max-like protein x

Overview
Namemax-like protein x (AKG62113.1)
Smed IDSMED30010649
Length (bp)1205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of max-like protein x (SMED30010649) t-SNE clustered cells

Violin plots show distribution of expression levels for max-like protein x (SMED30010649) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of max-like protein x (SMED30010649) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for max-like protein x (SMED30010649) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010649

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010649h1SMcG0018894 dd_Smed_v4_3140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
stem cellSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30010649h1SMcG0018894 HO006087smed_ncbi_20240424PMID:24173799
Cowles et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of max-like protein x vs. Ensembl Human
Match: MLX (MAX dimerization protein MLX [Source:HGNC Symbol;Acc:HGNC:11645])

HSP 1 Score: 104.375 bits (259), Expect = 1.757e-25
Identity = 69/165 (41.82%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+CKPQ L  +V  VL
Sbjct:   43 KDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVL 206          
BLAST of max-like protein x vs. Ensembl Human
Match: MLX (MAX dimerization protein MLX [Source:HGNC Symbol;Acc:HGNC:11645])

HSP 1 Score: 104.76 bits (260), Expect = 2.165e-25
Identity = 77/189 (40.74%), Postives = 114/189 (60.32%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV + + DED D      +   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+CKPQ L  +V  VL
Sbjct:   50 ASSVPNTD-DEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVL 236          
BLAST of max-like protein x vs. Ensembl Human
Match: MLX (MAX dimerization protein MLX [Source:HGNC Symbol;Acc:HGNC:11645])

HSP 1 Score: 105.531 bits (262), Expect = 4.141e-25
Identity = 77/189 (40.74%), Postives = 114/189 (60.32%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV + + DED D      +   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+CKPQ L  +V  VL
Sbjct:  104 ASSVPNTD-DEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVL 290          
BLAST of max-like protein x vs. Ensembl Human
Match: MLX (MAX dimerization protein MLX [Source:HGNC Symbol;Acc:HGNC:11645])

HSP 1 Score: 94.3597 bits (233), Expect = 1.690e-21
Identity = 67/168 (39.88%), Postives = 101/168 (60.12%), Query Frame = 2
Query:  188 DEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCK 670
            DED D      +   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+CK
Sbjct:   82 DEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCK 248          
BLAST of max-like protein x vs. Ensembl Celegans
Match: mml-1 (pep chromosome:WBcel235:III:7370131:7374731:-1 gene:WBGene00003378.1 transcript:T20B12.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mml-1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.603e-6
Identity = 24/57 (42.11%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSL 394
            ++R+R LH  AEQ RR A+K G+D LM +I P   + G K + A +L ++   IR L
Sbjct:  801 EERKRILHLHAEQNRRSALKDGFDQLMDII-PDLYSGGVKPTNAVVLAKSADHIRRL 856          
BLAST of max-like protein x vs. Ensembl Celegans
Match: mml-1 (pep chromosome:WBcel235:III:7370149:7374731:-1 gene:WBGene00003378.1 transcript:T20B12.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mml-1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.670e-6
Identity = 24/57 (42.11%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSL 394
            ++R+R LH  AEQ RR A+K G+D LM +I P   + G K + A +L ++   IR L
Sbjct:  801 EERKRILHLHAEQNRRSALKDGFDQLMDII-PDLYSGGVKPTNAVVLAKSADHIRRL 856          
BLAST of max-like protein x vs. Ensembl Fly
Match: bigmax (gene:FBgn0039509 transcript:FBtr0085173)

HSP 1 Score: 97.8265 bits (242), Expect = 3.977e-23
Identity = 69/164 (42.07%), Postives = 102/164 (62.20%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETN---GTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            K+RRRE HTQAEQ+RRDAIK GYDSL  L+ P  + N   G KLSKA ILQ++I  I  L++Q   +E E   L+ E+ ALRI+ + YE M +  +     EE   + ++ KF++F   ++++F++F +    +NF   +T II W+EE+CKP  L  ++   L
Sbjct:   69 KERRREAHTQAEQKRRDAIKKGYDSLQELV-PRCQPNDSSGYKLSKALILQKSIEYIGYLNQQKLKQEDEGSALQKEVTALRIIKNGYENMLQHQQANPGPEEAR-LTDEAKFQVFQAIMEEMFETF-QHIPMENFKQLTTGIIPWLEEHCKPHILRNILSRTL 229          
BLAST of max-like protein x vs. Ensembl Fly
Match: Mondo (gene:FBgn0032940 transcript:FBtr0081527)

HSP 1 Score: 48.9062 bits (115), Expect = 7.110e-6
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  221 RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSI 412
            R  +RR  H  AEQ+RR  IK+G+D+L  LI         KLSKA +LQ+    I+ L ++ ++
Sbjct:  714 RDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLSKAAMLQKGADHIKQLRQERNV 777          
BLAST of max-like protein x vs. Ensembl Fly
Match: Mondo (gene:FBgn0032940 transcript:FBtr0301458)

HSP 1 Score: 48.9062 bits (115), Expect = 7.522e-6
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  221 RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSI 412
            R  +RR  H  AEQ+RR  IK+G+D+L  LI         KLSKA +LQ+    I+ L ++ ++
Sbjct:  908 RDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLSKAAMLQKGADHIKQLRQERNV 971          
BLAST of max-like protein x vs. Ensembl Fly
Match: Mondo (gene:FBgn0032940 transcript:FBtr0301457)

HSP 1 Score: 48.9062 bits (115), Expect = 7.522e-6
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  221 RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSI 412
            R  +RR  H  AEQ+RR  IK+G+D+L  LI         KLSKA +LQ+    I+ L ++ ++
Sbjct:  908 RDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLSKAAMLQKGADHIKQLRQERNV 971          
BLAST of max-like protein x vs. Ensembl Fly
Match: Mondo (gene:FBgn0032940 transcript:FBtr0301462)

HSP 1 Score: 48.9062 bits (115), Expect = 7.522e-6
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 2
Query:  221 RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSI 412
            R  +RR  H  AEQ+RR  IK+G+D+L  LI         KLSKA +LQ+    I+ L ++ ++
Sbjct:  908 RDTQRRAGHIHAEQKRRYNIKNGFDTLHALIPQLQLNPNAKLSKAAMLQKGADHIKQLRQERNV 971          
BLAST of max-like protein x vs. Ensembl Zebrafish
Match: mlx (MAX dimerization protein MLX [Source:ZFIN;Acc:ZDB-GENE-050522-316])

HSP 1 Score: 74.7146 bits (182), Expect = 6.596e-15
Identity = 59/163 (36.20%), Postives = 93/163 (57.06%), Query Frame = 2
Query:  245 HTQAEQRRRDAIKSGYDSLMPLIHPASETNG------TKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDV 715
            HT+ + R    IK GYD L  ++ P  +          K+SKAT+LQ+TI  I+ L ++   +E+++  L+ E+ AL+IM +NYE + K ++N  + + + +V +QVKF +F   +  LFQSF  S    +F   S  +  W+EE+CKPQ L   V +VL  V
Sbjct:   65 HTRRQSRNAGIIKKGYDDLQSIV-PTCQQQSDFSMATQKMSKATVLQKTIDYIQFLHKEKKKQEEDVSTLRKEVMALKIMKTNYEHIVKAHQNNPQ-QGSEQVSDQVKFSVFQSIMDSLFQSFSASVSVSSFQELSACVFSWIEEHCKPQTLREFVVTVLQQV 225          
BLAST of max-like protein x vs. Ensembl Xenopus
Match: MLX (MLX, MAX dimerization protein [Source:NCBI gene;Acc:101732928])

HSP 1 Score: 124.79 bits (312), Expect = 1.329e-32
Identity = 82/220 (37.27%), Postives = 133/220 (60.45%), Query Frame = 2
Query:   89 YSKALMYNVNNPSNMYDQSQIVKIASSVSSQNS-------DEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETN---GT-KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ++  +M+N+   S + ++  +V  A+S+ S ++       DED D     I+   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + +   GT KLSKA +LQ+TI  I+ L+++   +E ++  L+ E+ AL+IM SNYE++ K ++N +  E T++VP+++KF +F   +  LF +F+ S   ++F   S  +  W+EE+CKPQ L  +V   L
Sbjct:   34 HAGGVMFNLEVESGLINKGSLVSRANSIGSTSASSVPNTDDEDSDDRQETIKNDYKDRRRRAHTQAEQKRRDAIKKGYDDLQCIVPTCQQQDIAIGTQKLSKAVVLQKTIDYIQFLNKEKKKQEDDVSTLRKEVMALQIMKSNYEQIVKAHQNNLH-EGTDQVPDEMKFRVFQGIMDSLFHTFNSSVSVNSFQELSACVFAWIEEHCKPQTLQDIVIRFL 252          
BLAST of max-like protein x vs. Ensembl Xenopus
Match: MLX (MLX, MAX dimerization protein [Source:NCBI gene;Acc:101732928])

HSP 1 Score: 120.939 bits (302), Expect = 1.134e-31
Identity = 81/205 (39.51%), Postives = 125/205 (60.98%), Query Frame = 2
Query:  122 PSNMYDQSQIVKIASSVSSQNS-------DEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETN---GT-KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLV 694
            PSN   +  +V  A+S+ S ++       DED D     I+   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + +   GT KLSKA +LQ+TI  I+ L+++   +E ++  L+ E+ AL+IM SNYE++ K ++N +  E T++VP+++KF +F   +  LF +F+ S   ++F   S  +  W+EE+CKPQ L  +V
Sbjct:    2 PSNWLQKGSLVSRANSIGSTSASSVPNTDDEDSDDRQETIKNDYKDRRRRAHTQAEQKRRDAIKKGYDDLQCIVPTCQQQDIAIGTQKLSKAVVLQKTIDYIQFLNKEKKKQEDDVSTLRKEVMALQIMKSNYEQIVKAHQNNLH-EGTDQVPDEMKFRVFQGIMDSLFHTFNSSVSVNSFQELSACVFAWIEEHCKPQTLQDIV 205          
BLAST of max-like protein x vs. Ensembl Xenopus
Match: MLX (MLX, MAX dimerization protein [Source:NCBI gene;Acc:101732928])

HSP 1 Score: 114.005 bits (284), Expect = 5.387e-29
Identity = 76/179 (42.46%), Postives = 115/179 (64.25%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETN---GT-KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQ 676
            ASSV + + DED D     I+   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + +   GT KLSKA +LQ+TI  I+ L+++   +E ++  L+ E+ AL+IM SNYE++ K ++N +  E T++VP+++KF +F   +  LF +F+ S   ++F   S  +  W+EE+CKPQ
Sbjct:   19 ASSVPNTD-DEDSDDRQETIKNDYKDRRRRAHTQAEQKRRDAIKKGYDDLQCIVPTCQQQDIAIGTQKLSKAVVLQKTIDYIQFLNKEKKKQEDDVSTLRKEVMALQIMKSNYEQIVKAHQNNLH-EGTDQVPDEMKFRVFQGIMDSLFHTFNSSVSVNSFQELSACVFAWIEEHCKPQ 195          
BLAST of max-like protein x vs. Ensembl Mouse
Match: Mlx (MAX-like protein X [Source:MGI Symbol;Acc:MGI:108398])

HSP 1 Score: 102.834 bits (255), Expect = 4.198e-25
Identity = 68/165 (41.21%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+C+PQ L  +V  VL
Sbjct:   43 KDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQTLREIVIGVL 206          
BLAST of max-like protein x vs. Ensembl Mouse
Match: Mlx (MAX-like protein X [Source:MGI Symbol;Acc:MGI:108398])

HSP 1 Score: 103.219 bits (256), Expect = 6.886e-25
Identity = 68/165 (41.21%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+C+PQ L  +V  VL
Sbjct:   73 KDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQTLREIVIGVL 236          
BLAST of max-like protein x vs. Ensembl Mouse
Match: Mlx (MAX-like protein X [Source:MGI Symbol;Acc:MGI:108398])

HSP 1 Score: 103.219 bits (256), Expect = 1.908e-24
Identity = 68/165 (41.21%), Postives = 103/165 (62.42%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+C+PQ L  +V  VL
Sbjct:  127 KDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQTLREIVIGVL 290          
BLAST of max-like protein x vs. Ensembl Mouse
Match: Mlx (MAX-like protein X [Source:MGI Symbol;Acc:MGI:108398])

HSP 1 Score: 49.2914 bits (116), Expect = 5.655e-7
Identity = 21/30 (70.00%), Postives = 24/30 (80.00%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLI 313
            KDRRR  HTQAEQ+RRDAIK GYD L  ++
Sbjct:   97 KDRRRRAHTQAEQKRRDAIKRGYDDLQTIV 126          
BLAST of max-like protein x vs. UniProt/SwissProt
Match: sp|Q9UH92|MLX_HUMAN (Max-like protein X OS=Homo sapiens OX=9606 GN=MLX PE=1 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 1.988e-24
Identity = 77/189 (40.74%), Postives = 114/189 (60.32%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV + + DED D      +   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+CKPQ L  +V  VL
Sbjct:  104 ASSVPNTD-DEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVL 290          
BLAST of max-like protein x vs. UniProt/SwissProt
Match: sp|O08609|MLX_MOUSE (Max-like protein X OS=Mus musculus OX=10090 GN=Mlx PE=1 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.142e-24
Identity = 76/189 (40.21%), Postives = 114/189 (60.32%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIR---KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGT----KLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV + + DED D      +   KDRRR  HTQAEQ+RRDAIK GYD L  ++    + + +    KLSKA +LQ+TI  I+ L ++   +E+E+  L+ ++ AL+IM  NYE++ K +++    E  ++V +QVKF +F   +  LFQSF+ S    +F   S  +  W+EE+C+PQ L  +V  VL
Sbjct:  104 ASSVPNTD-DEDSDYQQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDN-PHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCEPQTLREIVIGVL 290          
BLAST of max-like protein x vs. TrEMBL
Match: A0A0F7GXZ2 (Max-like protein x (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 3.038e-158
Identity = 250/251 (99.60%), Postives = 250/251 (99.60%), Query Frame = 2
Query:  371 TISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE 1123
             ISQIRSLSEQTSIKEKELENLKNELFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIFGQFLQQLFQSFDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE
Sbjct:   17 AISQIRSLSEQTSIKEKELENLKNELFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIFGQFLQQLFQSFDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE 267          
BLAST of max-like protein x vs. TrEMBL
Match: A0A0P4VQ84 (Putative bhlhzip transcription factor bigmax (Fragment) OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 6.600e-33
Identity = 90/181 (49.72%), Postives = 118/181 (65.19%), Query Frame = 2
Query:  188 DEDIDTANIMI-RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPA--SETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLS 721
            +ED D  N ++  KDRRRE HTQAEQ+RRDAIK GYDSL  L+     S+ +G KLSKAT+LQ++I  I+ L +Q   +E E   L+ E+ ALRIM +NYE+M K  +NQ    E+  V ++VKF++F   L QLF +F+ S   +NFS  S  I  W+EEYCKPQ L  +V SVL  V S
Sbjct:    2 EEDGDDKNCIVPYKDRRREAHTQAEQKRRDAIKKGYDSLQSLLPTCQQSDISGYKLSKATVLQKSIDYIQFLLQQKKKEEDERNALRKEVIALRIMQANYEQMVKAQENQPGLIESR-VCDEVKFDVFQNILDQLFITFN-SVSVNNFSELSACIFTWLEEYCKPQKLREMVTSVLQRVYS 180          
BLAST of max-like protein x vs. TrEMBL
Match: T1HED9 (BHLH domain-containing protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 3.658e-32
Identity = 84/182 (46.15%), Postives = 111/182 (60.99%), Query Frame = 2
Query:  188 DEDIDTANIMI-RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPA--SETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLSN 724
            +ED D  N ++  KDRRRE HTQAEQ+RRDAIK GYDSL  L+     S+ +G KLSKAT+LQ++I  I+ L +Q   +E E   L+ E+ ALRIM  NYE+M K  +NQ    E+  V ++VKF++       +      S   +NFS  S  I  W+EEYCKPQ L  +V SVL  V S+
Sbjct:    1 EEDGDDKNCIVPYKDRRREAHTQAEQKRRDAIKKGYDSLQSLLPTCQQSDISGYKLSKATVLQKSIDYIQFLLQQKKKEEDERNALRKEVIALRIMQVNYEQMVKAQENQPGLIESR-VCDEVKFDVVCILPLFITF---NSVSVNNFSELSACIFTWLEEYCKPQKLREMVTSVLQRVYSS 178          
BLAST of max-like protein x vs. TrEMBL
Match: A0A224XYZ1 (Putative bhlhzip transcription factor bigmax (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.914e-31
Identity = 88/181 (48.62%), Postives = 117/181 (64.64%), Query Frame = 2
Query:  188 DEDIDTANIMI-RKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPA--SETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLS 721
            +ED D  N ++  KDRRRE HTQAEQ+RRD IK GYDSL  L+     S+ +G KLSKAT+LQ++I  I+ L +Q   +E E   L+ E+ ALRIM +NYE+M K  +NQ    E+  V ++VKF++F   L QLF +F+ S   +NFS  S  I  W+EEYCKPQ L  +V +VL  V S
Sbjct:    2 EEDGDDKNCIVPYKDRRREAHTQAEQKRRDNIKKGYDSLQSLLPTCQQSDISGYKLSKATVLQKSIDYIQFLLQQKKKEEDERNALRKEVIALRIMQANYEQMVKAQENQPGLIESR-VCDEVKFDVFQNILDQLFITFN-SVSVNNFSELSACIFTWLEEYCKPQKLREMVTTVLQRVYS 180          
BLAST of max-like protein x vs. TrEMBL
Match: A0A2R5L8J0 (Putative bhlhzip transcription factor bigmax (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 2.201e-31
Identity = 85/192 (44.27%), Postives = 121/192 (63.02%), Query Frame = 2
Query:  149 IVKIASSVSSQNSD-EDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASE--TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDV 715
            I  I +S S+ N+D ED D  + +  K+RRRE HTQAEQ+RRDAIK GY+ L  L+    +  TN  K+SKA +LQ++I  I  L +Q    E+EL  L+ E+ AL+IM +NYE++ K N+NQ   +  N+V +++KFE+F      LFQSF+ S    NFS  S  +  W+EEYCKPQ L  +V  +L+ +
Sbjct:   37 IDNILTSSSAHNTDDEDSDHKSTLSYKERRREAHTQAEQKRRDAIKKGYEDLQFLVPTCQQDSTNAVKMSKAAVLQKSIDYITFLLQQKKKHEEELNALRKEVVALQIMKTNYEQLVKVNQNQ-PGQNKNQVSDEMKFEVFQAIGDSLFQSFNASVSVSNFSELSGCVFGWLEEYCKPQTLRDMVLQILSQL 227          
BLAST of max-like protein x vs. Ensembl Cavefish
Match: mlx (MAX dimerization protein MLX [Source:NCBI gene;Acc:103046275])

HSP 1 Score: 103.605 bits (257), Expect = 3.455e-25
Identity = 81/190 (42.63%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  161 ASSV---SSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASE--TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV     ++SD   +TA     KDRRR+ HTQAEQ+RRDAIK GYD   S++P     SE      K+SKAT+LQ+TI  I+ L ++   +E+E+  L+ E+ AL+IM +NYE + K ++N  + + + +V +QVKF +F   +  LFQSF  S    +F   S  +  W+EE+CKPQ L   V  VL
Sbjct:   52 ASSVPNTDDEDSDYRHETAYKDSYKDRRRQAHTQAEQKRRDAIKKGYDDLQSIVPTCQQQSEFAMATQKISKATVLQKTIDYIQFLHKEKKKQEEEVSTLRKEVMALKIMKTNYEHIVKAHQNNPQ-QGSEQVSDQVKFSVFQNIMDSLFQSFSTSVSVSSFQELSACVFSWIEEHCKPQTLREFVVGVL 240          
BLAST of max-like protein x vs. Ensembl Cavefish
Match: mlx (MAX dimerization protein MLX [Source:NCBI gene;Acc:103046275])

HSP 1 Score: 103.605 bits (257), Expect = 3.556e-25
Identity = 81/190 (42.63%), Postives = 115/190 (60.53%), Query Frame = 2
Query:  161 ASSV---SSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASE--TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV     ++SD   +TA     KDRRR+ HTQAEQ+RRDAIK GYD   S++P     SE      K+SKAT+LQ+TI  I+ L ++   +E+E+  L+ E+ AL+IM +NYE + K ++N  + + + +V +QVKF +F   +  LFQSF  S    +F   S  +  W+EE+CKPQ L   V  VL
Sbjct:   51 ASSVPNTDDEDSDYRHETAYKDSYKDRRRQAHTQAEQKRRDAIKKGYDDLQSIVPTCQQQSEFAMATQKISKATVLQKTIDYIQFLHKEKKKQEEEVSTLRKEVMALKIMKTNYEHIVKAHQNNPQ-QGSEQVSDQVKFSVFQNIMDSLFQSFSTSVSVSSFQELSACVFSWIEEHCKPQTLREFVVGVL 239          
BLAST of max-like protein x vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005581.1 (pep scaffold:Pmarinus_7.0:GL487226:4176:7420:1 gene:ENSPMAG00000005067.1 transcript:ENSPMAT00000005581.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 4.301e-28
Identity = 77/185 (41.62%), Postives = 114/185 (61.62%), Query Frame = 2
Query:  161 ASSVSSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASE---TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVL 706
            ASSV + + DED D    +  KDRRR+ HTQAEQ+RRDAIK GY+ L  ++    +       K+SKAT+LQR+I  I  L ++   +E+EL  L+ E+ AL+IM SNYE++ + +++  + +   +V ++VKF IF   +  LFQSF+ S    +F   S  +  W+EE+CKPQ L  +V  VL
Sbjct:   56 ASSVPNTD-DEDSDYRQELTYKDRRRQAHTQAEQKRRDAIKKGYEDLQAIVPTCMQQDLIGSQKMSKATVLQRSIDYIHFLHKEKKKQEEELSTLRKEVLALKIMKSNYEQIVRAHQSNPQ-QGQEQVSDEVKFSIFQGIMDTLFQSFNASIAVSSFQELSACVFSWLEEHCKPQTLREIVLGVL 238          
BLAST of max-like protein x vs. Ensembl Sea Lamprey
Match: MLXIPL (MLX interacting protein like [Source:HGNC Symbol;Acc:HGNC:12744])

HSP 1 Score: 48.521 bits (114), Expect = 2.052e-6
Identity = 25/60 (41.67%), Postives = 37/60 (61.67%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQ 403
            +D RR  H  AEQ+RR  IK G+D+L  L+ P +    +K+SKA  LQ+T+  I  L ++
Sbjct:  609 EDSRRVTHISAEQKRRFNIKIGFDTLYNLVSPLNLQPNSKVSKAATLQKTVEYITKLQQE 668          
BLAST of max-like protein x vs. Ensembl Nematostella
Match: EDO46174 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQW2])

HSP 1 Score: 107.842 bits (268), Expect = 1.655e-27
Identity = 77/201 (38.31%), Postives = 120/201 (59.70%), Query Frame = 2
Query:  134 YDQSQIVKIASSVSSQ-NSDED----IDTANIMIRKDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQN-LNVLVESVLT 709
            ++ ++IV ++S +  Q NSD D    +D  +    K  RR  H+ AEQ+RRDAIK GYD   S++P    ++     KLSKA ILQRTI  +  +  Q    E+ELE L+ E+ AL+IM  NYE++A+ + +Q  + +  +V E+ KF +F   L   F +FD +   ++F + S+ I HW+EEYCKPQ  ++ ++ S+ T
Sbjct:    5 WNDTEIVSLSSEIDDQQNSDSDALDELDFDSSSSSKQNRRFAHSVAEQKRRDAIKKGYDDLQSIVPTCQHSTSAGSPKLSKAIILQRTIEYVSFMHHQRKKHEEELEKLRKEVLALKIMKQNYEQIARAHADQPMSGQ--QVSEEAKFSVFKAILDNQFVTFDGTVVVNDFDSLSSGIFHWLEEYCKPQYFMDTVIRSLRT 203          
BLAST of max-like protein x vs. Ensembl Nematostella
Match: EDO27547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8Y7])

HSP 1 Score: 102.064 bits (253), Expect = 5.779e-26
Identity = 66/154 (42.86%), Postives = 93/154 (60.39%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQ 676
            K  RR  H+ AEQ+RRDAIK GYD   S++P    ++     KLSKA ILQRTI  +  +  Q    E+ELE L+ E+ AL+IM  NYE++A+ + +Q       +V E+ KF +F   L   F +FD +   ++F + S+ I HW+EEYCKPQ
Sbjct:   12 KQNRRFAHSVAEQKRRDAIKKGYDDLQSIVPTCQHSTSAGSPKLSKAIILQRTIEYVSFMHHQRKKHEEELEKLRKEVLALKIMKQNYEQIARAHADQ--PMPGQQVSEEAKFSVFKAILDNQFVTFDGTVVVNDFDSLSSGIFHWLEEYCKPQ 163          
BLAST of max-like protein x vs. Ensembl Nematostella
Match: EDO39391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA35])

HSP 1 Score: 45.4394 bits (106), Expect = 9.812e-6
Identity = 21/50 (42.00%), Postives = 32/50 (64.00%), Query Frame = 2
Query:  227 DRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTI 376
            + RR  H  AEQ+RR  IK G+D L  ++   +    +K+SKAT+LQ+T+
Sbjct:    1 EHRRMSHISAEQKRRCNIKMGFDQLASMVPTLASQKSSKVSKATVLQKTV 50          
BLAST of max-like protein x vs. Ensembl Medaka
Match: mlx (MAX dimerization protein MLX [Source:NCBI gene;Acc:101167456])

HSP 1 Score: 106.301 bits (264), Expect = 4.536e-26
Identity = 74/169 (43.79%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASE--TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDV 715
            KDRRR+ HTQAEQ+RRDAIK GYD   S++P     SE      K+SKATILQ+TI  I  L ++   +E+E+  L+ E+ AL+IM +NYE + K +++  +  E ++V +QVKF+IF   +  LF SF  S    +F   S  +  W+EE+CKPQ L   V  VL  +
Sbjct:   79 KDRRRQAHTQAEQKRRDAIKKGYDDLQSIVPTCQQQSEFAVGAQKISKATILQKTIDYIHFLHKEKKKQEEEVSVLRKEVMALKIMKTNYEHIVKAHQSNPQQGE-DQVSDQVKFDIFQSIMDSLFVSFSNSVSVSSFEELSACVFSWIEEHCKPQTLREFVVGVLRQI 246          
BLAST of max-like protein x vs. Ensembl Medaka
Match: mlx (MAX dimerization protein MLX [Source:NCBI gene;Acc:101167456])

HSP 1 Score: 105.916 bits (263), Expect = 5.604e-26
Identity = 74/169 (43.79%), Postives = 104/169 (61.54%), Query Frame = 2
Query:  224 KDRRRELHTQAEQRRRDAIKSGYD---SLMPLIHPASE--TNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDV 715
            KDRRR+ HTQAEQ+RRDAIK GYD   S++P     SE      K+SKATILQ+TI  I  L ++   +E+E+  L+ E+ AL+IM +NYE + K +++  +  E ++V +QVKF+IF   +  LF SF  S    +F   S  +  W+EE+CKPQ L   V  VL  +
Sbjct:   72 KDRRRQAHTQAEQKRRDAIKKGYDDLQSIVPTCQQQSEFAVGAQKISKATILQKTIDYIHFLHKEKKKQEEEVSVLRKEVMALKIMKTNYEHIVKAHQSNPQQGE-DQVSDQVKFDIFQSIMDSLFVSFSNSVSVSSFEELSACVFSWIEEHCKPQTLREFVVGVLRQI 239          
BLAST of max-like protein x vs. Planmine SMEST
Match: SMESG000025391.1 (SMESG000025391.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 339/340 (99.71%), Postives = 340/340 (100.00%), Query Frame = 2
Query:  104 MYNVNNPSNMYDQSQIVKIASSVSSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSIXXXXXXXXXXXXFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIXXXXXXXXXXXXDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTDVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE 1123
            MYNVNNPSNMYDQSQIVKIASSVSSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSIKEKELENLKNELFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIFGQFLQQLFQSFDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLT+VLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE
Sbjct:    1 MYNVNNPSNMYDQSQIVKIASSVSSQNSDEDIDTANIMIRKDRRRELHTQAEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQTSIKEKELENLKNELFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKFEIFGQFLQQLFQSFDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESVLTEVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSYRSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQSLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE 340          
The following BLAST results are available for this feature:
BLAST of max-like protein x vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MLX1.757e-2541.82MAX dimerization protein MLX [Source:HGNC Symbol;A... [more]
MLX2.165e-2540.74MAX dimerization protein MLX [Source:HGNC Symbol;A... [more]
MLX4.141e-2540.74MAX dimerization protein MLX [Source:HGNC Symbol;A... [more]
MLX1.690e-2139.88MAX dimerization protein MLX [Source:HGNC Symbol;A... [more]
back to top
BLAST of max-like protein x vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mml-13.603e-642.11pep chromosome:WBcel235:III:7370131:7374731:-1 gen... [more]
mml-13.670e-642.11pep chromosome:WBcel235:III:7370149:7374731:-1 gen... [more]
back to top
BLAST of max-like protein x vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bigmax3.977e-2342.07gene:FBgn0039509 transcript:FBtr0085173[more]
Mondo7.110e-639.06gene:FBgn0032940 transcript:FBtr0081527[more]
Mondo7.522e-639.06gene:FBgn0032940 transcript:FBtr0301458[more]
Mondo7.522e-639.06gene:FBgn0032940 transcript:FBtr0301457[more]
Mondo7.522e-639.06gene:FBgn0032940 transcript:FBtr0301462[more]
back to top
BLAST of max-like protein x vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mlx6.596e-1536.20MAX dimerization protein MLX [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of max-like protein x vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
MLX1.329e-3237.27MLX, MAX dimerization protein [Source:NCBI gene;Ac... [more]
MLX1.134e-3139.51MLX, MAX dimerization protein [Source:NCBI gene;Ac... [more]
MLX5.387e-2942.46MLX, MAX dimerization protein [Source:NCBI gene;Ac... [more]
back to top
BLAST of max-like protein x vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mlx4.198e-2541.21MAX-like protein X [Source:MGI Symbol;Acc:MGI:1083... [more]
Mlx6.886e-2541.21MAX-like protein X [Source:MGI Symbol;Acc:MGI:1083... [more]
Mlx1.908e-2441.21MAX-like protein X [Source:MGI Symbol;Acc:MGI:1083... [more]
Mlx5.655e-770.00MAX-like protein X [Source:MGI Symbol;Acc:MGI:1083... [more]
back to top
BLAST of max-like protein x vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9UH92|MLX_HUMAN1.988e-2440.74Max-like protein X OS=Homo sapiens OX=9606 GN=MLX ... [more]
sp|O08609|MLX_MOUSE9.142e-2440.21Max-like protein X OS=Mus musculus OX=10090 GN=Mlx... [more]
back to top
BLAST of max-like protein x vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0F7GXZ23.038e-15899.60Max-like protein x (Fragment) OS=Schmidtea mediter... [more]
A0A0P4VQ846.600e-3349.72Putative bhlhzip transcription factor bigmax (Frag... [more]
T1HED93.658e-3246.15BHLH domain-containing protein (Fragment) OS=Rhodn... [more]
A0A224XYZ11.914e-3148.62Putative bhlhzip transcription factor bigmax (Frag... [more]
A0A2R5L8J02.201e-3144.27Putative bhlhzip transcription factor bigmax (Frag... [more]
back to top
BLAST of max-like protein x vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mlx3.455e-2542.63MAX dimerization protein MLX [Source:NCBI gene;Acc... [more]
mlx3.556e-2542.63MAX dimerization protein MLX [Source:NCBI gene;Acc... [more]
back to top
BLAST of max-like protein x vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005581.14.301e-2841.62pep scaffold:Pmarinus_7.0:GL487226:4176:7420:1 gen... [more]
MLXIPL2.052e-641.67MLX interacting protein like [Source:HGNC Symbol;A... [more]
back to top
BLAST of max-like protein x vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of max-like protein x vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO461741.655e-2738.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275475.779e-2642.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393919.812e-642.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of max-like protein x vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mlx4.536e-2643.79MAX dimerization protein MLX [Source:NCBI gene;Acc... [more]
mlx5.604e-2643.79MAX dimerization protein MLX [Source:NCBI gene;Acc... [more]
back to top
BLAST of max-like protein x vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025391.10.000e+099.71SMESG000025391.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30010649
GenBankAKG62113.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010649 ID=SMED30010649|Name=max-like protein x|organism=Schmidtea mediterranea sexual|type=transcript|length=1205bp
CGCAATTTTAAAATAGTAATCTCTTAAATTTTTTCATATTATTACATACA
TATTAGTGTAATAATAATAATAATATTAAATACATAATTATTCAAAAGCT
TTAATGTACAATGTTAATAATCCATCAAACATGTATGATCAATCTCAGAT
TGTTAAAATAGCATCATCGGTATCATCACAAAATTCTGATGAAGATATTG
ACACTGCTAATATTATGATAAGGAAGGATCGACGTAGAGAATTACATACT
CAAGCCGAACAACGTCGTAGAGATGCAATTAAGAGTGGGTATGATTCTTT
AATGCCACTTATTCACCCAGCATCAGAAACAAATGGAACTAAACTCAGTA
AAGCAACCATTTTACAAAGAACAATTTCTCAAATAAGGTCATTAAGTGAA
CAAACGAGTATAAAGGAAAAAGAACTGGAGAATTTAAAAAATGAACTGTT
TGCTCTGCGCATAATGAATTCAAACTATGAGGAAATGGCCAAGTGTAACA
AAAATCAAATTAAAACCGAAGAAACAAACGAAGTGCCTGAACAAGTGAAA
TTTGAAATATTCGGCCAATTTCTCCAGCAGTTGTTTCAGTCCTTCGATAA
AAGCACGAAATTTGACAATTTCTCCACAGCCTCAACGACAATCATTCACT
GGGTGGAGGAATACTGCAAACCCCAGAATCTCAATGTTCTGGTCGAATCG
GTTTTAACGGACGTTCTATCGAATTATCAGAGCTCACAAGATAGAAGAAT
GCCTGTTGATATTCTGTCGACAGCCGACATGAGCATGGATCAGGATAACC
TCAGCACTTATCTGGGATCGCTATCTGACTGCCAGCCAAGCTCGAAATCT
TACCGATCGATGAGCAATCCGAGTGTCACCTTCTGTCCATTGGGGAATAA
TGAATCGAAACCCTTCAAAACATCCAACAGAAGGCAGCCAGGAATGCATC
CATCTCAGCAGGTGAATATACAACCCCAGGTATCGCTACCGTCGGTAATT
CAATCACTTGATCCCTCAATCGATGATGAGTTCATGTCAATTTCACCAAA
TGCACTCGAATTGGCATTTCTTGACTCCTTGGATAACAGCACGCTTATCG
ATGATATTTGGCTGCCATCGGAATGATGACTTGATTTAGGTGCTTGTTAT
CAGTTTTCATTGGCTACTTTTTGTTGCAATAAATATTTCGCTGCTTCAAA
AAAAA
back to top

protein sequence of SMED30010649-orf-1

>SMED30010649-orf-1 ID=SMED30010649-orf-1|Name=SMED30010649-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
MYNVNNPSNMYDQSQIVKIASSVSSQNSDEDIDTANIMIRKDRRRELHTQ
AEQRRRDAIKSGYDSLMPLIHPASETNGTKLSKATILQRTISQIRSLSEQ
TSIKEKELENLKNELFALRIMNSNYEEMAKCNKNQIKTEETNEVPEQVKF
EIFGQFLQQLFQSFDKSTKFDNFSTASTTIIHWVEEYCKPQNLNVLVESV
LTDVLSNYQSSQDRRMPVDILSTADMSMDQDNLSTYLGSLSDCQPSSKSY
RSMSNPSVTFCPLGNNESKPFKTSNRRQPGMHPSQQVNIQPQVSLPSVIQ
SLDPSIDDEFMSISPNALELAFLDSLDNSTLIDDIWLPSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000120progenitor cell
PLANA:0000121stem cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036638HLH_DNA-bd_sf
IPR032647Mlx
IPR011598bHLH_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0008134transcription factor binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 94..128
NoneNo IPR availablePANTHERPTHR15741BASIC HELIX-LOOP-HELIX ZIP TRANSCRIPTION FACTORcoord: 20..204
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainSMARTSM00353finuluscoord: 49..103
e-value: 5.4E-9
score: 45.9
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPFAMPF00010HLHcoord: 44..97
e-value: 1.8E-11
score: 43.8
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainPROSITEPS50888BHLHcoord: 43..97
score: 14.151
IPR011598Myc-type, basic helix-loop-helix (bHLH) domainCDDcd00083HLHcoord: 41..100
e-value: 2.38242E-11
score: 56.4535
IPR036638Helix-loop-helix DNA-binding domain superfamilyGENE3DG3DSA:4.10.280.10coord: 44..120
e-value: 7.1E-14
score: 53.7
IPR036638Helix-loop-helix DNA-binding domain superfamilySUPERFAMILYSSF47459HLH, helix-loop-helix DNA-binding domaincoord: 43..126
IPR032647Max-like protein XPANTHERPTHR15741:SF25MAX-LIKE PROTEIN Xcoord: 20..204