DNA-binding protein inhibitor ID-2
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30010638 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 10
Homology
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Match: ID1 (inhibitor of DNA binding 1, HLH protein [Source:HGNC Symbol;Acc:HGNC:5360]) HSP 1 Score: 61.2326 bits (147), Expect = 3.258e-12 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 68 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 106
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Match: ID1 (inhibitor of DNA binding 1, HLH protein [Source:HGNC Symbol;Acc:HGNC:5360]) HSP 1 Score: 61.2326 bits (147), Expect = 4.107e-12 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 68 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 106
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Match: ID4 (inhibitor of DNA binding 4, HLH protein [Source:HGNC Symbol;Acc:HGNC:5363]) HSP 1 Score: 60.8474 bits (146), Expect = 6.231e-12 Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ L++LVPTIP NKKV+++E+LQHVI+YI DL+ Sbjct: 67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQ 105
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Match: ID2 (inhibitor of DNA binding 2 [Source:HGNC Symbol;Acc:HGNC:5361]) HSP 1 Score: 58.5362 bits (140), Expect = 2.616e-11 Identity = 24/38 (63.16%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NKKV+++E+LQHVI+YI DL+ Sbjct: 39 MNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Match: ID2 (inhibitor of DNA binding 2 [Source:HGNC Symbol;Acc:HGNC:5361]) HSP 1 Score: 58.5362 bits (140), Expect = 2.616e-11 Identity = 24/38 (63.16%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NKKV+++E+LQHVI+YI DL+ Sbjct: 39 MNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Fly
Match: emc (gene:FBgn0000575 transcript:FBtr0072578) HSP 1 Score: 46.9802 bits (110), Expect = 6.216e-7 Identity = 21/39 (53.85%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 EMK ++LK LVP +PKN+K+ ++E++QHVI+YI DL+ Sbjct: 38 EMKMYLSKLKDLVPFMPKNRKLTKLEIIQHVIDYICDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Match: id3 (inhibitor of DNA binding 3 [Source:ZFIN;Acc:ZDB-GENE-020515-1]) HSP 1 Score: 60.077 bits (144), Expect = 3.472e-12 Identity = 24/46 (52.17%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 112 TRSIKSLEMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 + + + M CY++LK+LVP+IP+NK V+Q+E+LQHVI+YI DL+ Sbjct: 34 SEELSDMNMNDCYSKLKELVPSIPQNKSVSQVEILQHVIDYIFDLQ 79
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Match: id4 (inhibitor of DNA binding 4 [Source:ZFIN;Acc:ZDB-GENE-051113-208]) HSP 1 Score: 59.3066 bits (142), Expect = 6.767e-12 Identity = 24/39 (61.54%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPTIP++KKV+++E+LQHVI+YI DL+ Sbjct: 43 DMNDCYSRLKRLVPTIPQDKKVSKVEILQHVIDYILDLQ 81
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Match: id1 (inhibitor of DNA binding 1, HLH protein [Source:ZFIN;Acc:ZDB-GENE-990415-96]) HSP 1 Score: 57.3806 bits (137), Expect = 4.338e-11 Identity = 23/39 (58.97%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY++LK+LVPT+P NKK +++E+LQHVI+YI DL+ Sbjct: 49 DMNSCYSKLKELVPTLPTNKKASKMEILQHVIDYIWDLQ 87
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Match: id2a (inhibitor of DNA binding 2a [Source:ZFIN;Acc:ZDB-GENE-020910-1]) HSP 1 Score: 57.3806 bits (137), Expect = 5.966e-11 Identity = 23/38 (60.53%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NK V+++E+LQHVI+YI DL+ Sbjct: 43 MNDCYSKLKELVPSIPQNKNVSKMEILQHVIDYILDLQ 80
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Match: id2a (inhibitor of DNA binding 2a [Source:ZFIN;Acc:ZDB-GENE-020910-1]) HSP 1 Score: 57.3806 bits (137), Expect = 5.966e-11 Identity = 23/38 (60.53%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NK V+++E+LQHVI+YI DL+ Sbjct: 43 MNDCYSKLKELVPSIPQNKNVSKMEILQHVIDYILDLQ 80
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Xenopus
Match: id4 (inhibitor of DNA binding 4, HLH protein [Source:NCBI gene;Acc:448114]) HSP 1 Score: 60.077 bits (144), Expect = 6.437e-12 Identity = 25/39 (64.10%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPTIP NKKV+++E+LQHVI+YI DL+ Sbjct: 51 DMNDCYSRLKRLVPTIPPNKKVSKVEILQHVIDYILDLQ 89
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Xenopus
Match: id2 (inhibitor of DNA binding 2 [Source:NCBI gene;Acc:394480]) HSP 1 Score: 58.9214 bits (141), Expect = 1.521e-11 Identity = 24/38 (63.16%), Postives = 35/38 (92.11%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NKKV+++E+LQHVI+YI DL+ Sbjct: 39 MNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Xenopus
Match: id3 (inhibitor of DNA binding 3, HLH protein [Source:NCBI gene;Acc:549025]) HSP 1 Score: 56.225 bits (134), Expect = 1.448e-10 Identity = 25/53 (47.17%), Postives = 38/53 (71.70%), Query Frame = 1 Query: 94 HKRLNLTRSIKSL-EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 HK + + L +M CY++LK+LVP IP+ K++Q+E+LQHVI+YI DL+ Sbjct: 33 HKGPGVDEPMGLLYDMNGCYSKLKELVPGIPQGSKLSQVEILQHVIDYIFDLQ 85
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Match: Id1 (inhibitor of DNA binding 1, HLH protein [Source:MGI Symbol;Acc:MGI:96396]) HSP 1 Score: 60.8474 bits (146), Expect = 3.045e-12 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 61 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 99
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Match: Id1 (inhibitor of DNA binding 1, HLH protein [Source:MGI Symbol;Acc:MGI:96396]) HSP 1 Score: 60.8474 bits (146), Expect = 4.406e-12 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 61 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 99
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Match: Id4 (inhibitor of DNA binding 4 [Source:MGI Symbol;Acc:MGI:99414]) HSP 1 Score: 60.4622 bits (145), Expect = 5.116e-12 Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ L++LVPTIP NKKV+++E+LQHVI+YI DL+ Sbjct: 67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQ 105
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Match: Id2 (inhibitor of DNA binding 2 [Source:MGI Symbol;Acc:MGI:96397]) HSP 1 Score: 58.151 bits (139), Expect = 2.832e-11 Identity = 24/38 (63.16%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NKKV ++E+LQHVI+YI DL+ Sbjct: 39 MNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Match: Id2 (inhibitor of DNA binding 2 [Source:MGI Symbol;Acc:MGI:96397]) HSP 1 Score: 58.151 bits (139), Expect = 2.832e-11 Identity = 24/38 (63.16%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NKKV ++E+LQHVI+YI DL+ Sbjct: 39 MNDCYSKLKELVPSIPQNKKVTKMEILQHVIDYILDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Match: sp|P41134|ID1_HUMAN (DNA-binding protein inhibitor ID-1 OS=Homo sapiens OX=9606 GN=ID1 PE=1 SV=3) HSP 1 Score: 61.2326 bits (147), Expect = 1.973e-11 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 68 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 106
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Match: sp|P41135|ID1_RAT (DNA-binding protein inhibitor ID-1 OS=Rattus norvegicus OX=10116 GN=Id1 PE=1 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 2.506e-11 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 61 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 99
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Match: sp|P47928|ID4_HUMAN (DNA-binding protein inhibitor ID-4 OS=Homo sapiens OX=9606 GN=ID4 PE=1 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 2.992e-11 Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ L++LVPTIP NKKV+++E+LQHVI+YI DL+ Sbjct: 67 DMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQ 105
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Match: sp|P20067|ID1_MOUSE (DNA-binding protein inhibitor ID-1 OS=Mus musculus OX=10090 GN=Id1 PE=1 SV=3) HSP 1 Score: 60.8474 bits (146), Expect = 3.082e-11 Identity = 23/39 (58.97%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPT+P+N+KV+++E+LQHVI+YI+DL+ Sbjct: 61 DMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQ 99
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Match: sp|Q6GL62|ID4_XENTR (DNA-binding protein inhibitor ID-4 OS=Xenopus tropicalis OX=8364 GN=id4 PE=2 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 3.410e-11 Identity = 25/39 (64.10%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPTIP NKKV+++E+LQHVI+YI DL+ Sbjct: 51 DMNDCYSRLKRLVPTIPPNKKVSKVEILQHVIDYILDLQ 89
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Match: U5YTC3 (Id4 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=id4 PE=2 SV=1) HSP 1 Score: 75.0998 bits (183), Expect = 2.142e-15 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 1 Query: 163 KLVPTIPKNKKVNQIELLQHVINYIQDLEXXXXXXXXXXXQTEQKLEKSQ 312 KLVPTIPKNKKVNQIELLQHVINYIQDLELILLLSSKSISQTEQKLEKSQ Sbjct: 1 KLVPTIPKNKKVNQIELLQHVINYIQDLELILLLSSKSISQTEQKLEKSQ 50
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Match: C1LEX6 (Basic helix-loop-helix dimerisation region bHLH,domain-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_009386 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.515e-11 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 EMK+C +LKK+VPTI +NKKVNQ+ELLQHVI+YIQDLE Sbjct: 31 EMKRCLVKLKKMVPTIERNKKVNQLELLQHVIDYIQDLE 69
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Match: A0A4Z2DRI7 (DNA-binding protein inhibitor ID-2-A isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009386 PE=4 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 1.742e-11 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 EMK+C +LKK+VPTI +NKKVNQ+ELLQHVI+YIQDLE Sbjct: 31 EMKRCLVKLKKMVPTIERNKKVNQLELLQHVIDYIQDLE 69
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Match: A0A430QSA9 (BHLH domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0006509 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 2.163e-11 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 EMK+C +LKK+VPTI +NKKVNQ+ELLQHVI+YIQDLE Sbjct: 31 EMKRCLVKLKKMVPTIERNKKVNQLELLQHVIDYIQDLE 69
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Match: A0A183NJG0 (BHLH domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS2246 PE=4 SV=1) HSP 1 Score: 65.855 bits (159), Expect = 2.163e-11 Identity = 30/39 (76.92%), Postives = 36/39 (92.31%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 EMK+C +LKK+VPTI +NKKVNQ+ELLQHVI+YIQDLE Sbjct: 31 EMKRCLVKLKKMVPTIERNKKVNQLELLQHVIDYIQDLE 69
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Match: id3 (inhibitor of DNA binding 3, HLH protein [Source:NCBI gene;Acc:103027061]) HSP 1 Score: 58.9214 bits (141), Expect = 6.248e-12 Identity = 26/55 (47.27%), Postives = 41/55 (74.55%), Query Frame = 1 Query: 94 HKRLNLTRSIKSLE---MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 + L+++RS E M CY+ LK+LVP+IP+++ V+Q+E+LQHVI+YI DL+ Sbjct: 22 EQSLSISRSRSPAELSDMNDCYSRLKELVPSIPQDRSVSQVEILQHVIDYIFDLQ 76
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Match: id4 (inhibitor of DNA binding 4, HLH protein [Source:NCBI gene;Acc:103041967]) HSP 1 Score: 57.7658 bits (138), Expect = 2.307e-11 Identity = 23/39 (58.97%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ L++LVPTIP +KKV+++E+LQHVI+YI DL+ Sbjct: 46 DMNDCYSRLRRLVPTIPPHKKVSRVEILQHVIDYILDLQ 84
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Match: id4 (inhibitor of DNA binding 4, HLH protein [Source:NCBI gene;Acc:103041967]) HSP 1 Score: 57.7658 bits (138), Expect = 2.307e-11 Identity = 23/39 (58.97%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ L++LVPTIP +KKV+++E+LQHVI+YI DL+ Sbjct: 46 DMNDCYSRLRRLVPTIPPHKKVSRVEILQHVIDYILDLQ 84
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Match: id1 (DNA-binding protein inhibitor ID-1-like [Source:NCBI gene;Acc:103047891]) HSP 1 Score: 57.7658 bits (138), Expect = 2.815e-11 Identity = 24/39 (61.54%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CYT+LK+LVPT+P NKK +++E+LQHVI+YI DL+ Sbjct: 48 DMNSCYTKLKELVPTLPANKKHSKVEILQHVIDYIWDLQ 86
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Match: ENSAMXT00000051460.1 (DNA-binding protein inhibitor ID-1-like [Source:NCBI gene;Acc:103045393]) HSP 1 Score: 56.9954 bits (136), Expect = 5.006e-11 Identity = 23/39 (58.97%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY++LK+LVPT+P NKK +++E+LQHVI+YI DL+ Sbjct: 41 DMNSCYSKLKELVPTLPANKKHSKVEILQHVIDYIWDLQ 79
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Sea Lamprey
Match: id4 (inhibitor of DNA binding 4 [Source:ZFIN;Acc:ZDB-GENE-051113-208]) HSP 1 Score: 47.3654 bits (111), Expect = 2.726e-8 Identity = 20/40 (50.00%), Postives = 31/40 (77.50%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPK-NKKVNQIELLQHVINYIQDLE 249 +MK CY+ L +LVPT+ +K +++E+LQHVI+YI DL+ Sbjct: 32 DMKGCYSRLSQLVPTLATTGRKASRMEILQHVIDYILDLQ 71
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Nematostella
Match: EDO44627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVE5]) HSP 1 Score: 47.7506 bits (112), Expect = 7.013e-8 Identity = 17/38 (44.74%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M +CY LK +VP +P ++++++E+LQ+VI+YI DL+ Sbjct: 43 MSECYERLKNMVPNVPVGRRISKVEILQYVIDYILDLQ 80
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Medaka
Match: id3 (inhibitor of DNA binding 3, HLH protein [Source:NCBI gene;Acc:101164112]) HSP 1 Score: 60.077 bits (144), Expect = 2.662e-12 Identity = 30/67 (44.78%), Postives = 45/67 (67.16%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLEXXXXXXXXXXXQTEQKLEKSQ*KSNFNK 333 +M CY+ LK+LVP+IP+NK V+Q+E+LQHVI+YI DL++ L S + ++ S NF+K Sbjct: 45 DMNDCYSRLKELVPSIPQNKSVSQVEILQHVIDYIFDLQIALEAVDPSAPEMVLSIKTSDITRNFSK 111
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Medaka
Match: id4 (DNA-binding protein inhibitor ID-4 [Source:NCBI gene;Acc:101162314]) HSP 1 Score: 58.9214 bits (141), Expect = 1.269e-11 Identity = 24/39 (61.54%), Postives = 35/39 (89.74%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY+ LK+LVPTIP++KKV+++E+LQHVI+YI DL+ Sbjct: 47 DMNDCYSRLKRLVPTIPQDKKVSKVEILQHVIDYILDLQ 85
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Medaka
Match: id1 (DNA-binding protein inhibitor ID-1 [Source:NCBI gene;Acc:101161879]) HSP 1 Score: 58.9214 bits (141), Expect = 1.544e-11 Identity = 23/39 (58.97%), Postives = 34/39 (87.18%), Query Frame = 1 Query: 133 EMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 +M CY++LK+LVPT+P NKK +++E+LQHVI+YI DL+ Sbjct: 75 DMNSCYSKLKELVPTLPTNKKASKVEILQHVIDYIWDLQ 113
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Medaka
Match: id2a (inhibitor of DNA binding 2 [Source:NCBI gene;Acc:101169826]) HSP 1 Score: 56.9954 bits (136), Expect = 6.544e-11 Identity = 23/38 (60.53%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 136 MKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLE 249 M CY++LK+LVP+IP+NK V+++E+LQHVI+YI DL+ Sbjct: 41 MNDCYSKLKELVPSIPQNKNVSKMEILQHVIDYILDLQ 78
BLAST of DNA-binding protein inhibitor ID-2 vs. Planmine SMEST
Match: SMESG000017492.1 (SMESG000017492.1) HSP 1 Score: 121.709 bits (304), Expect = 3.693e-37 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 1 Query: 91 MHKRLNLTRSIKSLEMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLEXXXXXXXXXXXQTEQKLEKSQ 312 MHKRLNLTRSIKSLEMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLELILLLSSKSISQTEQKLEKSQ Sbjct: 1 MHKRLNLTRSIKSLEMKKCYTELKKLVPTIPKNKKVNQIELLQHVINYIQDLELILLLSSKSISQTEQKLEKSQ 74 The following BLAST results are available for this feature:
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 1
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 3
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 5
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 1
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of DNA-binding protein inhibitor ID-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 4
BLAST of DNA-binding protein inhibitor ID-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30010638 ID=SMED30010638|Name=DNA-binding protein inhibitor ID-2|organism=Schmidtea mediterranea sexual|type=transcript|length=414bpback to top protein sequence of SMED30010638-orf-1 >SMED30010638-orf-1 ID=SMED30010638-orf-1|Name=SMED30010638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp RSHFCIFKSRRYNFGNSMTIHFYKKTQYYNMHKRLNLTRSIKSLEMKKCYback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|