+G + +GR  L   ++ S+P ++ +    T+    D  K+G  Y  V++ + +       ++E+  +E N YG +K E   ++ AGK  +L + P++L+ +R   F+PYV+FI+ P S+E+LR +        L     +D +L  T+D +  I   +  +FD  +V  ++D A       ++ L ++PQWVP  W+
Sbjct:  132 IRMVGIRKMEGEPLGVTFRVESNELVIARILRGGMIDQQGLLHVGDVIREVN-----GCDVSN-DPYLREATGSV---VLKILPSYT----LPQNPAPVRTDRYPLHHVCQQLFVKCQFDYNPADDQLIPCKEAGLKFSQGDVLQIVSQDDPDWWQACKAQDG-------GSAGLVPSQTLEEKRKAYVRQ------EMNF---TSASGGALCGVLGGKKKKKL-----MYMSTKNAEFDRHE---------------------------ILIYEEMAKM--PPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYG-TKIESIGVVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAP-SVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIHYFDLTIVNDNMDEAFANLRAYLERLVKEPQWVPIGWV 555          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 124.79 bits (312), Expect = 1.197e-32
Identity = 74/215 (34.42%), Postives = 121/215 (56.28%), Query Frame = 1
Query: 1591 CPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPS------DDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETAL 2205
            C A  E++  +  I TYEE+ ++    +RKRPIVL+GP   GR++L   ++ SD ++FA    HTT    D+  +G +Y  VS++ F+      +FIE   FEKN YG S   ++ +I++GK  +L L  +SL+ ++ +   PY+IF++PP+  E LR + M  E   P        +EL   I++A  ++  +G +FD ++V   LD A +  L
Sbjct:   14 CAACAEMDADE--ILTYEEMALYHQPANRKRPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFVSRQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPPSQ-ERLRAM-MAKESKNPKVSARFLPEELREVIEKAREMEQGYGHYFDGIIVNADLDKAHQELL 224          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 5.150e-26
Identity = 61/219 (27.85%), Postives = 114/219 (52.05%), Query Frame = 1
Query: 1630 ISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKL-RMTLEKIRPS----DDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            I  YEEV      P +++ ++L+G + +GR  L   ++ ++P ++ ++   T+    D  KEG  Y  VS+ + +       ++E+  +E N YG     +  ++  GK  +L + P++L+ +R   F+P+V+F++ PT +E LR + R  L+    S    D +L  T+D +  I   +  FFD  +V +++D A       ++ L + PQWVP  W+
Sbjct:  247 ILIYEEVAKM--PPFQRKTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFVSRADMEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPT-LETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMDVAFAKLRAALEGLGKGPQWVPISWV 462          

HSP 2 Score: 85.5001 bits (210), Expect = 1.065e-17
Identity = 63/172 (36.63%), Postives = 94/172 (54.65%), Query Frame = 1
Query:  865 IKIVVLEKGK-HPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQRE 1377
            I++V + K +  PLG T R E   +++ RI+ GG+  + GLL  GD +  VN  ++T  D   +   L   +G+V   V  +  SY+ S    Q    + +K  F Y P+DD  IPC + GL FNRG+IL + + +DP+WWQA +  DG       G AGLIPS   + +R+
Sbjct:   46 IRMVGIRKVEGQPLGVTFRVESSELVIARILRGGMIDQQGLLHVGDVIREVNGRDVT-NDPAGLQRFLREATGSV---VLKILPSYTRSSPPAQ----VFVKCYFDYNPEDDQLIPCKEAGLRFNRGDILQIVSQEDPDWWQALKVKDG-------GSAGLIPSQTLEEKRK 202          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 75.8702 bits (185), Expect = 2.698e-16
Identity = 45/134 (33.58%), Postives = 73/134 (54.48%), Query Frame = 1
Query: 1681 RPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSK----EGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYV----IFISPPTSIELLRKL 2058
            RPIV+ GP   G+  LLK + A  P+ F      TT   +     G +Y  VS +EFK M    EFIE A F  N+YG + + +K +  +GKT +L +  + +++++    IP +    +FI+PP+  +L ++L
Sbjct:    3 RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKA---IPELNARFLFIAPPSVEDLKKRL 133          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 271.937 bits (694), Expect = 7.834e-81
Identity = 174/482 (36.10%), Postives = 263/482 (54.56%), Query Frame = 1
Query:  856 DIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYR-DDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEG----GNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRP---------SDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            D  +KIV ++K   PLGATV+NE  AV++GRIV GG A KSGLL EGDE+L +N + + GK V+EV ++LA ++GT+ F +     S  G+++R +    +H++A F Y P DD +IPC ++GLAF RG+ILHV + +D NWWQA+R  ++G+       LAGLIPS  +Q QRE +K  +  +        +T +    LC+K+ +R          +YN   N                          E+ ++D  + TY+EV +  P P RKRPIVL+GP  IGR +L + +I  DP++FA    HT+   K G     +Y  V +  F       +F+E    + ++YG S   +K++I+AGKT +L L  E+L+ +R +   PYVIFIS P S E +R LR    KI P         +D E+   + +A  ++  +G +FD  +     +   +   ++I  L+ +PQWVP  WL
Sbjct:  192 DDSVKIVRIDKSCDPLGATVKNEDGAVLIGRIVKGGAAEKSGLLHEGDEILEINGVHMKGKSVSEVCELLADMNGTLTFLLVPKTRSI-GTLSRDR---AVHVRANFDYDPYDDEFIPCRELGLAFRRGDILHVVDQEDQNWWQAWRAGEEGKK------LAGLIPSKHFQQQRESMKHTVPADNE-----KTTEKSKKCLCIKRKRRK-------KVLYNAQQN--------------------------EVFEVD-QVLTYDEVDLLHPNPSRKRPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVPRHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSP-SYERVRALRRG--KIDPFNPKLNVALTDREIHEMVAKAREMEEAYGHYFDHTITNTDFERTFDELRQVIARLEDEPQWVPVSWL 621          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 157.918 bits (398), Expect = 4.764e-41
Identity = 132/476 (27.73%), Postives = 220/476 (46.22%), Query Frame = 1
Query:  862 PIKIVVLEK-GKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREM-LKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEG----GNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELL----RKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            PI++V L K     LG T++ E   +I+ RI+ GG+  + GLL  GD +  VN  +++G + +E+ D LA+ +G +   V     SY  S    Q    + ++A F Y P  D  IPC D GLAF +GE+L + + +D NWWQA + DD R        AG+IPS   + +R   +KK   G              S  LC  K K+          +Y    N                        D E +++      YEEV      P +++ +V++G + +GR  L   +I SD ++F     HT+   +EG      Y  VS+EE +      +++E   +  N YG     ++ ++ +GK  ++ + P +L+ ++   F+PY++ I+ P+  EL     + L   +   + SDDEL  T++ +  +   +  +FD  +   +++ A       I+SL   PQWVP  W+
Sbjct:  101 PIRMVGLHKHANEHLGVTLKVEDNQLIISRIIHGGMIDRQGLLHVGDIIKEVNGKDMSG-NPSELQDYLAKSTGKITLKVLP---SYYESPALCQ----VFVRAHFDYDPSKDDQIPCQDAGLAFKQGEVLQIVDQEDANWWQAKKVDDSR-------AAGIIPSQICEERRRAGVKKDKPG--------------SKFLCGSKKKQKV--------MYKSSKN-----------------------FDFEKHEL----PIYEEVAKM--PPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIESLSTHPQWVPVSWV 510          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Match: EDO47352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMI8])

HSP 1 Score: 153.68 bits (387), Expect = 5.379e-39
Identity = 116/414 (28.02%), Postives = 192/414 (46.38%), Query Frame = 1
Query:  847 SDRDIPIKIVVLEK-GKHPLGATVRNEKEAX--XXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVT-IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNIS-TYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLE 2073
            SD ++ +K V L K GK PLGATV+ +++    +V RI+ GG+  +SG L  GD +  +N   + GK  NEV +I+ R+SG+V F V  +      +++R     T + L+ALF Y P +D  IPC + GL   +G+IL V + +DPNWWQA ++DD      +    GL+PS  +Q +R +  +  +  E   +         +    K+ K+ ++                                     +D + ++ D + + TYEEV MF P   + R ++L+                          +    +   G  Y  VS+   +      +FIE   F K  YG S   +K +I  GK  +L +QP++ + +R+  + PY ++I PP S+E LR  R+T++
Sbjct:  138 SDLELAVKYVRLIKSGKEPLGATVKCDEDTGDIVVARILRGGMVDRSGTLGVGDVIQEINNQSVIGKTTNEVVEIMERLSGSVLFKVIPMK-----AVDRKSTADTKVRLRALFNYDPANDDLIPCKEAGLPLVKGDILQVVSREDPNWWQARKEDD------VNNTIGLVPSKQFQEKRFLFDRLFAETENHKHSSGGVNHVKNFRWRKRKKKEHKL------------------------------------SDAQKDETDGDKALTYEEVTMFSPVNDKHRLVILIDTS-----------------------RRMRPYEANGREYYFVSRTTMENYAQNSKFIEYGEFRKCLYGTSVDSIKRVIRTGKMCILKVQPKAAKILRRKEYKPYFVYIKPP-SLETLRSTRVTVK 480          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Match: EDO46060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR66])

HSP 1 Score: 107.842 bits (268), Expect = 2.974e-25
Identity = 103/398 (25.88%), Postives = 177/398 (44.47%), Query Frame = 1
Query: 1156 IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYR-----DDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNG-GWVY--NVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPN-------------------ISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIV-SKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSR 2253
            ++++ALF Y    D+ +P    GL+F  G+ILHVTN  D  WWQA +     +++GR         G+IPS          K+++   E A       R +S       + +   +FN+G G V   +   + KLP  +                +DLE + +DP+                   I +YE VQ    +    RP++++GP     +D L   I+  P++F     HTT    D+ K+G +Y  V S+EE +       FIE   +  N YG S   +K++ +  K  +L +   +++ ++     P  IFI  P S+E +R+L   L     ++++   T DRA  ++  FG++F +++   + D       ++I+       WVPS+
Sbjct:   17 LYVRALFDYDKTKDSGLPSQ--GLSFKYGDILHVTNASDDEWWQARKLNAVGEEEGR---------GVIPS----------KRRVERREKA-------RMKSVKFTRTSDDKLRGSFNDGTGSVRKRSFKFSKKLPFFKKE--------------SDLETSDVDPSYTSNASDSESSTSARAEEPILSYEAVQQH--ELKYTRPVIVLGPLKDRINDDL---ISEFPDKFGSCVPHTTRPRRDYEKDGLDYHFVESREEMERAIQNHMFIEAGQYNDNLYGTSVESVKIVAEKSKHCILDVSGYAIKRLQVAGLYPIAIFIK-PKSMESIRELNKRL-----TEEQAQKTFDRALKLEQEFGEYFTAIVQGDTYDELYNRVKEVIRQQSGPVIWVPSK 361          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Match: EDO39364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAA1])

HSP 1 Score: 108.997 bits (271), Expect = 2.606e-24
Identity = 102/435 (23.45%), Postives = 169/435 (38.85%), Query Frame = 1
Query:  970 HKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQ-SSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSK----EGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            H+ G L  GDE+  +N   +  K +  +  +L   SG V F +   +     + +       + ++ALF Y P  D  IPC   G+AF+  EIL V N  D  WWQA + D   +       AGLIPSP+ Q  R           A +    S +Q  +S +   + K+ Y+        Y    N                            +++D  + TYEEV     +  +++ +VL+G   +GR  +   +I    ++FA    HTT   +    +G +Y  VS E          ++E  T E   YG     +  II+  K A+L ++P+                       E L++L    +++R +                 +G  FD  +V + +D  +    + ++ L   PQWVP  W+
Sbjct:  571 HRQGTLHPGDEIREINGSNVADKSIEALQSMLRDASGNVTFKIVPSSRGLGTNTD-------VFVRALFDYDPRSDDLIPCQRAGMAFHCSEILQVVNKADCYWWQAKKPDANEE------FAGLIPSPELQEWR----------VACIAAEKSKKQNGASCIWFSRKKKTYRD------RYVAKHNAV-------------------------FDRLD--LVTYEEVVKM--EKFKRKTLVLLGAHGVGRRHIKNTLINKFADKFAYPIPHTTRDPRAGEEDGKHYYFVSAEVMMSDIESNRYLEYGTHEGAMYGTKLDTITDIIENHKVAILDVEPQG----------------------ESLKRLAKESDQLRQT-----------------YGHLFDLTIVNNDIDETIAQLEEALERLGTTPQWVPISWI 908          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Match: mpp5b (membrane palmitoylated protein 5 [Source:NCBI gene;Acc:101164939])

HSP 1 Score: 279.641 bits (714), Expect = 6.268e-83
Identity = 174/474 (36.71%), Postives = 254/474 (53.59%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILC----LKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +K+V LEK +  PLGATVRN+ ++V+V R+V GG A +SGLL EGDE+L +N + + GK +NEV D+L ++ G + F +   +         P     +H++A F Y P DD ++PC ++GL+F +G+ILHV +  DPNWWQAYRD D  +      LAGLIP   +Q QRE LKK L  N        S  QQ  + C     K+ KRN   F       + D++                                 +I TYEE+ ++    +RKRPI L+GP   G  +L + +++ +PE+FA+   HTT     H + G  Y  VS+  F+      +FIE+  +EKN YG S   ++ +I++G   +L L   SL+ +R +   PYVIFI PP S E LR L  T E   P  +EL  TI++A  ++  FG FFD+ +     + A +   ++I  LD +PQWVP+ WL
Sbjct:  228 VKLVRLEKARDTPLGATVRNDMDSVVVSRVVKGGAAERSGLLNEGDEILEINGIPIRGKHINEVHDLLQQMHGALTFLLIPSSHIKPA----PHRQTVMHIRAYFDYDPSDDPFVPCRELGLSFQKGDILHVISQDDPNWWQAYRDGDEDNQ----PLAGLIPGKSFQQQRETLKKSLPDN--------SRDQQGKLWCSKKSKKQKKRNVSNFTK-----STDSD---------------------------------DILTYEEMSLYHQPANRKRPIALIGPTNSGHDELRRRLLSLEPERFAVAVPHTTRNPRIHERNGREYHFVSRPGFEADLAAGKFIESGEYEKNLYGTSTDSVRHVINSGHICVLCLHTRSLQVLRSSNLKPYVIFIGPP-SQERLRTLLAT-EGKTPKPEELKETIEKAREMEQNFGHFFDATIQNVDPNQAFQELRRLIDKLDTEPQWVPTSWL 645          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Match: MPP5 (MAGUK p55 subfamily member 5-A-like [Source:NCBI gene;Acc:101170065])

HSP 1 Score: 276.174 bits (705), Expect = 5.297e-82
Identity = 176/471 (37.37%), Postives = 260/471 (55.20%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVT-IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK    PLGATVRNE E V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVN+V DILA + G + F +       SG +  P    T IH+KA F Y P DD Y+PC ++GL+F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNKR  +       +YN   N + P+ E                          +I TYEE+ ++    +RKRPI L+GP   G+ +L + ++ S P++F+   QHTT    D  + G +Y  VS++ F+      + IE+   EKN YG S   ++ +I+ GK  +L L  + L+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++   G  FD+++V   LD +    L++I  LD +PQWVP  WL
Sbjct:  188 VKIVRIEKAPDVPLGATVRNEMENVVISRIVRGGAAERSGLLSEGDEILEINGIEIRGKDVNQVFDILADMHGLLTFVLIP-----SGQIRPPPVKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHIISQSDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKRKRKKL-----LYNTHRN-EDPDHE--------------------------DILTYEEMALYHQPANRKRPIALIGPNGCGQVELRQRLLRSQPDRFSGAAQHTTRSRRDGEQSGRDYIFVSRQSFEAELAMGKLIESVESEKNLYGTSTDSVRQVINTGKICVLCLHAQGLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDVIEKAREMEQSCGHLFDAIIVNTDLDKSFHELLRLIDKLDTEPQWVPCSWL 608          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Match: MPP5 (MAGUK p55 subfamily member 5-A-like [Source:NCBI gene;Acc:101170065])

HSP 1 Score: 276.559 bits (706), Expect = 1.464e-81
Identity = 176/471 (37.37%), Postives = 259/471 (54.99%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVT-IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +KIV +EK    PLGATVRNE E V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVN+V DILA + G + F +       SG +  P    T IH+KA F Y P DD Y+PC ++GL+F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNKR  +       +YN   N   P+ E                          +I TYEE+ ++    +RKRPI L+GP   G+ +L + ++ S P++F+   QHTT    D  + G +Y  VS++ F+      + IE+   EKN YG S   ++ +I+ GK  +L L  + L+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++   G  FD+++V   LD +    L++I  LD +PQWVP  WL
Sbjct:  246 VKIVRIEKAPDVPLGATVRNEMENVVISRIVRGGAAERSGLLSEGDEILEINGIEIRGKDVNQVFDILADMHGLLTFVLIP-----SGQIRPPPVKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHIISQSDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKRKRKKL-----LYNTHRNED-PDHE--------------------------DILTYEEMALYHQPANRKRPIALIGPNGCGQVELRQRLLRSQPDRFSGAAQHTTRSRRDGEQSGRDYIFVSRQSFEAELAMGKLIESVESEKNLYGTSTDSVRQVINTGKICVLCLHAQGLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDVIEKAREMEQSCGHLFDAIIVNTDLDKSFHELLRLIDKLDTEPQWVPCSWL 666          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Match: MPP5 (MAGUK p55 subfamily member 5-A-like [Source:NCBI gene;Acc:101170065])

HSP 1 Score: 259.61 bits (662), Expect = 1.783e-75
Identity = 170/463 (36.72%), Postives = 253/463 (54.64%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVT-IHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTT----DHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDP 2235
            +KIV +EK    PLGATVRNE E V++ RIV GG A +SGLL EGDE+L +N +E+ GKDVN+V DILA + G + F +       SG +  P    T IH+KA F Y P DD Y+PC ++GL+F +G+ILH+ +  DPNWWQAYRD D  +      LAGL+P   +Q QRE +K+ +  ++          +   + C KKNKR  +       +YN   N   P+ E                          +I TYEE+ ++    +RKRPI L+GP   G+ +L + ++ S P++F+   QHTT    D  + G +Y  VS++ F+      + IE+   EKN YG S   ++ +I+ GK  +L L  + L+ +R +   PY+IFI+PP+  E LR L +  +   P  +EL   I++A  ++   G  FD+++V   LD +    L++I  LD +P
Sbjct:  246 VKIVRIEKAPDVPLGATVRNEMENVVISRIVRGGAAERSGLLSEGDEILEINGIEIRGKDVNQVFDILADMHGLLTFVLIP-----SGQIRPPPVKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHIISQSDPNWWQAYRDGDEDNQ----PLAGLVPGKSFQQQREAMKQTIEEDK-------EPEKSGKLWCAKKNKRKRKKL-----LYNTHRNED-PDHE--------------------------DILTYEEMALYHQPANRKRPIALIGPNGCGQVELRQRLLRSQPDRFSGAAQHTTRSRRDGEQSGRDYIFVSRQSFEAELAMGKLIESVESEKNLYGTSTDSVRQVINTGKICVLCLHAQGLKVLRSSDLKPYIIFIAPPSQ-ERLRAL-LAKDNKNPKPEELRDVIEKAREMEQSCGHLFDAIIVNTDLDKSFHELLRLIDKLDTEP 658          
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Match: mpp5b (membrane palmitoylated protein 5 [Source:NCBI gene;Acc:101164939])

HSP 1 Score: 236.113 bits (601), Expect = 2.990e-67
Identity = 150/406 (36.95%), Postives = 220/406 (54.19%), Query Frame = 1
Query:  865 IKIVVLEKGKH-PLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMT 2067
            +K+V LEK +  PLGATVRN+ ++V+V R+V GG A +SGLL EGDE+L +N + + GK +NEV D+L ++ G + F +   +         P     +H++A F Y P DD ++PC ++GL+F +G+ILHV +  DPNWWQAYRD D  +      LAGLIP   +Q QRE LKK L  N        S  QQ  + C KK+K+  +  N   +  + D++                                 +I TYEE+ ++    +RKRPI L+GP   G  +L + +++ +PE+FA+   HTT     H + G  Y  VS+  F+      +FIE+  +EKN YG S   ++ +I++G   +L L   SL+ +R +   PYVIFI PP S E LR L  T
Sbjct:  228 VKLVRLEKARDTPLGATVRNDMDSVVVSRVVKGGAAERSGLLNEGDEILEINGIPIRGKHINEVHDLLQQMHGALTFLLIPSSHIKPA----PHRQTVMHIRAYFDYDPSDDPFVPCRELGLSFQKGDILHVISQDDPNWWQAYRDGDEDNQ----PLAGLIPGKSFQQQRETLKKSLPDN--------SRDQQGKLWCSKKSKKQKKR-NVSNFTKSTDSD---------------------------------DILTYEEMSLYHQPANRKRPIALIGPTNSGHDELRRRLLSLEPERFAVAVPHTTRNPRIHERNGREYHFVSRPGFEADLAAGKFIESGEYEKNLYGTSTDSVRHVINSGHICVLCLHTRSLQVLRSSNLKPYVIFIGPP-SQERLRTLLAT 582          
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Match: SMESG000019904.1 (SMESG000019904.1)

HSP 1 Score: 1448.34 bits (3748), Expect = 0.000e+0
Identity = 750/754 (99.47%), Postives = 750/754 (99.47%), Query Frame = 1
Query:   34 MTGVLQPNNMHDQAYQNSENLNRIQYYXXXXXXXXXXXXXXXXMNQFLNSSLRASDRLRALEKSKKLNYKMNAAFVSEDTENDTARLDIDIARFTEALCKRKPNRNNLSKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGKSSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRXXXXXXXXENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQQSLIY 2295
            MTGVLQPNNMHDQAYQNSENLNRIQYYEERLSKRKEKSKEEEKMNQFLNSSLRASDRLRALEKSKKLNYKMNAAFVSEDTENDTA LDIDIARFTEALCKRKPNRNNLSKSDLDWLQKYIQSDGFQDSYKMSIAVQKIL CYGHPPL GKSSAQ KLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRSKSGSSKSENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAVIVGRIVVGGIAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTENNRQKSNKKKRSTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQQSLIY
Sbjct:    1 MTGVLQPNNMHDQAYQNSENLNRIQYYEERLSKRKEKSKEEEKMNQFLNSSLRASDRLRALEKSKKLNYKMNAAFVSEDTENDTAMLDIDIARFTEALCKRKPNRNNLSKSDLDWLQKYIQSDGFQDSYKMSIAVQKILVCYGHPPLTGKSSAQRKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYANDQCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRSKSGSSKSENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEAVIVGRIVVGGIAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTENNRQKSNKKKRSTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQQSLIY 754          
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Match: SMESG000044526.1 (SMESG000044526.1)

HSP 1 Score: 181.8 bits (460), Expect = 1.431e-48
Identity = 146/502 (29.08%), Postives = 239/502 (47.61%), Query Frame = 1
Query:  856 DIPIKIVVLEKGKHPLGATVR-NEKE-AXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFA----LLKQHTTDHSKEGGNYKIVSKEEFKFMQNQEEFI---ETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTL-------EKIRPSDDELV--------TTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQQSL 2289
            D+ +KIV + K   PLGAT++ NE+  AV++ R++ GG A + G L  GDE+  +N L + G+D  EV  IL  I+G V+  V +   S S      QN    H++ALF+Y P  D  IPC + G+AF +G+IL + N +DPNWWQA + D    +G  A    LI S     + E L   ++G    +     +R       L++ K  Y+   N                                P+D+ L+ + P I TYE+V  +  +    RPIV++GP  +G+ +L + +I +D   F     +  +  T + + G +Y  V+ EEF+     +  I       F+K   G+    +  II  G   +   +P+S+ A+R     P++I+I PP SI++L + R  L       +K+    D++           I   + +++++ Q+FD ++V   L  ALE   ++   L+ +P WVP RWL Q   +  S+
Sbjct:  122 DVMVKIVHIVKDNEPLGATIKVNERTGAVLIARVMHGGAADRCGALSVGDEIQEINRLSVQGRDPMEVIKILTSITGDVKLKVCT---SMSSKSANDQN--MCHVRALFSYSPALDQLIPCREAGIAFRKGDILRLVNTEDPNWWQAVKVDPIFGAGFKA--MSLIGS---NLESESLPGIMAGRTGLI----PSRT------LQEKKEQYKMAANQR------------------------------PSDILLDSL-PEIFTYEDVDQYFAEDCNYRPIVIIGPPGVGKSELKRELINTDLSHFKEPIKITTREPTPNEEHGQDYLFVTLEEFETFARADSLINYWSDGEFDKT--GLCVDAVLEIIQCGMVPVFTAKPQSIPALRTAALKPFIIYIRPP-SIDILLETRPMLSSGNKETKKVYGKSDDIRYFKESDFEEMIQIGSRMELLYAQYFDHIIVNDDLPVALEQLSEMAYRLETEPFWVPKRWLEQESSTASSV 569          
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 140.584 bits (353), Expect = 4.800e-34
Identity = 123/473 (26.00%), Postives = 209/473 (44.19%), Query Frame = 1
Query:  865 IKIVVLEKGK-HPLGATVR-NEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIY-ASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDR-ANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +++V  +K    P+G T++ N++   IV RI+ GG+ H+ G L  GDE+  +N   + G+ +  +  +L    G+V   +     SY    + P     I++KA+F Y P+DD  IPC   G+ F  G+IL + +  D NWWQA        S  +   AGLIP  +Y+          +G+     +  A+ R Q+++   K+N R                  K+                           I PNI  Y    ++       + +VL+G   +GR  +   +I S P++FA    HTT   ++    G NY  VS EE        E++E  T E+  YG     ++ I  AG  A+L ++P++LR +R   F PYV+FI+ P           T+  +   +D  +  + R +  +++ +G +FD  +V + ++  +    + I  +    QWVP  W+
Sbjct:  437 VRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVP---SYR---HNPMQ-CEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLW-----SAVINNTAGLIPVRNYR----------NGDRQVWQLKEANKRLQTALGLAKRNDR-----------------AKI--------------------------SIVPNIPVYSINWIW-------KTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPC--------LATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWV 829          
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Match: SMESG000060582.1 (SMESG000060582.1)

HSP 1 Score: 140.198 bits (352), Expect = 7.070e-34
Identity = 123/473 (26.00%), Postives = 209/473 (44.19%), Query Frame = 1
Query:  865 IKIVVLEKGK-HPLGATVR-NEKEAXXXXXXXXXXXAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREMLKKQLSGNEAALNIY-ASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKE----GGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDR-ANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            +++V  +K    P+G T++ N++   IV RI+ GG+ H+ G L  GDE+  +N   + G+ +  +  +L    G+V   +     SY    + P     I++KA+F Y P+DD  IPC   G+ F  G+IL + +  D NWWQA        S  +   AGLIP  +Y+          +G+     +  A+ R Q+++   K+N R                  K+                           I PNI  Y    ++       + +VL+G   +GR  +   +I S P++FA    HTT   ++    G NY  VS EE        E++E  T E+  YG     ++ I  AG  A+L ++P++LR +R   F PYV+FI+ P           T+  +   +D  +  + R +  +++ +G +FD  +V + ++  +    + I  +    QWVP  W+
Sbjct:  488 VRLVQFQKNTDEPMGITLKMNDEGKCIVARIMHGGMIHRQGTLHVGDEIREINSESVVGRTIEYLQKLLKNARGSVTLKIVP---SYR---HNPMQ-CEIYVKAMFEYNPEDDDLIPCSQAGVKFKIGDILQIISKDDHNWWQARLW-----SAVINNTAGLIPVRNYR----------NGDRQVWQLKEANKRLQTALGLAKRNDR-----------------AKI--------------------------SIVPNIPVYSINWIW-------KTLVLLGAHGVGRRHIKNCLIQSAPDRFAYPIPHTTRPPRKDEVNGKNYFFVSHEEMMRDITNNEYLEYGTHEEAMYGTKLDTIRHIHSAGLIAILDVEPQALRVLRTAEFSPYVVFIAAPC--------LATMTDVHNLNDGSLERLSRESEMLEVQYGHYFDLKIVNNDIEDTIRQLKRSIDEVQSSAQWVPVNWV 880          
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Match: SMESG000062837.1 (SMESG000062837.1)

HSP 1 Score: 130.183 bits (326), Expect = 7.565e-32
Identity = 120/472 (25.42%), Postives = 216/472 (45.76%), Query Frame = 1
Query:  865 IKIVVLEKGKHPLGATVRNEKEAXXXXXXXXXX-XAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGTVRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAFNRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREM--LKKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGKLPNTEXXXXXXXXXXXXTYCPADLELNQIDPNISTYEEVQMFIPQPHRKRPIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTD----HSKEGGNYKIVSKEEFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRAIRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAIDMMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWL 2259
            + I + +    P+G T+R +K    V   ++ G + H+ G L  GDE++ VN   + G  +  V  IL    G+V  T+   N         P N   I++KA+F Y+P +D+ +P   + L F  G+IL + +  D NWWQA   D   DS      A LIPS + Q  R +  +  +++G + +     ++ +  +   L++ KR  ++         +  NG   +   ++ ++  +    Y    L L   D   S YEEV         +R ++L+G   +GR  +   +I S P  F+    HT+     +   G +Y  VS E+         ++E    +   YGI    ++ II      +L ++P++LR +R   F P+V+FISPP     L  L  + ++I   D  L    + +  ++M++  F D  +V +S++  ++  ++ +  L  + QW+P  W+
Sbjct:   16 VTITINKNVSEPMGMTLRKDKNGRCVIARIMIGGLIHRHGSLHVGDEIVEVNAESVVGDSLEFVQRILKSAHGSVYLTIVPNN------WREPPN-CEIYVKAMFDYEPSEDSIVPASQMALTFYVGDILRIISKDDNNWWQAQHLDQDVDSP-----ARLIPSAELQESRAVTSILDKVTGEKKS----NASAKSCNPFVLRQKKRKKRSSK-----VPIICNGVAHSLAESKCRNYFESEKLY--DQLHLFLSDLEFSPYEEVIEI--AEFSRRSLILLGAHGVGRRHIKNALIQSFPHLFSAPVPHTSKAPLANQINGKDYHFVSHEQMLSDIANNLYLEYGKQDDILYGIKLETVRQIIQCRIIPVLDVEPQALRLLRNGEFAPFVVFISPPH----LDVLSDSTKEI--FDGCLEKLCEDSELLEMLYRPFIDMEIVNYSIEDTVKPIVQALNELHSNSQWIPVAWI 456          
The following BLAST results are available for this feature:
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPP52.496e-8832.86membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
MPP53.774e-8832.86membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
MPP33.258e-5330.96membrane palmitoylated protein 3 [Source:HGNC Symb... [more]
MPP34.267e-5330.96membrane palmitoylated protein 3 [Source:HGNC Symb... [more]
MPP42.542e-4829.33membrane palmitoylated protein 4 [Source:HGNC Symb... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-25.580e-3624.63pep chromosome:WBcel235:X:12399517:12406131:-1 gen... [more]
lin-22.538e-3524.63pep chromosome:WBcel235:X:12399517:12414037:-1 gen... [more]
magu-26.592e-3148.80MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-26.592e-3148.80MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-28.317e-3148.80MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdt5.159e-8234.58gene:FBgn0261873 transcript:FBtr0089975[more]
sdt5.159e-8234.58gene:FBgn0261873 transcript:FBtr0308219[more]
sdt5.942e-8234.58gene:FBgn0261873 transcript:FBtr0100375[more]
sdt2.806e-8134.58gene:FBgn0261873 transcript:FBtr0111034[more]
sdt2.593e-8034.58gene:FBgn0261873 transcript:FBtr0340142[more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp5a5.664e-8637.02membrane protein, palmitoylated 5a (MAGUK p55 subf... [more]
mpp5a5.664e-8637.02membrane protein, palmitoylated 5a (MAGUK p55 subf... [more]
mpp5a5.664e-8637.02membrane protein, palmitoylated 5a (MAGUK p55 subf... [more]
mpp5b1.541e-7333.19membrane protein, palmitoylated 5b (MAGUK p55 subf... [more]
mpp4l1.430e-4929.98membrane protein, palmitoylated 4-like [Source:ZFI... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp51.995e-8833.33membrane protein, palmitoylated 5 [Source:NCBI gen... [more]
mpp52.063e-8833.33membrane protein, palmitoylated 5 [Source:NCBI gen... [more]
mpp57.711e-8833.33membrane protein, palmitoylated 5 [Source:NCBI gen... [more]
mpp58.471e-8738.05membrane protein, palmitoylated 5 [Source:NCBI gen... [more]
pex134.926e-5530.79peroxisomal biogenesis factor 13 [Source:Xenbase;A... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpp52.064e-8832.55membrane protein, palmitoylated 5 (MAGUK p55 subfa... [more]
Mpp35.549e-5631.47membrane protein, palmitoylated 3 (MAGUK p55 subfa... [more]
Mpp35.549e-5631.47membrane protein, palmitoylated 3 (MAGUK p55 subfa... [more]
Mpp35.549e-5631.47membrane protein, palmitoylated 3 (MAGUK p55 subfa... [more]
Mpp79.302e-5329.80membrane protein, palmitoylated 7 (MAGUK p55 subfa... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RDQ2|MPP5_PONAB4.441e-8933.18MAGUK p55 subfamily member 5 OS=Pongo abelii OX=96... [more]
sp|E2QY99|MPP5_CANLF2.495e-8833.18MAGUK p55 subfamily member 5 OS=Canis lupus famili... [more]
sp|Q9JLB2|MPP5_MOUSE1.444e-8732.55MAGUK p55 subfamily member 5 OS=Mus musculus OX=10... [more]
sp|Q8N3R9|MPP5_HUMAN1.812e-8732.86MAGUK p55 subfamily member 5 OS=Homo sapiens OX=96... [more]
sp|B4F7E7|MPP5_RAT2.138e-8732.55MAGUK p55 subfamily member 5 OS=Rattus norvegicus ... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5IGJ81.269e-9439.87Putative calcium/calmodulin-dependent serine prote... [more]
L7MFE53.285e-9134.53Putative calcium/calmodulin-dependent serine prote... [more]
A0A4D5RIY01.254e-9039.87Putative calcium/calmodulin-dependent serine prote... [more]
A0A131Y0C01.863e-9040.09Putative calcium/calmodulin-dependent serine prote... [more]
A0A224Z1B01.953e-8939.87MAGUK p55 subfamily member 5 OS=Rhipicephalus zamb... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp5a2.931e-8537.66MAGUK p55 subfamily member 5-A [Source:NCBI gene;A... [more]
mpp5b3.455e-7536.31membrane palmitoylated protein 5 [Source:NCBI gene... [more]
mpp5b6.947e-7536.31membrane palmitoylated protein 5 [Source:NCBI gene... [more]
mpp5b6.947e-7536.31membrane palmitoylated protein 5 [Source:NCBI gene... [more]
mpp5a4.879e-7038.46MAGUK p55 subfamily member 5-A [Source:NCBI gene;A... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp7a3.543e-5531.25membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
ENSPMAT00000008487.11.621e-4327.58pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
ENSPMAT00000008482.11.243e-3926.79pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
MPP51.197e-3234.42membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
ENSPMAT00000004699.15.150e-2627.85pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK12.698e-1633.58Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO335777.834e-8136.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375384.764e-4127.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473525.379e-3928.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460602.974e-2525.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393642.606e-2423.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp5b6.268e-8336.71membrane palmitoylated protein 5 [Source:NCBI gene... [more]
MPP55.297e-8237.37MAGUK p55 subfamily member 5-A-like [Source:NCBI g... [more]
MPP51.464e-8137.37MAGUK p55 subfamily member 5-A-like [Source:NCBI g... [more]
MPP51.783e-7536.72MAGUK p55 subfamily member 5-A-like [Source:NCBI g... [more]
mpp5b2.990e-6736.95membrane palmitoylated protein 5 [Source:NCBI gene... [more]
back to top
BLAST of MAGUK p55 subfamily member 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019904.10.000e+099.47SMESG000019904.1[more]
SMESG000044526.11.431e-4829.08SMESG000044526.1[more]
SMESG000060582.14.800e-3426.00SMESG000060582.1[more]
SMESG000060582.17.070e-3426.00SMESG000060582.1[more]
SMESG000062837.17.565e-3225.42SMESG000062837.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010668 ID=SMED30010668|Name=MAGUK p55 subfamily member 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2507bp
AAATCTATATAAATCTTATATGGTGATAACTGAATGACAGGAGTTCTTCA
ACCAAATAACATGCATGATCAAGCCTATCAAAATTCTGAAAATCTCAACA
GAATTCAGTATTATGAAGAGAGATTGAGCAAACGCAAAGAGAAATCAAAA
GAGGAAGAAAAGATGAACCAATTCCTCAACAGCTCGTTACGCGCATCAGA
CAGATTGCGAGCACTGGAGAAATCAAAGAAACTTAATTACAAAATGAATG
CAGCCTTTGTGTCGGAGGATACAGAGAATGACACAGCAAGGCTGGATATT
GATATTGCCAGATTCACGGAAGCGCTCTGTAAACGCAAACCCAATCGGAA
CAACCTATCAAAATCAGATCTGGACTGGTTACAGAAATATATCCAAAGCG
ACGGGTTCCAAGATTCCTACAAAATGAGCATAGCGGTCCAGAAAATTTTG
GCTTGTTATGGGCATCCGCCTTTGAATGGGAAATCCTCAGCTCAGAGTAA
ATTGAAAAAGGTCAACGCGTCGCTGTCAACTGGCCACTTGCAGTCAAAAG
AGTCACATTATAAATATCAAATGCAAGAGCTGCTCCAAATTTTGTCAAAT
CCAGATTTGGAAGCACTTTGCTACGCCAACGATCAATGTGCCAACATTGC
CTTTAGTATTGAGGAGCGGAGAATTTCAGAGGCTGACGAGTTCACCCAAC
ACGATCTCACTCCAAGCTCCCCCGCTAAAGCGGAATTGAAGAGCCCAGTG
TCAGAACAGCGATCAAAATCAGGGTCCAGTAAATCAGAAAATACGGTCCG
TATTATCAAGTCGCCATTAGAAGGCTGCTATGCCCAGATCCATCTGTCCG
ACAGAGATATTCCGATAAAAATTGTCGTCCTAGAGAAAGGCAAACATCCT
CTGGGCGCAACTGTGCGCAATGAGAAGGAGGCTGTCATAGTTGGGAGAAT
TGTCGTGGGAGGCATTGCTCATAAATCAGGCCTCCTGAAGGAAGGGGACG
AACTGCTGTCTGTCAACGAGTTGGAATTGACAGGTAAAGATGTCAACGAG
GTGTCAGACATTCTAGCCAGAATCAGCGGCACAGTCCGGTTCACAGTTGC
CTCTGTCAATGACAGTTACTCAGGCTCAATGAATCGGCCGCAGAATGGAG
TCACGATACACCTGAAGGCGCTCTTCACATACAAGCCGGATGATGATGCG
TATATACCTTGCGTTGATATTGGACTAGCGTTCAATCGGGGCGAGATTCT
CCATGTGACAAATGTGCAAGACCCGAATTGGTGGCAAGCATATCGGGATG
ATGACGGCCGTGATAGCGGATCTCTTGCTGGGCTGGCGGGATTAATACCG
AGTCCCGATTACCAGTATCAAAGGGAAATGTTGAAGAAGCAACTCAGCGG
CAATGAGGCCGCATTGAATATATATGCCAGCACTCGGCAGCAGTCCTCCA
TTTTGTGTTTGAAGAAGAACAAGAGAAACTACCAGACGTTCAACAACGGC
GGATGGGTGTATAATGTGGACACAAACGGCAAGCTGCCGAATACCGAGAA
TAATAGGCAGAAATCAAACAAGAAGAAGAGGTCAACATATTGTCCGGCAG
ATCTCGAATTGAATCAGATTGATCCCAACATTAGCACGTATGAAGAAGTG
CAAATGTTCATTCCACAGCCCCACAGGAAACGGCCCATTGTGCTCGTTGG
TCCAGAACTGATTGGCAGACACGATCTGTTGAAAATGATCATCGCCAGCG
ATCCCGAACAGTTCGCCTTACTCAAGCAACATACAACCGATCACTCGAAA
GAAGGCGGCAATTATAAAATAGTGAGCAAGGAGGAATTCAAGTTCATGCA
GAATCAGGAAGAGTTCATCGAAACTGCAACATTTGAGAAGAACTGGTACG
GGATCAGCAAGAGTGAATTGAAGTTGATTATAGATGCTGGCAAAACGGCC
CTATTGATACTGCAACCGGAGAGCCTACGAGCTATCCGAAAGACAACCTT
TATTCCTTATGTGATATTCATAAGCCCTCCTACTAGTATAGAACTTCTAC
GGAAACTGAGAATGACGCTAGAAAAGATCCGGCCTTCTGATGACGAGTTG
GTGACCACGATTGACCGAGCAAATGCCATTGACATGATGTTCGGACAGTT
TTTTGATTCAGTATTAGTCGTCCATTCTCTCGACAGTGCATTAGAAACCG
CCTTAAAAATTATCAAATCACTGGACCGAGACCCCCAGTGGGTGCCATCT
AGATGGCTGGGACAACGACCAATGTCACAACAATCCTTGATCTATTGAAA
TTAGCTTAGCTTACCAAGCGGCTCAACTTATGATAACTGATTATTGTACT
TTCTGTCCTTTGCAGACCATAATGTGGATAACTATTTATATTCAGATGAT
TTATTATTATTATTATTATTAAATTTGATGTCGTCTGACTTGCTTGTATT
TGATGTCGAAGATTTTGACTTGTAATAATAAAGCTTAGTCTTTTTTTTTA
AAAAAAA
back to top

protein sequence of SMED30010668-orf-1

>SMED30010668-orf-1 ID=SMED30010668-orf-1|Name=SMED30010668-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=755bp
MTGVLQPNNMHDQAYQNSENLNRIQYYEERLSKRKEKSKEEEKMNQFLNS
SLRASDRLRALEKSKKLNYKMNAAFVSEDTENDTARLDIDIARFTEALCK
RKPNRNNLSKSDLDWLQKYIQSDGFQDSYKMSIAVQKILACYGHPPLNGK
SSAQSKLKKVNASLSTGHLQSKESHYKYQMQELLQILSNPDLEALCYAND
QCANIAFSIEERRISEADEFTQHDLTPSSPAKAELKSPVSEQRSKSGSSK
SENTVRIIKSPLEGCYAQIHLSDRDIPIKIVVLEKGKHPLGATVRNEKEA
VIVGRIVVGGIAHKSGLLKEGDELLSVNELELTGKDVNEVSDILARISGT
VRFTVASVNDSYSGSMNRPQNGVTIHLKALFTYKPDDDAYIPCVDIGLAF
NRGEILHVTNVQDPNWWQAYRDDDGRDSGSLAGLAGLIPSPDYQYQREML
KKQLSGNEAALNIYASTRQQSSILCLKKNKRNYQTFNNGGWVYNVDTNGK
LPNTENNRQKSNKKKRSTYCPADLELNQIDPNISTYEEVQMFIPQPHRKR
PIVLVGPELIGRHDLLKMIIASDPEQFALLKQHTTDHSKEGGNYKIVSKE
EFKFMQNQEEFIETATFEKNWYGISKSELKLIIDAGKTALLILQPESLRA
IRKTTFIPYVIFISPPTSIELLRKLRMTLEKIRPSDDELVTTIDRANAID
MMFGQFFDSVLVVHSLDSALETALKIIKSLDRDPQWVPSRWLGQRPMSQQ
SLIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005912adherens junction
GO:0005923bicellular tight junction
GO:0012505endomembrane system
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
GO:0030424axon
GO:0042995cell projection
GO:0043204perikaryon
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR031185MPP5
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR008145GK/Ca_channel_bsu
IPR001478PDZ
IPR027417P-loop_NTPase
IPR011511SH3_2
IPR008144Guanylate_kin-like_dom
Vocabulary: biological process
TermDefinition
GO:0070830bicellular tight junction assembly
GO:0090162establishment of epithelial cell polarity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 375..447
e-value: 5.2E-4
score: 29.3
IPR001452SH3 domainPFAMPF07653SH3_2coord: 377..440
e-value: 6.8E-6
score: 25.7
IPR001452SH3 domainPROSITEPS50002SH3coord: 372..448
score: 12.828
IPR008145Guanylate kinase/L-type calcium channel beta subunitSMARTSM00072gk_7coord: 548..731
e-value: 5.8E-21
score: 85.7
IPR008145Guanylate kinase/L-type calcium channel beta subunitPFAMPF00625Guanylate_kincoord: 549..728
e-value: 4.6E-28
score: 98.1
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 288..359
e-value: 2.1E-10
score: 50.6
IPR001478PDZ domainPFAMPF00595PDZcoord: 282..355
e-value: 9.1E-8
score: 32.4
IPR001478PDZ domainPROSITEPS50106PDZcoord: 280..359
score: 14.596
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 361..537
e-value: 8.9E-23
score: 82.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 538..742
e-value: 1.3E-47
score: 163.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 219..253
NoneNo IPR availablePANTHERPTHR23122MEMBRANE-ASSOCIATED GUANYLATE KINASE MAGUKcoord: 14..742
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 278..356
e-value: 5.72347E-15
score: 68.3622
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 276..360
e-value: 1.4E-20
score: 74.6
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 275..358
IPR031185MAGUK p55 subfamily member 5PANTHERPTHR23122:SF14MAGUK P55 SUBFAMILY MEMBER 5coord: 14..742
IPR008144Guanylate kinase-like domainPROSITEPS50052GUANYLATE_KINASE_2coord: 549..728
score: 26.382
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 369..469
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 546..739