Nucleolar RNA helicase II/Gu protein

Overview
NameNucleolar RNA helicase II/Gu protein
Smed IDSMED30010637
Length (bp)2478
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar RNA helicase II/Gu protein (SMED30010637) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar RNA helicase II/Gu protein (SMED30010637) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar RNA helicase II/Gu protein (SMED30010637) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar RNA helicase II/Gu protein (SMED30010637) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010637

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010637SMESG000065959.1 dd_Smed_v4_283_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010637SMESG000065959.1 Contig39846uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30010637SMESG000065959.1 Contig39846newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30010637SMESG000065959.1 dd_Smed_v6_283_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30010637SMESG000065959.1 dd_Smed_v6_283_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30010637SMESG000065959.1 dd_Smed_v6_283_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Match: DDX21 (DExD-box helicase 21 [Source:HGNC Symbol;Acc:HGNC:2744])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 279/540 (51.67%), Postives = 367/540 (67.96%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELE 1834
            E  EG  +NFP+S E  K L+ RGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL       K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q   +++G+DI+ G PGR++D I  G+LDL+++++V+LDEVD+MLDMGF+D V+EILS  Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   K A TVEHLAI+C W +RA  I D+IRVY G +  R IIFCE KK+A EL+ +SA+K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLVIQ  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L + I  +VK + F+KG+ G+ FD+P      ++  W D +   L    + PELE
Sbjct:  182 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSG-HQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELE 715          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Match: DDX21 (DExD-box helicase 21 [Source:HGNC Symbol;Acc:HGNC:2744])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 279/540 (51.67%), Postives = 367/540 (67.96%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELE 1834
            E  EG  +NFP+S E  K L+ RGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL       K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q   +++G+DI+ G PGR++D I  G+LDL+++++V+LDEVD+MLDMGF+D V+EILS  Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   K A TVEHLAI+C W +RA  I D+IRVY G +  R IIFCE KK+A EL+ +SA+K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLVIQ  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L + I  +VK + F+KG+ G+ FD+P      ++  W D +   L    + PELE
Sbjct:  114 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSG-HQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELE 647          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Match: DDX50 (DExD-box helicase 50 [Source:HGNC Symbol;Acc:HGNC:17906])

HSP 1 Score: 527.709 bits (1358), Expect = 1.389e-176
Identity = 262/544 (48.16%), Postives = 369/544 (67.83%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NFP+S E  K L+ RGV  LFPIQ+KTF  ++EGKD+IAQA+TGTGKTF+FA+P+I +L+    ++K  R PKV+V+APTREL +Q+A DF+ +T  KL     YGG SY  Q++ +++G+DI+ G PGR++D +  G+LDLS++ +V+LDEVD+MLD+GF++ V++I+   Y  D+ DN   PQTLLFSAT P W++K+ KKY+++    + LV K   KAA+TVEHLAIQC W +R   I D+++VY G +  R IIFCE KK+  E+A +  +K +   LHGD+ Q +RE+ LK FREG + VLV TNVAARGLD+P++DLVIQ  PP+DVE YIHRSGRTGRAGR G+CICF++P+E+  L+ VE  AG TFKR+  PS   ++++  +D I++  S+     D F+ SA +LIE  GA  A+A ALA ISG     + RSL++S +GF T  L + +EI+    A+  L + L  N V Q+  +  +KG  G+ FD+P    E ++  W D  +  L     +PE+EE  D
Sbjct:  133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDN---PQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSG-SEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISG-ASSFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDW-ILSVPAKLPEIEEYYD 669          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Match: DDX50 (DExD-box helicase 50 [Source:HGNC Symbol;Acc:HGNC:17906])

HSP 1 Score: 512.686 bits (1319), Expect = 8.862e-171
Identity = 259/544 (47.61%), Postives = 367/544 (67.46%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NFP+S E  K L+ RGV  LFPIQ+KTF  ++EGKD+IAQA+TGTGKTF+FA+P+I +L+    ++K  R PKV+V+APTREL +Q+A DF+ +T  KL     YGG SY  Q++ +++G+DI+ G PGR++D +  G+LDLS++ +V+LDEVD+MLD+GF++ V++I+   Y  D+ DN   PQTLLFSAT P W++K+ KKY+++    + LV K   KAA+TVEHLAIQC W +R   I D+++VY G +  R IIFCE KK+  E+A +  +K +   LHGD+ Q +RE+ LK FREG + VLV TNVAARGLD+P++DLVIQ  PP+DVE YIHRSGRTGRAGR G+CICF++P+E+  L+ VE  AG TFKR+  PS   ++++  +D I++  S+  + A  F     +LIE  GA  A+A ALA ISG     + RSL++S +GF T  L + +E  ++  A+  L + L  N V Q+  +  +KG  G+ FD+P    E ++  W D  +  L     +PE+EE  D
Sbjct:  132 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDN---PQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSG-SEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASV--SYAAIFSDHQLRLIEEKGAVDALAAALAHISG-ASSFEPRSLITSDKGFVTMTLESLEE--YRMSAWKELNRKLSSNAVSQITRMCLLKGIWGVCFDVPTTESERLQAEWHDSDW-ILSVPAKLPEIEEYYD 664          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 214.927 bits (546), Expect = 9.446e-60
Identity = 125/360 (34.72%), Postives = 203/360 (56.39%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLEN---VSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFE 1312
            L   L  N+   G   L P+Q  +   I  G+D++A A+TG+GKT AF LP++  + +    +   K  ++P+ I++APTRELV+QI  +    +  + ++ + IYGG      +  +  G +I+   PGR+ D+I + ++ L QI+Y++LDE DRMLDMGF   + +++S         +K + QTL+FSAT P+ I ++  ++L+++ + + + + G   A   V+   +Q     +   + +I+R  G   + R ++F E KK AD +A+     K     +HGD  Q +RE  L  FR GK  VLV T+VAARGLD+ ++  VI    P  +++Y+HR GRTGR G  G  I FF+
Sbjct:  146 LCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQIVQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDMGFGPEMKKLISC----PGMPSKEQRQTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGG--ACRDVQQTVLQVGQFSKREKLVEILRNIG---DERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFD 496          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Match: Y54G11A.3 (pep chromosome:WBcel235:II:14276621:14283973:1 gene:WBGene00013214.1 transcript:Y54G11A.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54G11A.3)

HSP 1 Score: 214.157 bits (544), Expect = 1.180e-60
Identity = 138/372 (37.10%), Postives = 197/372 (52.96%), Query Frame = 2
Query:  236 NNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVI-------TKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTL--LFSATMPDWIHKIVKKYLRTD--AVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGG--GNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            +N  +  E++KN    G +   PIQ + +  +  G+D I  ++TG+GKT AF LP +        + E      KP   P V+V++PTREL  QI  + +  + +  K++ +YGG S  +QV A + GV+IV   PGR+ DL + G + L+ + YV+LDE DRMLDMGF   +  IL  I          RP  L  L SAT P+ + K+  KY +    AVN  L    D  +  +V       P   R   + +I+       G N + IIF + K  AD L+S   MK  +   LHG   Q  RE+ L   R G+  +LV T++A+RG+DVPDI  V+    P D+E+Y+HR GRTGRAGRKG  + F 
Sbjct:   91 SNASIMGEIRKN----GFEKPSPIQSQMWPLLLSGQDCIGVSQTGSGKTLAFLLPALLHIDAQLAQYEKNDEEQKP--SPFVLVLSPTRELAQQIEGEVKKYSYNGYKSVCLYGGGSRPEQVEACRGGVEIVIATPGRLTDLSNDGVISLASVTYVVLDEADRMLDMGFEVAIRRILFEI----------RPDRLVALTSATWPEGVRKLTDKYTKEAVMAVNGSL----DLTSCKSVTQFFEFVPHDSRFLRVCEIVNFLTAAHGQNYKMIIFVKSKVMADHLSSDFCMKGINSQGLHGGRSQSDREMSLNMLRSGEVQILVATDLASRGIDVPDITHVLNYDFPMDIEEYVHRVGRTGRAGRKGEAMSFL 442          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Match: ddx-23 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QN2])

HSP 1 Score: 208.379 bits (529), Expect = 7.577e-57
Identity = 140/375 (37.33%), Postives = 199/375 (53.07%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPV---ITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASD---FESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYI----YPKDTNDNKNRP-------------QTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPW-RERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEK---YDLQKV 1342
            PIQ +      + +DVI  A+TG+GKT AF LP+   IT L  +         P  I+MAPTREL  QI  +   F  L    +KT+++ GG S + Q   L+ GV++V   PGR+ D+++   L L+Q  YVILDE DRMLDMGF   V ++L Y+      KDT++  N               QT++F+ATM   I ++ ++YLR  AV + +   G  K    VE +    P  R+R      ++ V         IIF  +KK AD L+   + +     VLHG   Q++RE  L+  +EG   +LV T+VA RG+DV D+ LV+     K +EDY HR GRTGRAG+ G  I F  P +    +DL++V
Sbjct:  326 PIQRQAIPIGLQNRDVIGVAETGSGKTAAFLLPLLVWITSLPKMERQEHRDLGPYAIIMAPTRELAQQIEEETNKFGKLLG--IKTVSVIGGASREDQGMKLRMGVEVVIATPGRLLDVLENRYLLLNQCTYVILDEADRMLDMGFEPDVQKVLEYMPDTNMKKDTDEFDNEEALMKGFSTREKYRQTVMFTATMSSAIERLARQYLRRPAV-VHIGSAG--KPTERVEQVVYMVPEDRKRK----KLVEVLESQFQPPIIIFVNQKKGADMLSKGLTKLGFKPTVLHGGKGQDQREYALQALKEGTSDILVATDVAGRGIDVKDVSLVLNYDMAKSIEDYTHRIGRTGRAGKHGKAITFLTPDDTAVYFDLKQV 691          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 204.527 bits (519), Expect = 1.268e-56
Identity = 127/365 (34.79%), Postives = 193/365 (52.88%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIAS-DFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCH---VLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            + N  PL  ++ + L  +  K    IQ  ++     G+D+I+ AKTG+GKT AF LP +  +   +   + G  P V+V+ PTREL  Q+     +   S  LK   ++GG S   Q   L+ GVDIV   PGR+ D +D G  ++ +  Y++LDE DRMLDMGF   + +I+  I P          QTL+FSAT P  +  +   + +  A +N+  +E   +   + V  +  +     +   + +++         + IIF E K+ ADEL    AM+ D      +HGD  Q +R+ VL++F+ GK  +++ T+VAARGLDV DI  VI    P + EDY+HR GRTGR+ +KG    FF
Sbjct:  131 EFNEAPLPGQIHELLYGKFQKPTV-IQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQR-GEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDR--------QTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEE---HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTR--AMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFF 480          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 204.527 bits (519), Expect = 1.268e-56
Identity = 127/365 (34.79%), Postives = 193/365 (52.88%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIAS-DFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCH---VLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            + N  PL  ++ + L  +  K    IQ  ++     G+D+I+ AKTG+GKT AF LP +  +   +   + G  P V+V+ PTREL  Q+     +   S  LK   ++GG S   Q   L+ GVDIV   PGR+ D +D G  ++ +  Y++LDE DRMLDMGF   + +I+  I P          QTL+FSAT P  +  +   + +  A +N+  +E   +   + V  +  +     +   + +++         + IIF E K+ ADEL    AM+ D      +HGD  Q +R+ VL++F+ GK  +++ T+VAARGLDV DI  VI    P + EDY+HR GRTGR+ +KG    FF
Sbjct:  131 EFNEAPLPGQIHELLYGKFQKPTV-IQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQR-GEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDR--------QTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEE---HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTR--AMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFF 480          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 204.527 bits (519), Expect = 1.268e-56
Identity = 127/365 (34.79%), Postives = 193/365 (52.88%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIAS-DFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCH---VLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            + N  PL  ++ + L  +  K    IQ  ++     G+D+I+ AKTG+GKT AF LP +  +   +   + G  P V+V+ PTREL  Q+     +   S  LK   ++GG S   Q   L+ GVDIV   PGR+ D +D G  ++ +  Y++LDE DRMLDMGF   + +I+  I P          QTL+FSAT P  +  +   + +  A +N+  +E   +   + V  +  +     +   + +++         + IIF E K+ ADEL    AM+ D      +HGD  Q +R+ VL++F+ GK  +++ T+VAARGLDV DI  VI    P + EDY+HR GRTGR+ +KG    FF
Sbjct:  131 EFNEAPLPGQIHELLYGKFQKPTV-IQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQR-GEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDR--------QTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEE---HAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTR--AMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDVDDIKFVINYDYPNNSEDYVHRIGRTGRSDKKGTAYTFF 480          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 211.075 bits (536), Expect = 3.944e-58
Identity = 128/354 (36.16%), Postives = 196/354 (55.37%), Query Frame = 2
Query:  269 NLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKE 1321
            N+   G K+  PIQ  +   I  G+D++A A+TG+GKT AF LP+++KL      L+ GR P+V++++PTREL  QI ++       S LK   +YGG S+  Q   +  G  +V   PGR+ D +DR  +      +V+LDE DRMLDMGFS+ +  I++++  +  +      QTL+FSAT P+ I ++  ++L+    V I +V      A S V+    +     +   + +I+     G     I+F E K+ AD LAS  + K      +HGD  Q +RE  L+ F+ G   VL+ T+VA+RGLD+ +I  VI    P  ++DY+HR GRTGR G  G    FF+P++
Sbjct:  259 NVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGR-PQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEH------QTLMFSATFPEEIQRMAGEFLKNYVFVAIGIV----GGACSDVKQTIYEVNKYAKRSKLIEILSEQADG----TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK 597          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 211.075 bits (536), Expect = 3.944e-58
Identity = 128/354 (36.16%), Postives = 196/354 (55.37%), Query Frame = 2
Query:  269 NLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKE 1321
            N+   G K+  PIQ  +   I  G+D++A A+TG+GKT AF LP+++KL      L+ GR P+V++++PTREL  QI ++       S LK   +YGG S+  Q   +  G  +V   PGR+ D +DR  +      +V+LDE DRMLDMGFS+ +  I++++  +  +      QTL+FSAT P+ I ++  ++L+    V I +V      A S V+    +     +   + +I+     G     I+F E K+ AD LAS  + K      +HGD  Q +RE  L+ F+ G   VL+ T+VA+RGLD+ +I  VI    P  ++DY+HR GRTGR G  G    FF+P++
Sbjct:  259 NVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGR-PQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEH------QTLMFSATFPEEIQRMAGEFLKNYVFVAIGIV----GGACSDVKQTIYEVNKYAKRSKLIEILSEQADG----TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK 597          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 211.075 bits (536), Expect = 3.944e-58
Identity = 128/354 (36.16%), Postives = 196/354 (55.37%), Query Frame = 2
Query:  269 NLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKE 1321
            N+   G K+  PIQ  +   I  G+D++A A+TG+GKT AF LP+++KL      L+ GR P+V++++PTREL  QI ++       S LK   +YGG S+  Q   +  G  +V   PGR+ D +DR  +      +V+LDE DRMLDMGFS+ +  I++++  +  +      QTL+FSAT P+ I ++  ++L+    V I +V      A S V+    +     +   + +I+     G     I+F E K+ AD LAS  + K      +HGD  Q +RE  L+ F+ G   VL+ T+VA+RGLD+ +I  VI    P  ++DY+HR GRTGR G  G    FF+P++
Sbjct:  259 NVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGR-PQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEH------QTLMFSATFPEEIQRMAGEFLKNYVFVAIGIV----GGACSDVKQTIYEVNKYAKRSKLIEILSEQADG----TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK 597          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0301947)

HSP 1 Score: 204.142 bits (518), Expect = 2.364e-56
Identity = 128/366 (34.97%), Postives = 193/366 (52.73%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTREL---VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTD-AVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNN-ARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            D +   L   + K +  +G K    IQ + +     G + +  AKTG+GKT  + LP I  + N    L+ G  P  +V+APTREL   + Q+A++F S  SS ++   ++GG     Q+  L+ G +IV   PGR+ D +  G  +L +  Y++LDE DRMLDMGF   + +I+S I P          QTL++SAT P  + ++ + +L     +NI  +E   +     V  +  +    E+  T+  +  +Y    +  + IIF E K+  D L     +    C  +HGD  Q +R+ VL++FR GK ++LV T+VAARGLDV  I  VI    P++ EDYIHR GRTGR+  KG    FF
Sbjct:  138 DFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN-QQPLQRGDGPIALVLAPTRELAQQIQQVATEFGS--SSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDR--------QTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTL--LSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFF 490          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078650)

HSP 1 Score: 204.142 bits (518), Expect = 2.364e-56
Identity = 128/366 (34.97%), Postives = 193/366 (52.73%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTREL---VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTD-AVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNN-ARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            D +   L   + K +  +G K    IQ + +     G + +  AKTG+GKT  + LP I  + N    L+ G  P  +V+APTREL   + Q+A++F S  SS ++   ++GG     Q+  L+ G +IV   PGR+ D +  G  +L +  Y++LDE DRMLDMGF   + +I+S I P          QTL++SAT P  + ++ + +L     +NI  +E   +     V  +  +    E+  T+  +  +Y    +  + IIF E K+  D L     +    C  +HGD  Q +R+ VL++FR GK ++LV T+VAARGLDV  I  VI    P++ EDYIHR GRTGR+  KG    FF
Sbjct:  138 DFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINN-QQPLQRGDGPIALVLAPTRELAQQIQQVATEFGS--SSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDR--------QTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTL--LSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGIKYVINFDYPQNSEDYIHRIGRTGRSNTKGTSFAFF 490          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Match: ddx21 (DEAD (Asp-Glu-Ala-Asp) box helicase 21 [Source:ZFIN;Acc:ZDB-GENE-031113-10])

HSP 1 Score: 535.798 bits (1379), Expect = 3.820e-179
Identity = 261/545 (47.89%), Postives = 379/545 (69.54%), Query Frame = 2
Query:  206 EECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEET 1840
            E  E  EG  +NF +S    K L+ARGV  LF IQ+KTF+ +++GKD+I QA+TGTGKTF+FA+P++ KL++     + GR PKV+V+APTREL  Q+  DF+ +T  KL     YGG SY+ Q+ A++SG+D++ G PGR+RD +   +LDLSQ+++V+LDEVD+MLDMGF++ V+EILS  Y KD    + +PQTLLFSAT P W++ + KKY+R+  +++ L+ K   KAA+TVEHLAI C W +RA  I D+I+VY G ++ R I+FCE KK+A EL+ ++++K     LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLVIQ  PP DVE YIHRSGRTGRAGR G+CICF++ KE+  L+ VE  AG TFKR+  P+A  II+++  D ++   S+P      F+ +A +LI+  GA +A+A ALA ISG    ++ RSL++S  GF++ +L+ + E+    +A+  LK+ L + I + +  + F+KG+KG+ FD+P    + V+  W D +  TL     +PELE++
Sbjct:  191 ETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIGQARTGTGKTFSFAVPLVEKLQSGDQERRRGRPPKVLVLAPTRELAIQVTKDFKDITR-KLSVTCFYGGSSYNPQIDAIRSGIDVLVGTPGRIRDHLQNNKLDLSQLQHVVLDEVDQMLDMGFAEQVEEILSASYKKDA---EQKPQTLLFSATCPSWVYDVAKKYMRSQFIHVDLIGKKTQKAATTVEHLAIACHWSQRASVIGDVIQVYSG-SHGRTIVFCETKKEATELSLNTSIKQSAQSLHGDIPQKQREVTLKGFRNGSFEVLVATNVAARGLDIPEVDLVIQSSPPNDVESYIHRSGRTGRAGRTGICICFYQRKEESQLKFVEQKAGITFKRVGVPTAYDIIQSSSKDAVRFLDSVPAVAVGYFREAAQELIQQRGAVEALAAALAHISGATS-LEQRSLINSEPGFSSMILSCSQEMHSISFAWRGLKEQLGEEIDQHISHMVFIKGKKGVCFDVPVSKLKEVQEKWQDSRRWTLSTATQLPELEQS 729          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 214.157 bits (544), Expect = 1.124e-58
Identity = 124/365 (33.97%), Postives = 203/365 (55.62%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L KN+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +   + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++   PGR+ DLI RG++ LS++ Y++LDE DRMLDMGF   + ++++         +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   +Q     +   + +++R  G   N R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P  +++Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  287 LSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVA----SPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVG--GACSDVEQTIVQVDQYSKRDQLLELLRATG---NERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLAR 642          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 213.772 bits (543), Expect = 1.153e-58
Identity = 124/365 (33.97%), Postives = 203/365 (55.62%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L KN+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +   + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++   PGR+ DLI RG++ LS++ Y++LDE DRMLDMGF   + ++++         +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   +Q     +   + +++R  G   N R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P  +++Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  271 LSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVA----SPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVG--GACSDVEQTIVQVDQYSKRDQLLELLRATG---NERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLAR 626          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 213.772 bits (543), Expect = 1.171e-58
Identity = 124/365 (33.97%), Postives = 203/365 (55.62%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L KN+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +   + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++   PGR+ DLI RG++ LS++ Y++LDE DRMLDMGF   + ++++         +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   +Q     +   + +++R  G   N R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P  +++Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  272 LSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVA----SPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVG--GACSDVEQTIVQVDQYSKRDQLLELLRATG---NERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLAR 627          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 213.386 bits (542), Expect = 1.178e-58
Identity = 124/365 (33.97%), Postives = 203/365 (55.62%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L KN+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +   + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++   PGR+ DLI RG++ LS++ Y++LDE DRMLDMGF   + ++++         +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   +Q     +   + +++R  G   N R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P  +++Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  259 LSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDMGFEPEMRKLVA----SPGMPSKEERQTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVG--GACSDVEQTIVQVDQYSKRDQLLELLRATG---NERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLAR 614          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Match: nasp (nuclear autoantigenic sperm protein (histone-binding) [Source:Xenbase;Acc:XB-GENE-980254])

HSP 1 Score: 469.929 bits (1208), Expect = 1.883e-154
Identity = 241/544 (44.30%), Postives = 358/544 (65.81%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  +GD + FP+S +  KNL+A+GV  LFPIQ KTF   + GKDV+ QA+TGTGKTF+FA+P++ +L      L  GR P+VI++ PTREL  QI ++  S+T  KLK    YGG  Y +QV ++K G D + G PGR+RDL+   +LDL+ +++V+LDEVD M DMGFS+ V+EILS  Y  D  +N   PQTLLFSAT PDW++ + KKY++     I LV     KAA TVEHLAI+C   ++A  + DI++VY G ++ + IIFC+ K +A ELA++  ++K     LHGD+ Q++RE++LK FR+G + VLV TNVAARGLD+P++DLV+    PK+ + Y+HRSGRTGRAGR G+CI  +EP+E++ L+ VE   G TFKR+  PS  ++ +++  D I++  S+P  V + F+  A +LIE  GA  A+A ALA ISG    +K RSLL+   G+ T  L ++ +I    YA+ ++K+ L ++I  ++  +  +K   G+ FD+ +E+ + ++  W D +        ++P ++E+E
Sbjct:  134 EKIDGDFSKFPISKDTIKNLQAKGVSYLFPIQSKTFHTAYSGKDVVVQARTGTGKTFSFAIPLVERLNEDQQPLARGRAPRVIILTPTRELAIQITNEIRSITK-KLKVCCFYGGTPYQQQVFSIKEGFDFLVGTPGRVRDLVQNYRLDLTVLKHVVLDEVDMMFDMGFSEQVEEILSVRYKPDPEEN---PQTLLFSATCPDWMYNVAKKYMKKQFEKIDLVGHRSQKAAITVEHLAIECTRSQKAAVLGDIVQVYSG-SHGKSIIFCDSKLEAHELATNCGSLKQSAKPLHGDLQQKEREVILKGFRQGSFEVLVATNVAARGLDIPEVDLVVLYSAPKEADAYVHRSGRTGRAGRTGICISLYEPRERHYLRNVERSTGITFKRVGIPSLLNVAKSSSADAIKSLDSVPADVIEHFKEYAQELIEKKGALTALAAALAHISGATS-IKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSMGVCFDVRSENLQSMQEGWKDTRRWQFTVATELPAIQESE 671          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Match: nasp (nuclear autoantigenic sperm protein (histone-binding) [Source:Xenbase;Acc:XB-GENE-980254])

HSP 1 Score: 471.085 bits (1211), Expect = 2.467e-154
Identity = 241/544 (44.30%), Postives = 358/544 (65.81%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  +GD + FP+S +  KNL+A+GV  LFPIQ KTF   + GKDV+ QA+TGTGKTF+FA+P++ +L      L  GR P+VI++ PTREL  QI ++  S+T  KLK    YGG  Y +QV ++K G D + G PGR+RDL+   +LDL+ +++V+LDEVD M DMGFS+ V+EILS  Y  D  +N   PQTLLFSAT PDW++ + KKY++     I LV     KAA TVEHLAI+C   ++A  + DI++VY G ++ + IIFC+ K +A ELA++  ++K     LHGD+ Q++RE++LK FR+G + VLV TNVAARGLD+P++DLV+    PK+ + Y+HRSGRTGRAGR G+CI  +EP+E++ L+ VE   G TFKR+  PS  ++ +++  D I++  S+P  V + F+  A +LIE  GA  A+A ALA ISG    +K RSLL+   G+ T  L ++ +I    YA+ ++K+ L ++I  ++  +  +K   G+ FD+ +E+ + ++  W D +        ++P ++E+E
Sbjct:  175 EKIDGDFSKFPISKDTIKNLQAKGVSYLFPIQSKTFHTAYSGKDVVVQARTGTGKTFSFAIPLVERLNEDQQPLARGRAPRVIILTPTRELAIQITNEIRSITK-KLKVCCFYGGTPYQQQVFSIKEGFDFLVGTPGRVRDLVQNYRLDLTVLKHVVLDEVDMMFDMGFSEQVEEILSVRYKPDPEEN---PQTLLFSATCPDWMYNVAKKYMKKQFEKIDLVGHRSQKAAITVEHLAIECTRSQKAAVLGDIVQVYSG-SHGKSIIFCDSKLEAHELATNCGSLKQSAKPLHGDLQQKEREVILKGFRQGSFEVLVATNVAARGLDIPEVDLVVLYSAPKEADAYVHRSGRTGRAGRTGICISLYEPRERHYLRNVERSTGITFKRVGIPSLLNVAKSSSADAIKSLDSVPADVIEHFKEYAQELIEKKGALTALAAALAHISGATS-IKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSMGVCFDVRSENLQSMQEGWKDTRRWQFTVATELPAIQESE 712          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Match: nasp (nuclear autoantigenic sperm protein (histone-binding) [Source:Xenbase;Acc:XB-GENE-980254])

HSP 1 Score: 470.315 bits (1209), Expect = 5.015e-154
Identity = 241/544 (44.30%), Postives = 358/544 (65.81%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  +GD + FP+S +  KNL+A+GV  LFPIQ KTF   + GKDV+ QA+TGTGKTF+FA+P++ +L      L  GR P+VI++ PTREL  QI ++  S+T  KLK    YGG  Y +QV ++K G D + G PGR+RDL+   +LDL+ +++V+LDEVD M DMGFS+ V+EILS  Y  D  +N   PQTLLFSAT PDW++ + KKY++     I LV     KAA TVEHLAI+C   ++A  + DI++VY G ++ + IIFC+ K +A ELA++  ++K     LHGD+ Q++RE++LK FR+G + VLV TNVAARGLD+P++DLV+    PK+ + Y+HRSGRTGRAGR G+CI  +EP+E++ L+ VE   G TFKR+  PS  ++ +++  D I++  S+P  V + F+  A +LIE  GA  A+A ALA ISG    +K RSLL+   G+ T  L ++ +I    YA+ ++K+ L ++I  ++  +  +K   G+ FD+ +E+ + ++  W D +        ++P ++E+E
Sbjct:  174 EKIDGDFSKFPISKDTIKNLQAKGVSYLFPIQSKTFHTAYSGKDVVVQARTGTGKTFSFAIPLVERLNEDQQPLARGRAPRVIILTPTRELAIQITNEIRSITK-KLKVCCFYGGTPYQQQVFSIKEGFDFLVGTPGRVRDLVQNYRLDLTVLKHVVLDEVDMMFDMGFSEQVEEILSVRYKPDPEEN---PQTLLFSATCPDWMYNVAKKYMKKQFEKIDLVGHRSQKAAITVEHLAIECTRSQKAAVLGDIVQVYSG-SHGKSIIFCDSKLEAHELATNCGSLKQSAKPLHGDLQQKEREVILKGFRQGSFEVLVATNVAARGLDIPEVDLVVLYSAPKEADAYVHRSGRTGRAGRTGICISLYEPRERHYLRNVERSTGITFKRVGIPSLLNVAKSSSADAIKSLDSVPADVIEHFKEYAQELIEKKGALTALAAALAHISGATS-IKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSMGVCFDVRSENLQSMQEGWKDTRRWQFTVATELPAIQESE 711          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Match: nasp (nuclear autoantigenic sperm protein (histone-binding) [Source:Xenbase;Acc:XB-GENE-980254])

HSP 1 Score: 449.129 bits (1154), Expect = 1.210e-148
Identity = 235/523 (44.93%), Postives = 346/523 (66.16%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSW 1780
            E  +GD + FP+S +  KNL+A+GV  LFPIQ KTF   + GKDV+ QA+TGTGKTF+FA+P++ +L      L  GR P+VI++ PTREL  QI ++  S+T  KLK    YGG  Y +QV ++K G D + G PGR+RDL+   +LDL+ +++V+LDEVD M DMGFS+ V+EILS  Y  D  +N   PQTLLFSAT PDW++ + KKY++     I LV     KAA TVEHLAI+C   ++A  + DI++VY  G++ + IIFC+ K +A ELA++  ++K     LHGD+ Q++RE++LK FR+G + VLV TNVAARGLD+P++DLV       + + Y+HRSGRTGRAGR G+CI  +EP+E++ L+ VE   G TFKR+  PS  ++ +++  D I++  S+P  V + F+  A +LIE  GA  A+A ALA ISG    +K RSLL+   G+ T  L ++ +I    YA+ ++K+ L ++I  ++  +  +K   G+ FD+ +E+ + ++ S+
Sbjct:   24 EKIDGDFSKFPISKDTIKNLQAKGVSYLFPIQSKTFHTAYSGKDVVVQARTGTGKTFSFAIPLVERLNEDQQPLARGRAPRVIILTPTRELAIQITNEIRSITK-KLKVCCFYGGTPYQQQVFSIKEGFDFLVGTPGRVRDLVQNYRLDLTVLKHVVLDEVDMMFDMGFSEQVEEILSVRYKPDPEEN---PQTLLFSATCPDWMYNVAKKYMKKQFEKIDLVGHRSQKAAITVEHLAIECTRSQKAAVLGDIVQVY-SGSHGKSIIFCDSKLEAHELATNCGSLKQSAKPLHGDLQQKEREVILKGFRQGSFEVLVATNVAARGLDIPEVDLVSTI-LSNEADAYVHRSGRTGRAGRTGICISLYEPRERHYLRNVERSTGITFKRVGIPSLLNVAKSSSADAIKSLDSVPADVIEHFKEYAQELIEKKGALTALAAALAHISGATS-IKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSMGVCFDVRSENLQSMQVSF 539          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Match: nasp (nuclear autoantigenic sperm protein (histone-binding) [Source:Xenbase;Acc:XB-GENE-980254])

HSP 1 Score: 439.113 bits (1128), Expect = 5.863e-145
Identity = 234/523 (44.74%), Postives = 342/523 (65.39%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSW 1780
            E  +GD + FP+S +  KNL+A+GV  LFPIQ KTF   + GKDV+ QA+TGTGKTF+FA+P++ +L      L  GR P+VI++ PTREL  QI ++  S+T  KLK    YGG  Y +QV ++K G D + G PGR+RDL+   +LDL+ +++V+LDEVD M DMGFS+ V+EILS  Y  D  +N   PQTLLFSAT PDW++ + KKY++     I LV     KAA TVEHLAI+C   ++A  + DI++VY  G++ + IIFC+ K +A ELA++  ++K     LHGD+ Q++RE++LK FR+G + VLV TNVAARGLD+P++DLV+      + + Y+HRSGRTGRAGR G+CI  +EP+E++ L+ VE   G TFKR+  PS  ++ +++  D I++  S+P  V + F+  A +LIE  GA  A+A ALA ISG    +K RSLLSS             +I    YA+ ++K+ L ++I  ++  +  +K   G+ FD+ +E+ + ++ S+
Sbjct:   24 EKIDGDFSKFPISKDTIKNLQAKGVSYLFPIQSKTFHTAYSGKDVVVQARTGTGKTFSFAIPLVERLNEDQQPLARGRAPRVIILTPTRELAIQITNEIRSITK-KLKVCCFYGGTPYQQQVFSIKEGFDFLVGTPGRVRDLVQNYRLDLTVLKHVVLDEVDMMFDMGFSEQVEEILSVRYKPDPEEN---PQTLLFSATCPDWMYNVAKKYMKKQFEKIDLVGHRSQKAAITVEHLAIECTRSQKAAVLGDIVQVY-SGSHGKSIIFCDSKLEAHELATNCGSLKQSAKPLHGDLQQKEREVILKGFRQGSFEVLVATNVAARGLDIPEVDLVVLY---SEADAYVHRSGRTGRAGRTGICISLYEPRERHYLRNVERSTGITFKRVGIPSLLNVAKSSSADAIKSLDSVPADVIEHFKEYAQELIEKKGALTALAAALAHISGATS-IKQRSLLSS----------RILQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSMGVCFDVRSENLQSMQVSF 527          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Match: Ddx21 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Source:MGI Symbol;Acc:MGI:1860494])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 280/544 (51.47%), Postives = 371/544 (68.20%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NFP+S E  K L+ARGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL+      K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF+D V+EIL   Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   KAA TVEHLAI+C W ERA  I D+IRVY G +  R IIFCE KKDA EL+ ++ +K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L ++I  +VK + F+KG+ G+ FD+  E    ++  W D +   L    + PELE   D
Sbjct:  254 EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIRVYSG-HQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNFGVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQNKEEYQLAQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKLGVCFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELEGPPD 791          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Match: Ddx50 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 [Source:MGI Symbol;Acc:MGI:2182303])

HSP 1 Score: 522.316 bits (1344), Expect = 1.178e-174
Identity = 260/544 (47.79%), Postives = 367/544 (67.46%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NF +S E  K L+ RGV  LFPIQ+KTF  ++EGKD+IAQA+TGTGKTF+FA+P+I +L+    ++K  R PKV+V+APTREL +Q+A DF+ +T  KL     YGG SY  Q++ +++G+DI+ G PGR++D +  G+LDLS++ +V+LDEVD+MLD+GF++ V++I+   Y  D+ DN   PQTLLFSAT P W++K+ KKY+++    + LV K   KAA+TVEHLAIQC W +R   I D+++VY G +  R IIFCE KK+  E+A +  +K +   LHGD+ Q +RE+ LK FREG + VLV TNVAARGLD+P++DLVIQ  PP+DVE YIHRSGRTGRAGR G+C+CF++P+E+  L+ VE  AG TFKR+  PS   ++++  +D I++  S+     D F+ SA +LIE  GA  A+A ALA ISG     + RSL++S +GF T  L + +EI+    A+  L + L  N V  V  +  +KG  G+ FD+P    E ++  W D  +  L     +PE+EE  D
Sbjct:  130 EQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDN---PQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSG-SEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISG-ASSFEPRSLITSDKGFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKGNMGVCFDVPTSESERLQAEWHDSDW-ILSVPAKLPEIEEYYD 666          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 214.157 bits (544), Expect = 9.256e-59
Identity = 125/360 (34.72%), Postives = 204/360 (56.67%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFE 1312
            L   L  N+   G   L P+Q  +   +  G+D++A A+TG+GKT AF LP++  +  + ++ S  K  ++P+ I++APTREL++QI  +    +  + ++ + IYGG  +   V  +  G +I+   PGR+ D+I + ++ L Q++Y++LDE DRMLDMGF   + +++S         +K + QTLLFSAT P+ I ++   +L++  + + + + G   A   V+   +Q     +   + +I+R  G   + R ++F E KK AD +A+     K     +HGD  Q +RE  L  FR GK  VLV T+VAARGLD+ ++  VI    P  +++Y+HR GRTGR G  G  I FF+
Sbjct:  268 LCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISC----PGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGG--ACRDVQQTILQVGQYSKREKLVEILRNIG---DERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFD 618          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 213.386 bits (542), Expect = 2.351e-58
Identity = 125/360 (34.72%), Postives = 204/360 (56.67%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFE 1312
            L   L  N+   G   L P+Q  +   +  G+D++A A+TG+GKT AF LP++  +  + ++ S  K  ++P+ I++APTREL++QI  +    +  + ++ + IYGG  +   V  +  G +I+   PGR+ D+I + ++ L Q++Y++LDE DRMLDMGF   + +++S         +K + QTLLFSAT P+ I ++   +L++  + + + + G   A   V+   +Q     +   + +I+R  G   + R ++F E KK AD +A+     K     +HGD  Q +RE  L  FR GK  VLV T+VAARGLD+ ++  VI    P  +++Y+HR GRTGR G  G  I FF+
Sbjct:  294 LCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQIVQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDMGFGPEMKKLISC----PGMPSKEQRQTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVG--GACRDVQQTILQVGQYSKREKLVEILRNIG---DERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFD 644          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 207.994 bits (528), Expect = 6.108e-57
Identity = 129/357 (36.13%), Postives = 191/357 (53.50%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTREL---VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRT-DAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD---CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEP---KEKYDLQKV 1342
            PIQ + F     G+D++  A+TG+GKT A+ LP I  + N    L+ G  P  +V+APTREL   V Q+A D+     S+LK+  IYGG     Q+  L+ GV+I    PGR+ D ++ G+ +L +  Y++LDE DRMLDMGF   + +I+  I P          QTL++SAT P  + ++ + +LR    +N+  +E     A   +  +   C   E+   +  ++         + IIF E K+  D+L     M+ D      +HGD  Q +R+ VL +FR GK  +L+ T+VA+RGLDV D+  VI    P   EDY+HR GRT R+  KG    FF P   K+  +L KV
Sbjct:  117 PIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHI-NHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKC--SRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR--------QTLMWSATWPKEVRQLAEDFLRDYTQINVGNLE---LSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRR--MRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKV 457          
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Match: sp|Q3B8Q1|DDX21_RAT (Nucleolar RNA helicase 2 OS=Rattus norvegicus OX=10116 GN=Ddx21 PE=2 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 280/540 (51.85%), Postives = 370/540 (68.52%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELE 1834
            E  EG  +NFP+S E  K L+ARGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL+      K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF+D V+EIL   Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   KAA TVEHLAI+C W ERA  I D+IRVY G +  R IIFCE KKDA EL+ ++ +K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L ++I  +VK + F+KG+ G+ FD+  E    +K  W D +   L    + PELE
Sbjct:  178 EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIRVYSG-HQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNFGVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLAQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAIGHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSQAGFVTMILRCSVEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKLGVCFDVRTEAVTEIKEKWHDSRRWQLTVATEQPELE 711          
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Match: sp|Q9JIK5|DDX21_MOUSE (Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 280/544 (51.47%), Postives = 371/544 (68.20%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NFP+S E  K L+ARGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL+      K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF+D V+EIL   Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   KAA TVEHLAI+C W ERA  I D+IRVY G +  R IIFCE KKDA EL+ ++ +K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L ++I  +VK + F+KG+ G+ FD+  E    ++  W D +   L    + PELE   D
Sbjct:  254 EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIRVYSG-HQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNFGVLVATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQNKEEYQLAQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKLGVCFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELEGPPD 791          
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Match: sp|Q9NR30|DDX21_HUMAN (Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5)

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 279/540 (51.67%), Postives = 367/540 (67.96%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELE 1834
            E  EG  +NFP+S E  K L+ RGV  LFPIQ KTF H++ GKD+IAQA+TGTGKTF+FA+P+I KL       K GR P+V+V+APTREL +Q++ DF  +T  KL     YGG  Y  Q   +++G+DI+ G PGR++D I  G+LDL+++++V+LDEVD+MLDMGF+D V+EILS  Y KD+ DN   PQTLLFSAT P W+  + KKY+++    + L+ K   K A TVEHLAI+C W +RA  I D+IRVY G +  R IIFCE KK+A EL+ +SA+K D   LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLVIQ  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+Y L +VE  AG  FKRI  PSA  II+A+  D I+   S+P T    F+ SA +LIE  GA +A+A ALA ISG    V  RSL++S  GF T +L  + E+    YA+  LK+ L + I  +VK + F+KG+ G+ FD+P      ++  W D +   L    + PELE
Sbjct:  182 EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITK-KLSVACFYGGTPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVAYKKDSEDN---PQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHWTQRAAVIGDVIRVYSG-HQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITLKGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGATS-VDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQLGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELE 715          
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Match: sp|Q9BQ39|DDX50_HUMAN (ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1)

HSP 1 Score: 527.709 bits (1358), Expect = 6.668e-176
Identity = 262/544 (48.16%), Postives = 369/544 (67.83%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NFP+S E  K L+ RGV  LFPIQ+KTF  ++EGKD+IAQA+TGTGKTF+FA+P+I +L+    ++K  R PKV+V+APTREL +Q+A DF+ +T  KL     YGG SY  Q++ +++G+DI+ G PGR++D +  G+LDLS++ +V+LDEVD+MLD+GF++ V++I+   Y  D+ DN   PQTLLFSAT P W++K+ KKY+++    + LV K   KAA+TVEHLAIQC W +R   I D+++VY G +  R IIFCE KK+  E+A +  +K +   LHGD+ Q +RE+ LK FREG + VLV TNVAARGLD+P++DLVIQ  PP+DVE YIHRSGRTGRAGR G+CICF++P+E+  L+ VE  AG TFKR+  PS   ++++  +D I++  S+     D F+ SA +LIE  GA  A+A ALA ISG     + RSL++S +GF T  L + +EI+    A+  L + L  N V Q+  +  +KG  G+ FD+P    E ++  W D  +  L     +PE+EE  D
Sbjct:  133 EQKEGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDN---PQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSG-SEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICICFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISG-ASSFEPRSLITSDKGFVTMTLESLEEIQDVSCAWKELNRKLSSNAVSQITRMCLLKGNMGVCFDVPTTESERLQAEWHDSDW-ILSVPAKLPEIEEYYD 669          
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Match: sp|Q99MJ9|DDX50_MOUSE (ATP-dependent RNA helicase DDX50 OS=Mus musculus OX=10090 GN=Ddx50 PE=2 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 8.238e-174
Identity = 260/544 (47.79%), Postives = 367/544 (67.46%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETED 1846
            E  EG  +NF +S E  K L+ RGV  LFPIQ+KTF  ++EGKD+IAQA+TGTGKTF+FA+P+I +L+    ++K  R PKV+V+APTREL +Q+A DF+ +T  KL     YGG SY  Q++ +++G+DI+ G PGR++D +  G+LDLS++ +V+LDEVD+MLD+GF++ V++I+   Y  D+ DN   PQTLLFSAT P W++K+ KKY+++    + LV K   KAA+TVEHLAIQC W +R   I D+++VY G +  R IIFCE KK+  E+A +  +K +   LHGD+ Q +RE+ LK FREG + VLV TNVAARGLD+P++DLVIQ  PP+DVE YIHRSGRTGRAGR G+C+CF++P+E+  L+ VE  AG TFKR+  PS   ++++  +D I++  S+     D F+ SA +LIE  GA  A+A ALA ISG     + RSL++S +GF T  L + +EI+    A+  L + L  N V  V  +  +KG  G+ FD+P    E ++  W D  +  L     +PE+EE  D
Sbjct:  130 EQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITR-KLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDN---PQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSG-SEGRAIIFCETKKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQDVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISG-ASSFEPRSLITSDKGFVTMTLESPEEIQDVSCAWKELNRKLSSNAVSHVTRMCLLKGNMGVCFDVPTSESERLQAEWHDSDW-ILSVPAKLPEIEEYYD 666          
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Match: A4V6M8 (Nucleolar RNA helicase II/Gu protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 937.176 bits (2421), Expect = 0.000e+0
Identity = 474/626 (75.72%), Postives = 528/626 (84.35%), Query Frame = 2
Query:  119 KEKNESEKENFXXXXXXXXXXXXXXXNTSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSG--SLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRSFNGKSQGGNNPKLVKFD 1990
            K  N+SEKEN         +   +KK+   E E  EGDL+NFPLS +L+K L+ARGVK LFPIQIKTF HI  GKDVIAQAKTGTGKTFAFALPV+TKLEN SG   LK GRKPKVIVMAPTRELVSQIASDFESL S  LK L+IYGGVSY+KQ +ALK+GVDI+AGAPGR+RDLI++G LDLS+IEYVILDEVDRMLDMGFSDIV+EILSYIYP +T+  K  PQTLLFSATMP+WIH IVKKYL+ DA+ +CL+++  SKAASTVEHLAIQCPWRERAGTIPDIIRV+GGGN ARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICF+EPKEKYDLQKVE LAGFTFKRIFPPSAASIIEANL DTI+AFKSIPETV +SF+ SA +LIE FGAEKAMALALAKISGKV+E+KNRSLLSS EGFTTY+LTT DEIKFKGYAYSALKK +   IVEQVK LQFVKGRK LVFD+ +EHDE + T+W D  +N L K+ ++PE+E++E+           GG+       + +  G+KRSF G   GGN  KLVKFD
Sbjct:   10 KSINDSEKENASAKPVKLKKVKTIKKDN--EVEKVEGDLSNFPLSSDLQKKLQARGVKALFPIQIKTFHHIHTGKDVIAQAKTGTGKTFAFALPVLTKLEN-SGIDGLKSGRKPKVIVMAPTRELVSQIASDFESLISKNLKVLSIYGGVSYEKQTTALKNGVDIIAGAPGRVRDLINKGHLDLSKIEYVILDEVDRMLDMGFSDIVEEILSYIYPSETD--KKGPQTLLFSATMPNWIHNIVKKYLKPDAIKVCLIDENGSKAASTVEHLAIQCPWRERAGTIPDIIRVHGGGNQARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFYEPKEKYDLQKVEKLAGFTFKRIFPPSAASIIEANLNDTIEAFKSIPETVCESFKESAIKLIEQFGAEKAMALALAKISGKVEELKNRSLLSSMEGFTTYMLTTNDEIKFKGYAYSALKKYISTEIVEQVKSLQFVKGRKSLVFDLASEHDESISTNWVDSNFNKLTKLSELPEIEKSEE----RNGGFRNGGQGRRPGGFNDRKFGMKRSFGGSFNGGNQSKLVKFD 626          
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Match: G1MYU6 (DExD-box helicase 21 OS=Meleagris gallopavo OX=9103 GN=DDX21 PE=4 SV=2)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 271/543 (49.91%), Postives = 383/543 (70.53%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  EG  +NFP+S    + L+ARGV  LFP+Q+KTF  ++ GKDVIAQA+TGTGKTF+FA+P+I KL+  S   + GR PKV+V+APTREL +Q+A DF+ +T  KL     YGG  Y+ Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF++ V++IL   Y KD+ DN   PQTLLFSAT P+W++ + KKY+++    + L+ +   KAA+TVEHLAI+C W +RA  I D+I+VY G ++ R I+FCE KKDA+ELA ++++K DC  LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR G+CICF++ KE+  L+ VE  AG TFKR+  P+A  II+A+  D I+   S+P++  D F+ SA  LIE  G   A+A ALA ISG    ++ RSLL+S  GF T +L  ++EI    Y +  L++ L  ++  +V  + F+KGR G+ FD+PA   + ++  W D K   L    ++PELEE++
Sbjct:   79 EQKEGAFSNFPISKGTVQLLQARGVTYLFPVQVKTFHPVYSGKDVIAQAQTGTGKTFSFAIPLIEKLQADSQERRRGRSPKVLVLAPTRELANQVAKDFKDITR-KLTVACFYGGTPYNGQIDLIRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVEDILRVAYKKDSEDN---PQTLLFSATCPNWVYDVAKKYMKSKYEQVDLIGRRTQKAATTVEHLAIECHWSQRAAVIGDVIQVYSG-SHGRTIVFCETKKDANELALNASIKQDCQSLHGDIPQKQREITLKGFRNGAFKVLVATNVAARGLDIPEVDLVVQSSPPKDVESYIHRSGRTGRAGRTGICICFYQRKEENQLRYVEQKAGITFKRVGVPTATDIIKASSKDAIRCLDSVPQSAIDYFKESAQLLIEEKGPVNALAAALAHISGAT-SIEQRSLLNSDVGFVTMILRCSEEINNMSYVWRKLREQLGGDVDRKVNRMCFIKGRMGVCFDIPAADQKDIEERWEDSKQCCLCVANELPELEESQ 615          
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Match: A0A218UQN1 (Nucleolar RNA helicase 2 OS=Lonchura striata domestica OX=299123 GN=DDX21_0 PE=4 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 269/542 (49.63%), Postives = 383/542 (70.66%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEET 1840
            E  EG  +NF +S E  + L+ARGV  LFP+Q+KTF+ ++ GKDVIAQA+TGTGKTF+FA+P+I KL+  S   + GR PKV+V+ PTREL +Q+A DF+ +T  KL     YGG  Y+ Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF++ V++IL   Y KD+ DN   PQTLLFSAT P W++ + KKY+++    I L+ K   KAA+TVEHLAI+C W +RA  I D+I+VY G ++ R I+FCE KK+A+ELA ++++K DC  LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR G+CICF++ KE+Y L+ VE  AG TFKR+  P+A  II+A+  D ++   S+P+T  + F+ SA  LI+  G   A+A ALA ISG    ++ RSLL+S  GF T +L  ++EI    YA+  L++ L D++  +V  + F+KG+ G+ FD+P    + ++  W D K+  L    ++PEL E+
Sbjct:  130 EQKEGAFSNFSISKETVQLLQARGVTYLFPVQVKTFNPVYAGKDVIAQARTGTGKTFSFAIPLIEKLQGDSQERRRGRPPKVLVLCPTRELANQVAKDFKDITR-KLTVACFYGGTPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVEDILRVAYKKDSEDN---PQTLLFSATCPHWVYDVAKKYMKSRYEQIDLIGKRTQKAATTVEHLAIECHWSQRAAVIGDVIQVYSG-SHGRTIVFCETKKEANELALNASIKQDCQSLHGDIPQKQREITLKGFRNGSFKVLVATNVAARGLDIPEVDLVVQSSPPKDVESYIHRSGRTGRAGRTGICICFYQRKEEYQLRHVEQKAGITFKRVGVPTATDIIKASSKDAMRCLDSVPQTAIEYFRESAQLLIKEKGPVNALAAALAHISGATS-IEQRSLLNSDVGFVTMILRCSEEINNMSYAWRRLREVLGDDVDRKVNRMCFLKGKMGVCFDVPVAEQKEIEARWEDSKHWRLCVATELPELVES 665          
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Match: A0A3L8S762 (Uncharacterized protein (Fragment) OS=Chloebia gouldiae OX=44316 GN=DV515_00011553 PE=4 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 270/542 (49.82%), Postives = 383/542 (70.66%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEET 1840
            E  EG  +NF +S E  + L+ARGV  LFP+Q+KTF+ ++ GKDVIAQA+TGTGKTF+FA+P+I KL+  S   + GR PKV+V+ PTREL +Q+A DF+ +T  KL     YGG  Y+ Q+  ++SG+DI+ G PGR++D +  G+LDL++I++V+LDEVD+MLDMGF++ V++IL   Y KD+ DN   PQTLLFSAT P W++ + KKY+++    I L+ K   KAA+TVEHLAI+C W +RA  I D+I+VY G ++ R I+FCE KK+A+ELA ++++K DC  LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR G+CICF++ KE+Y L+ VE  AG TFKR+  P+A  II+A+  D ++   S+P+T  + F+ SA  LI+  G   A+A ALA ISG    ++ RSLL+S  GF T +L  ++EI    YA+  L++ L D++  +V  + F+KG+ G+ FD+P    + ++  W D K+  L    ++PEL E+
Sbjct:  105 EQKEGAFSNFSISKETVQLLQARGVTYLFPVQVKTFNPVYAGKDVIAQARTGTGKTFSFAIPLIEKLQGESQERRRGRPPKVLVLCPTRELANQVAKDFKDITR-KLTVACFYGGTPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKIKHVVLDEVDQMLDMGFAEQVEDILRVAYKKDSEDN---PQTLLFSATCPHWVYDVAKKYMKSRYEQIDLIGKRTQKAATTVEHLAIECHWSQRAAVIGDVIQVYSG-SHGRTIVFCETKKEANELALNASIKQDCQSLHGDIPQKQREITLKGFRNGSFKVLVATNVAARGLDIPEVDLVVQSSPPKDVESYIHRSGRTGRAGRTGICICFYQRKEEYQLRHVEQKAGITFKRVGVPTATDIIKASSKDAMRCLDSVPQTAIEYFRESAQLLIKEKGPVNALAAALAHISGATS-IEQRSLLNSDVGFVTMILRCSEEINNMSYAWRRLREVLGDDVDRKVNRMCFLKGKMGVCFDVPVADQKEIEARWEDSKHWRLCVATELPELVES 640          
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Match: A0A0Q3TTS0 (Nucleolar RNA helicase 2-like protein OS=Amazona aestiva OX=12930 GN=AAES_52049 PE=4 SV=1)

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 270/543 (49.72%), Postives = 383/543 (70.53%), Query Frame = 2
Query:  215 ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  EG  +NF +S    + L+ARGV  LFP+Q+KTF+ ++ GKDVIAQA+TGTGKTF+FA+P+I KL+  S   + GR PKV+V+ PTREL +Q+A DF+ +T  KL     YGG  Y+ Q+  ++SG+DI+ G PGR++D +  G+LDL+++++V+LDEVD+MLDMGF++ V++IL   Y KD+ DN   PQTLLFSAT P W++ + KKY+++    I L+ K   KAA+TVEHLAI+C W +RA  I D+I+VY G +  R I+FCE KK+A+ELA ++++K DC  LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR G+CICF++ KE++ L+ VE  AG TFKR+  P+A  II+A+  D I+   S+P+T  + F+ SA  LIE  G   A+A ALA ISG    ++ RSLL+S  GF T +L+ ++EI    YA+  L++ L D++  +V  + F+KG+ G+ FD+PA   + ++  W D K   L    ++PEL E++
Sbjct:  129 EQKEGAFSNFSISKGTVQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTGTGKTFSFAIPLIEKLQGDSQERRRGRSPKVLVLCPTRELANQVAKDFKDITK-KLTVACFYGGTPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVEDILRVAYKKDSEDN---PQTLLFSATCPHWVYDVAKKYMKSRYEQIDLIGKRTQKAATTVEHLAIECHWSQRAAVIGDVIQVYSG-SYGRTIVFCETKKEANELALNASIKQDCQSLHGDIPQKQREITLKGFRNGTFKVLVATNVAARGLDIPEVDLVVQSSPPKDVESYIHRSGRTGRAGRTGICICFYQRKEEHQLRYVEQKAGITFKRVGVPTATDIIKASSKDAIRCLDSVPQTAIEYFKESARFLIEEKGPVNALAAALAHISGATS-IEQRSLLNSDAGFVTMILSCSEEINNMSYAWRKLRELLGDDVDRKVNRMCFLKGKMGVCFDIPAADQKEIEAKWEDSKQWRLCVATELPELVESQ 665          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Match: ddx21 (DExD-box helicase 21 [Source:NCBI gene;Acc:103032160])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 267/547 (48.81%), Postives = 386/547 (70.57%), Query Frame = 2
Query:  203 SEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            +E  E  EG  +NF +S +  + L+ARGV  LF IQ+KTF+ +++GKDVI QA+TGTGKTF+FA+P++ KL++     + GR PKV+V+APTREL  Q+A DF+ +T + L     YGG SY+ QV A++SG+DI+ G PGR++D +   +LDLSQ+++V+LDEVD+MLDMGF++ V+EILS  Y KD   N   PQTLLFSAT P W++ + KKY+R+  V++ L+ K   KAA+TVEHLAI C W +RA  + D+++VY G ++ R I+FCE KK+A EL+ + ++K +   LHGD+PQ++RE  LK FR G + VLV TNVAARGLD+P++DLV+QC PPKDVE YIHRSGRTGRAGR GVCICF++ KE+  L+ VE  AG TFKR+  P+A  I++++  D ++   S+P    + F+A+A +LIE  G  +A+A ALA ISG    ++ RSLL+S  GFTT ++  + E+   G A+ ALK+ L + I +Q++ + F+K + G+ FD+PA+  + ++  W DG+   L    ++PEL+E +
Sbjct:  164 TETPEQREGAFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSFAIPLVEKLQSEPADKRRGRPPKVLVLAPTRELAIQVAKDFKDVTRN-LSVFCFYGGSSYNPQVDAIRSGIDILVGTPGRIKDNLQNNKLDLSQLKHVVLDEVDQMLDMGFAEQVEEILSASYKKDAESN---PQTLLFSATCPPWVYDVAKKYMRSQFVHVDLIGKKTQKAATTVEHLAIACHWSQRAAVLGDVVQVYSG-SHGRSIVFCETKKEAHELSMNPSIKQNAQSLHGDIPQKQRETTLKGFRNGTFEVLVATNVAARGLDIPEVDLVVQCSPPKDVESYIHRSGRTGRAGRTGVCICFYQRKEEDQLRYVEKKAGITFKRVGVPTANDIVKSSSKDAVRYLDSVPAAAIEYFRAAAERLIEERGPVEALAAALAHISGAT-TLEQRSLLNSDAGFTTMIMNCSVEMNNIGTAWRALKEQLGEEIDDQIRRMIFLKDQMGVCFDVPADKVKEIQDKWEDGRRWQLTVATELPELKEQQ 704          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Match: ddx21 (DExD-box helicase 21 [Source:NCBI gene;Acc:103032160])

HSP 1 Score: 534.643 bits (1376), Expect = 6.201e-180
Identity = 264/546 (48.35%), Postives = 377/546 (69.05%), Query Frame = 2
Query:  206 EECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            E  E  EG  +NF +S +  + L+ARGV  LF IQ+KTF+ +++GKDVI QA+TGTGKTF+FA+P++ KL++     + GR PKV+V+APTREL  Q+A DF+ +T + L     YGG SY+ QV A++SG+DI+ G PGR++D +   +LDLSQ+++V+LDEVD+MLDMGF++ V+EILS  Y KD   N   PQTLLFSAT P W++ + KKY+R+  V++ L+ K   KAA+TVEHLAI C W +RA  + D+++VY G ++ R I+FCE KK+A EL+ + ++K +   LHGD+PQ++RE  LK FR G + VLV TNVAARGLD+P++DLV+QC PPKDVE YIHRSGRTGRAGR GVCICF++ KE+  L+ VE  AG TFKR+  P+A  I++++  D ++   S+P    + F+A+A +LIE  G  +A+A ALA ISG    ++ RSLL+S  GFTT ++  + E+   G A+ ALK+ L + I +Q++ + F+K       D       ++K  W DG+   L    ++PEL+E +
Sbjct:   97 ETPEQREGAFSNFKISQKTIQLLQARGVTYLFDIQVKTFNPVYDGKDVIGQARTGTGKTFSFAIPLVEKLQSEPADKRRGRPPKVLVLAPTRELAIQVAKDFKDVTRN-LSVFCFYGGSSYNPQVDAIRSGIDILVGTPGRIKDNLQNNKLDLSQLKHVVLDEVDQMLDMGFAEQVEEILSASYKKDAESN---PQTLLFSATCPPWVYDVAKKYMRSQFVHVDLIGKKTQKAATTVEHLAIACHWSQRAAVLGDVVQVYSG-SHGRSIVFCETKKEAHELSMNPSIKQNAQSLHGDIPQKQRETTLKGFRNGTFEVLVATNVAARGLDIPEVDLVVQCSPPKDVESYIHRSGRTGRAGRTGVCICFYQRKEEDQLRYVEKKAGITFKRVGVPTANDIVKSSSKDAVRYLDSVPAAAIEYFRAAAERLIEERGPVEALAAALAHISGAT-TLEQRSLLNSDAGFTTMIMNCSVEMNNIGTAWRALKEQLGEEIDDQIRRMIFLK-------DQMVHIHSVLKDKWEDGRRWQLTVATELPELKEQQ 629          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 208.764 bits (530), Expect = 3.101e-57
Identity = 124/365 (33.97%), Postives = 203/365 (55.62%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L +N+   G     P+Q      I   +D++A A+TG+GKT AF LP++ +L  + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++ G PGR+ D+I RG++ LS++ Y++LDE DRMLDMGF   + +++S          K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   IQ     +   + ++++  G     R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P ++E+Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  226 LSRNVAKSGYVKPTPVQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCGTPGRLLDIIGRGKVGLSKLRYLVLDEADRMLDMGFEPDMRKLVS----SPGMPAKEERQTLMFSATYPEDIQRLAADFLKVDYLFLAVGVVGG--ACSDVEQHIIQVDQYSKREQLLELLKTTG---TERTMVFVETKRSADFIATFLCQEKVPTTSIHGDREQREREKALSDFRTGQCPVLVATSVAARGLDIEHVQHVVNFDLPNNIEEYVHRIGRTGRCGNTGRAVSFFYPESDTPLAR 581          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 208.379 bits (529), Expect = 5.093e-57
Identity = 126/366 (34.43%), Postives = 203/366 (55.46%), Query Frame = 2
Query:  260 LKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFS-DIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQK 1339
            L +N+   G     P+Q      I   +D++A A+TG+GKT AF LP++ +L  + V+ S     ++P+ I++APTREL++QI  +       + ++ + +YGG++    +  +  G +++ G PGR+ D+I RG++ LS++ Y++LDE DRMLDMGF  D+   + S   P      K   QTL+FSAT P+ I ++   +L+ D + + +   G   A S VE   IQ     +   + ++++  G     R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR G+  VLV T+VAARGLD+  +  V+    P ++E+Y+HR GRTGR G  G  + FF P+    L +
Sbjct:  247 LSRNVAKSGYVKPTPVQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREVLKGCNVLCGTPGRLLDIIGRGKVGLSKLRYLVLDEADRMLDMGFEPDMRKLVSSPGMPA-----KEERQTLMFSATYPEDIQRLAADFLKVDYLFLAVGVVGG--ACSDVEQHIIQVDQYSKREQLLELLKTTG---TERTMVFVETKRSADFIATFLCQEKVPTTSIHGDREQREREKALSDFRTGQCPVLVATSVAARGLDIEHVQHVVNFDLPNNIEEYVHRIGRTGRCGNTGRAVSFFYPESDTPLAR 602          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 201.445 bits (511), Expect = 5.635e-55
Identity = 123/345 (35.65%), Postives = 188/345 (54.49%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTREL---VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD---CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEP 1315
            PIQ + +     GKD++  A+TG+GKT A+ LP I  + N    L+ G  P  +V+APTREL   V Q+A+++    +S+LK+  IYGG     Q+  L+ GV+I    PGR+ D ++ G+ +L +  Y++LDE DRMLDMGF   + +I+  I P          QTL++SAT P  + ++ + +L+    +NI  ++     A   +  +   C   E+   +  ++         + IIF E K+  DEL     M+ D      +HGD  Q++R+ VL +F+ GK  +L+ T+VA+RGLDV D+  VI    P   EDYIHR GRT R+ + G    FF P
Sbjct:  119 PIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHI-NHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGR--ASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR--------QTLMWSATWPKEVRQLAEDFLKEYVQINIGALQ---LSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRR--MRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTP 447          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 3.463e-54
Identity = 121/361 (33.52%), Postives = 188/361 (52.08%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL------------ENVSGSLKPGRK---PKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRE---RAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEK 1324
            P+Q      I   +D++A A+TG+GKT AF LP+++++            +N   ++K G++   P  +V+APTREL  QI  +       S ++   +YGG     QV  L+ G  ++   PGR+ D+++RG++ L    Y++LDE DRMLDMGF   +  I+     +D    K   QTL+FSAT P  I  + + +L  D + + +      +  S  E++  +  W E   +   + D++   G   ++  ++F E KK AD L      +   C  +HGD  Q  RE  L  FR G+  +LV T VAARGLD+P++  VI    P D+E+Y+HR GRTGR G  G    F+  K +
Sbjct:   84 PVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVE----QDVMPTKGDRQTLMFSATFPKEIQILARDFLE-DYIFLAV-----GRVGSASENITQKVVWVEEMDKRSFLLDLLNATG--RDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNE 432          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 191.815 bits (486), Expect = 1.631e-51
Identity = 134/394 (34.01%), Postives = 204/394 (51.78%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPV---ITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSK---LKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYI----YPKDTND---------------NKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELA-SHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEK---YDLQKV 1342
            L   +++ +E  G K   PIQ +      + +D+I  A+TG+GKT AF +P+   IT L  +       + P  +++APTREL  QI    E++   K   ++T+ + GG+S + Q   L+ G  IV   PGR+ D+++   L LS+  YV+LDE DRM+DMGF   V  IL ++       DT+D               +K R QT++F+ATMP  + ++ + YLR  AV + +   G  K    VE         E+   + +++     G     IIF  +KK  D LA S   M  +   LHG   QE+RE  L   + G   +LV T+VA RG+D+ D+ +V+     K++EDY HR GRTGRAG+ GV + F   ++    YDL++ 
Sbjct:  327 LPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEE--ETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYR-QTVMFTATMPAAVERLARSYLRRPAV-VYIGSVG--KPIERVEQRVFIMGESEKRKKLLELL---SRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDLKQA 711          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 187.193 bits (474), Expect = 2.509e-49
Identity = 125/379 (32.98%), Postives = 197/379 (51.98%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSS-KLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLI--DRGQL-DLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD--CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF-EPKEKY--DLQKVENLAG 1357
            +S+++   L+ +  +   PIQ +    I  G+D+I  AKTG+GKT  F LP+   + +    L+ G  P  ++M PTREL  QIA +    T    L+ + +YGG    +Q++ LK G +I+   PGRM D++  + G++ +  +  Y++LDE DRM DMGF   V  I+    P          QT++FSAT P  +  + ++ L    V + +   G S   S VE   I      +   + +++ +Y        I+F ++++ AD L     MK+   C  LHG + Q  R+ ++  F+ G   ++V T+VAARGLDV  + +V+    P   EDY+HR GRTGRAG KG    F    +E+Y  D+ K   L+G
Sbjct:  376 ISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMD-QRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDR--------QTVMFSATFPRAMEALARRIL-NKPVEVQV--GGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQ--EKGAVIVFVDKQEHADTLLK-DLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSG 739          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.178 bits (448), Expect = 9.525e-49
Identity = 122/357 (34.17%), Postives = 186/357 (52.10%), Query Frame = 2
Query:  305 IQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSS-KLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQ-LDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLA---IQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH-SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAG 1357
            IQ++      +GKD+I  A+TG+GKT AFALP++  L      L   ++   +V+ PTREL  QI+  FE+L SS  +K+  + GG+    Q  AL     ++   PGR+ D ++  +  ++  ++Y+++DE DR+L+M F   VD+IL  I PK+        +T LFSATM   + K+ +  L+        V+   S    TVE L    +  P + +   +  I+    G +    IIFC    +   +A     +      LHG + Q KR   L KF+    S+L+ T+VA+RGLD+P +D+VI    P   +DYIHR GRT RAGR G  I F    +    Q++E+L G
Sbjct:   21 IQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQAL------LDAPQRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKGFNIRALKYLVMDEADRILNMDFETEVDKILKVI-PKER-------KTYLFSATMTKKVQKLQRAALKEP------VKCSVSTKYQTVEKLQQYYVFIPAKFKDSYLVYILNELAGNS---FIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVSQYDVELFQRIEHLIG 354          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Match: DDX54 (DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:20084])

HSP 1 Score: 171.785 bits (434), Expect = 4.493e-47
Identity = 124/370 (33.51%), Postives = 193/370 (52.16%), Query Frame = 2
Query:  227 GDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESL-TSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWR-ERAGTIPDIIRVYGGGNNARCIIFCERKKDAD---ELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKE 1321
            G   +  LS  + K +  +G KV  PIQ K    I EG+DV+A A+TG+GKT AF +P+  +L   S         + +V++PTREL  Q +   + L   + LKT  I GG   + Q +AL    DI+ G PGR+  ++    L L  +EYV+ DE DR+ +MGF++ + EI+     +   D++   QTLLFSAT+P  + +  +  L +D V I L    DSK +  ++ LA  C    ++   +  ++R     +  + ++F   K   +   EL S + M   C  ++  + Q +R++ + KF   K  +L+ T+VAARG+D P +D VI  + P   + +IHR GR  RAGR G       P E
Sbjct:   33 GGFQSMGLSYPVFKGVMGKGYKVPTPIQRKCIPVILEGRDVVAMARTGSGKTAAFLVPMFERLHARSAQ----AGARALVLSPTRELALQTSKFTKELGKHTGLKTALILGGDRMEDQFAALHENPDIIIGTPGRLMHVVVEMNLKLQAMEYVVFDEADRLFEMGFAEQLTEII-----RRLPDSR---QTLLFSATLPKQLVEFARAGL-SDPVLIRL--DVDSKLSDQLK-LAFMCSRADDKPCVLLHLLRTVVKPHE-QTVVFVATKHHVEYLRELVSQAGM--SCAYIYSALDQTERKINVGKFVHKKTMLLIVTDVAARGID-PMLDNVINYNFPGKPKLFIHRVGRVARAGRSGTAYSLVAPDE 382          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 212.231 bits (539), Expect = 1.673e-60
Identity = 121/346 (34.97%), Postives = 196/346 (56.65%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSS-KLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGG--NNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKY 1327
            PIQ   + ++  GKDV+  A+TG+GKTFAF +P I+ L N     +  R  +V+V++PTREL SQI  +   LT    ++   +YGGV  D+Q   LK    +V   PGR+ DL+  G +DLSQ+ Y++LDE DRML+ GF + +  I+     ++T+ +K   QTL+F+AT P  + ++   ++  + + + +       A   +  +      R +   + ++++ Y  G   N + +IF   KK+A  +  +      +   +HGD+ Q++R   L +F+ GK ++L+ T+VAARGLD+P++  VI    P  VEDY+HR GRTGRAG+ G     F  +EK+
Sbjct:  137 PIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMND----QKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKS-QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNII-----RETDASKR--QTLMFTATWPKEVRELASTFM-NNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKH 469          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 211.46 bits (537), Expect = 1.677e-59
Identity = 125/366 (34.15%), Postives = 197/366 (53.83%), Query Frame = 2
Query:  245 PLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRK---------PKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            PL   L +N++        P+Q  +   +  G+D++A A+TG+GKT  F  PV+++      S +P  +         P  ++MAPTREL +QI  + +  T  S +K   +YGG     Q+  ++ G D++   PGR+ DL++RG++ L+ ++Y++LDE DRMLDMGF   +  I+      D      R QTL+FSAT P  I  + + +L +D + + +      +  ST E++  +  + E       ++ +     +   +IF E K+ AD+L     M++     +HGD  Q +RE  L  FR G  ++LV T VAARGLD+P++  VI    P DV+DY+HR GRTGRAG  G+   FF
Sbjct:  148 PLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDC---DMTPVGER-QTLMFSATFPADIQHLARDFL-SDYIFLSV-----GRVGSTSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFF 503          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 208.764 bits (530), Expect = 5.552e-59
Identity = 122/356 (34.27%), Postives = 193/356 (54.21%), Query Frame = 2
Query:  272 LEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTD-AVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCH---VLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEK 1324
            ++A G      IQ + +     G+D++  A TG+GKT ++ LP I  + N    L PG  P V+V+APTREL  QI ++      SS+++   +YGGV   +Q+  L  G +IV   PGR+ D+++ G+ +L ++ Y++LDE DRMLDMGF   + +I+  I P          QTL++SAT P  + ++   YL     V +  +E   S   + +  +      R+R   +   +      N  + +IF   K+  D++  +  ++ D      +HGD  Q +R+ VL++FR G+  ++V T+VAARG+DV  I+ VI    P ++EDY+HR GRTGRAG  G  I FF  + K
Sbjct:  128 VKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHI-NAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR--------QTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDR---LNKYLETASQDNEYKTLIFASTKRMCDDITKY--LREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTEQNK 469          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 206.453 bits (524), Expect = 1.247e-57
Identity = 128/372 (34.41%), Postives = 197/372 (52.96%), Query Frame = 2
Query:  230 DLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKP-------GRK--PKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFE 1312
            D ++ PL   L +N++        P+Q  +   + +G+D++A A+TG+GKT  F  P+ T+L     S  P        RK  P  +V+APTREL +QI  +    T  S ++   +YGG     Q+  +  G D++   PGR+ DL++RG++ L+ I+Y++LDE DRMLDMGF   +  I+      D    +NR QTL+FSAT P  I  + + +L     N   +  G  +  ST E++  +  + +       ++ +    +    +IF E K+ AD+L     M++     +HGD  Q +RE  L  F+     +LV T VAARGLD+P++  VI    P D++DY+HR GRTGRAG  GV   FF 
Sbjct:  155 DFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEEC---DMPSVENR-QTLMFSATFPVDIQHLARDFLD----NYIFLSVG--RVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 516          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 195.667 bits (496), Expect = 4.362e-54
Identity = 127/360 (35.28%), Postives = 189/360 (52.50%), Query Frame = 2
Query:  302 PIQ---IKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSG---SLKPGRKPKVIVMAPTRELVSQIASDFESLT-------SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTN-DNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHV--LHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDL 1333
            PIQ   I    ++ + +D +  A TG+GKT AF +P++ K+        SLK    PK +++APTRELV QI  + + +T       +   K ++I GG S ++   +L  G DI+   PGR+ D ++   L + Q+E ++LDE D+M+D+GF D V  IL+ +   D N D+    QTL+F+ATM   I KI   Y++        VE G       V   A      ++   +  I+  Y    +   IIF   K+ AD LA     +++  V  LHG   QE+RE  L+ FR  K  +++ TNVAARGLD+P++ LV+     K ++DYIHR GRTGRA  +G  + F    E   L
Sbjct:  199 PIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKV---DINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADND--EDKFKKLKPIVAKY----DPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESL 549          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 199.134 bits (505), Expect = 6.213e-57
Identity = 118/323 (36.53%), Postives = 182/323 (56.35%), Query Frame = 2
Query:  350 IAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFE 1312
            +A A+TG+GKT A+ LPV+T L    G   P R P  + +APTREL  QI  +    +  + +K    YGGVS   Q S L+ G   + G PGR++D + R ++ L  I+++ILDE DRMLD+GF   + +++     +     K   QTL+FSAT PD I  +   +L+ D + + +   G +    T +H+ I     E+   + +I+   G     R ++F E K+ AD LA+  +  +     +  D  Q +RE  L+ FR+G+ ++LV T+VAARGLD+P++  VI    P+D+E+Y+HR GRTGR G +G    F+E
Sbjct:    1 MACAQTGSGKTAAYMLPVLTSLIK-QGLNAPPRSPLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYGGVSVPYQASQLERGCHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRMLDLGFGPDIHKLIE----ESNMTAKESRQTLMFSATFPDEIQHLAGSFLKPDYLFLAVGRVGGTNLDIT-QHV-ITVNGSEKRDKLHEILSATG---TDRTLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFYE 313          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 199.519 bits (506), Expect = 3.616e-56
Identity = 121/339 (35.69%), Postives = 183/339 (53.98%), Query Frame = 2
Query:  305 IQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESL-TSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD---CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            IQ + +     G++++  A+TG+GKT +F LP I  + N    L+PG  P V+V+ PTREL  Q+     S+    KL++  IYGG     Q+  L+ GV+I    PGR+ D+++  + +L +  Y++LDE DRMLDMGF   +  I+  I P          QTL++SAT P  +  +   +L +D V+I +   G + A   +  +   C   E+   +  ++    G    + +IF E K+ ADEL     ++SD      +HGD  Q +R+ VL +FR+G   +LV T+VA+RGLD+ DI  VI    P   EDY+HR GRT R+ R G    FF
Sbjct:   84 IQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHI-NHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDR--------QTLMWSATWPKEVQGLAHDFL-SDYVHITVGSLGLT-ANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTR--KLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFF 409          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Match: EDO37956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE71])

HSP 1 Score: 193.356 bits (490), Expect = 2.560e-54
Identity = 124/373 (33.24%), Postives = 194/373 (52.01%), Query Frame = 2
Query:  206 EECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDF-ESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSK-AASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDAD---ELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            E+C       ++  L  EL   L  +  +V  PIQ+++ S +  G+D+I  A+TG+GKT A++LP+   L   + S  PG  P  +++ PTREL+ Q+  +  E L   +     + GGV    Q  AL+ G D+V   PGR+ DL  RG L L +I Y+++DE DRML MG    ++E L  I    T  ++ R QTLL+SAT+P+ + ++     R+  +N   ++ G     A +V+   +     ++   + + +R          I+F    ++ D   EL       +    LH + PQ+ R  ++K FR+GK  +LV T+VA+RGLD P++  VI    P  +E YIHR GRTGR G  G+   F 
Sbjct:   33 EDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPS-NPGDTPVALILTPTRELMQQVFMNVSEMLDVIRCPGNPVCGGVPVSTQTIALREGADVVVATPGRLLDLCKRGALCLDKITYLVMDEADRMLGMG----MEEQLRKIVGLATGTSRAR-QTLLWSATLPESLERLA----RSAVLNPITIQVGPGGLIAPSVQQNVVFLYHYQKPQKLLETLRT---TPYPPVIVFTSSIQNVDYVTELLKQEQFHASG--LHSEKPQDYRFKLVKAFRDGKVDILVATDVASRGLDFPEVTHVINYDLPDTIECYIHRCGRTGRIGHHGIATSFL 390          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 198.749 bits (504), Expect = 3.719e-54
Identity = 130/388 (33.51%), Postives = 194/388 (50.00%), Query Frame = 2
Query:  200 TSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKP-----GRK---PKVIVMAPTRELVSQIASDFESLTSSKL-KTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPW---RERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD-CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEK 1324
            T +EC        +  L   L  N+   G K   P+Q      +   +D++A A+TG+GKT AF +P+++++        P     GR+   P  +V+APTREL  QI  +    +   L +   +YGG     Q+  L     ++   PGR+ D++DRG++ L  I +++LDE DRMLDMGF   +  I+     +D+       QTL+FSAT P  I  + + +L     N   +  G  K  ST E++  +  W    ++   + D++     G     ++F E KK AD L    A     C  +HGD  Q +RE  L+ FR G   +LV T VAARGLD+P++  VI    P D+E+Y+HR GRTGR G  G+   FF  K K
Sbjct:  183 TGQECPKNIELFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRNCHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDMGFEPQIRRIVD----QDSMPKTGIRQTLMFSATFPKEIQMLARDFLE----NYIFLAVG--KVGSTSENITQKVVWVDEFDKRSFLLDLLNA--SGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNHKNK 558          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 193.741 bits (491), Expect = 1.028e-53
Identity = 129/378 (34.13%), Postives = 195/378 (51.59%), Query Frame = 2
Query:  245 PLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVIT-KLENVSG-SLKPGRKPKVIVMAPTREL-------VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAAST-----VEHLA--------IQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            P+   LKK    +G+    PIQ++    +  G+D+I  A TG+GKT  F LP+I   LE       +    P  +++ P+REL       ++  +   E+     L+T    GG S  +Q  A+K GV +V   PGR+ DL+D+  + L    Y++LDE DRM+DMGF + V  I SY         K++ QTLLFSATMP    K ++ + ++  V    V  G + AAS      VE++         ++C  +    T P ++            IF E+K D D++  +  +K  +   +HGD  QE+R   +++F +G   VLV T+VA++GLD PDI  VI    P+D+E+Y+HR GRTGR G+ GV   F 
Sbjct:   57 PILAALKK----KGITHPTPIQVQGLPAVLTGRDMIGIAFTGSGKTLVFTLPIIMFSLEQEKAMPFQRNEGPYGMIVVPSRELARQTFEVITHFSRALEAHGFPSLRTNLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKRIITLDVCRYLVLDEADRMIDMGFEEDVRTIFSYF--------KSQRQTLLFSATMP----KKIQNFAKSALVKPVTVNVGRAGAASLDVIQEVEYVKQEAKVVYLLECLQK----TPPPVL------------IFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVATDVASKGLDFPDIQHVINFDMPEDIENYVHRIGRTGRCGKTGVATTFI 402          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Match: ddx21 (DExD-box helicase 21 [Source:NCBI gene;Acc:101155411])

HSP 1 Score: 529.635 bits (1363), Expect = 1.015e-178
Identity = 263/548 (47.99%), Postives = 383/548 (69.89%), Query Frame = 2
Query:  200 TSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETE 1843
            T E  E  EG  +NF +S      L+ARGV  LF IQ+KTF+ +++G+DV+AQA+TGTGKTF+FA+P++ +L+   G    GR PKV+V+ PTREL  Q+A DF+ + S KL     YGG SY+ Q+ A+++G+DI+ G PGR++D +   +L+LS +++V+LDEVD+MLDMGF++ V+EILS  Y KD++ N   PQTLLFSAT P W++++ KKY+R    ++ L+ K   +AA+TVEHLAI C W +RA  I D+I+VY G ++ R IIFCE KK+A+EL+ ++++K     LHGD+PQ++RE+ LK FR G + VLV TNVAARGLD+P++DLV+Q  PPKDVE YIHRSGRTGRAGR GVCICF++ KE+  L+ VEN AG TF+R+  P+A  II+A+  D ++   S+P T  + F+ SA +LIE  GA +A+A ALA ISG    ++ RSLL+S +   ++ +T + E+   GYA+  +K+ L D     +  + F+KG+ G+ FD+P++  + + ++W DG+   L    ++PELEE +
Sbjct:   48 TEETPEQKEGAFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTGKTFSFAIPLVERLQKEGGETTRGRPPKVLVLTPTRELAIQVAKDFKDV-SKKLAIACFYGGSSYNPQLDAIRNGIDILVGTPGRIKDHLQNHKLNLSDLKHVVLDEVDQMLDMGFAEQVEEILSLSYKKDSDTN---PQTLLFSATCPPWVYEVAKKYMRPGCKHVDLIGKKTQRAATTVEHLAIACHWSQRAAVIGDVIQVYSG-SHGRTIIFCETKKEANELSMNASIKQSSQTLHGDIPQKQREITLKGFRNGAFEVLVATNVAARGLDIPEVDLVVQSSPPKDVESYIHRSGRTGRAGRTGVCICFYQRKEEEQLRYVENKAGITFRRVGVPTANDIIKASSKDAVRFLDSVPVTAIEYFKESAEKLIEERGAVEALAAALAHISGATS-LEQRSLLNS-DAVRSHHMTCSQEMHNLGYAWRTIKEQLGDEFENHIHRMTFLKGKNGVCFDVPSDKVKEMMSNWQDGRRWQLTVATELPELEEKQ 588          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 224.172 bits (570), Expect = 4.856e-63
Identity = 134/380 (35.26%), Postives = 215/380 (56.58%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFS-DIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFK 1369
            L   LK N+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +L  + V+ S     ++P+ +++APTREL++QI  +    +  + ++ + +YGGV+   Q+  ++ G +++ G PGR+ D+I RG++ LS++ +++LDE DRMLDMGF  D+   + S   P     +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A + VE   +Q     +   + D++R  G   + R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR GK  VLV T+VA+RGLD+PD+  V+    P  ++DY+HR GRTGR G  G  + F++P    D Q   +L G   K
Sbjct:  188 LCESLKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFSFGTCVRPVVVYGGVNTGYQMREIEKGCNVLCGTPGRLLDMIGRGKVGLSKVRHLVLDEADRMLDMGFEPDMRRLVGSPGMP-----SKEERQTLMFSATFPEDIQRLAADFLKVDYLFVAVGVVG--GACTDVEQTFLQVTKFNKREQLLDLLRTIG---SERTMVFVETKRQADFIAAFLCQEKVPTTSIHGDREQREREKALADFRSGKCPVLVATSVASRGLDIPDVQHVVNFDLPNTIDDYVHRIGRTGRCGNTGRAVSFYDP--DVDSQLARSLVGILAK 555          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 223.016 bits (567), Expect = 7.847e-62
Identity = 134/380 (35.26%), Postives = 215/380 (56.58%), Query Frame = 2
Query:  248 LSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKL--ENVSGS-LKPGRKPKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFS-DIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAM-KSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFK 1369
            L   LK N+   G     P+Q      I  G+D++A A+TG+GKT AF LP++ +L  + V+ S     ++P+ +++APTREL++QI  +    +  + ++ + +YGGV+   Q+  ++ G +++ G PGR+ D+I RG++ LS++ +++LDE DRMLDMGF  D+   + S   P     +K   QTL+FSAT P+ I ++   +L+ D + + +   G   A + VE   +Q     +   + D++R  G   + R ++F E K+ AD +A+     K     +HGD  Q +RE  L  FR GK  VLV T+VA+RGLD+PD+  V+    P  ++DY+HR GRTGR G  G  + F++P    D Q   +L G   K
Sbjct:  298 LCESLKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFSFGTCVRPVVVYGGVNTGYQMREIEKGCNVLCGTPGRLLDMIGRGKVGLSKVRHLVLDEADRMLDMGFEPDMRRLVGSPGMP-----SKEERQTLMFSATFPEDIQRLAADFLKVDYLFVAVGVVGG--ACTDVEQTFLQVTKFNKREQLLDLLRTIG---SERTMVFVETKRQADFIAAFLCQEKVPTTSIHGDREQREREKALADFRSGKCPVLVATSVASRGLDIPDVQHVVNFDLPNTIDDYVHRIGRTGRCGNTGRAVSFYDP--DVDSQLARSLVGILAK 665          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:101166328])

HSP 1 Score: 211.46 bits (537), Expect = 2.745e-58
Identity = 133/361 (36.84%), Postives = 193/361 (53.46%), Query Frame = 2
Query:  233 LNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKG--DSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICF 1306
            L  F    E+ +N++  G     PIQ + +  +  G+D+IA A+TGTGKT A+ LP    ++           P ++V+ PTREL  QI ++ +  +    K++ IYGG     Q++ +KSGVDIV   PGR+ DL     ++L  I Y++LDE DRMLDMGF   + +IL  I P          QT++ SAT P  + ++ K YL+    N  +V  G  D  A  TV+         E+   + D IR     + A  IIF  +K  AD+L+S   ++      LHGD  Q  RE  LK F+E +  +LV T++A+RGLDV DI  V     P+++E+Y+HR GRTGRAGR G  +  
Sbjct:  228 LEAFERYPEIMENIDRVGFVRPTPIQSQAWPVLLSGEDLIAIAQTGTGKTLAYLLPGFIHMDGQPVPRAEWGGPGMLVLTPTRELALQIETECKKYSYKGYKSICIYGGGDRRGQINLVKSGVDIVIATPGRLNDLQMNELINLFSITYLVLDEADRMLDMGFEPQIMKILLDIRPDR--------QTVMTSATWPSGVRRLAKSYLK----NPMMVYVGTLDLAAVDTVQQTITIVQEEEKKAFVMDFIRNMLPQDKA--IIFVGKKIKADDLSSDLCLQGLAVQSLHGDREQRDREEALKDFKESRVRILVATDLASRGLDVHDITHVFNYDFPRNIEEYVHRVGRTGRAGRSGAAVTL 574          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Match: si:dkey-156n14.5 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101158507])

HSP 1 Score: 207.223 bits (526), Expect = 9.780e-57
Identity = 129/356 (36.24%), Postives = 191/356 (53.65%), Query Frame = 2
Query:  305 IQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTREL---VSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTD-AVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD---CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEP---KEKYDLQKV 1342
            IQ + F     GKD++  A+TG+GKT A+ LP I  + N    L+ G  P  +V+APTREL   V Q+A D+    SS++K+  +YGG     Q+  L+ GV+I    PGR+ D ++ G+ +L +  Y++LDE DRMLDMGF   + +I+  I P          QTL++SAT P  + ++ + +LR    +NI  +E     A   +  +   C   E+   +  ++         + IIF E KK  D+L     M+ D      +HGD  Q +R+ VL +FR GK  +L+ T+VA+RGLDV D+  VI    P   EDY+HR GRT R+  KG    FF P   ++  DL +V
Sbjct:  122 IQSQGFPVALSGKDMVGIAQTGSGKTLAYLLPAIVHI-NHQPYLERGDGPICLVLAPTRELAQQVQQVAYDYGK--SSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR--------QTLMWSATWPKEVRQLAEDFLREYIQINIGALE---LSANHNILQIVDVCMENEKDNKLLQLMEEIMAEKENKTIIFVETKKRCDDLTR--KMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPSSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRV 461          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Match: SMESG000065959.1 (SMESG000065959.1)

HSP 1 Score: 1200.65 bits (3105), Expect = 0.000e+0
Identity = 634/634 (100.00%), Postives = 634/634 (100.00%), Query Frame = 2
Query:   89 CKSEKLQKDVKEKNESEKENFXXXXXXXXXXXXXXXNTSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRSFNGKSQGGNNPKLVKFD 1990
            CKSEKLQKDVKEKNESEKENFGKGKKVKSEKLKLKKNTSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDRNGGGFRNGGWGGRRNGGFNNDRKGGGVKRSFNGKSQGGNNPKLVKFD
Sbjct:    2 CKSEKLQKDVKEKNESEKENFGKGKKVKSEKLKLKKNTSEECESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDRNGGGFRNGGWGGRRNGGFNNDRKGGGVKRSFNGKSQGGNNPKLVKFD 635          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Match: SMESG000065959.1 (SMESG000065959.1)

HSP 1 Score: 983.4 bits (2541), Expect = 0.000e+0
Identity = 508/508 (100.00%), Postives = 508/508 (100.00%), Query Frame = 2
Query:  467 MAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRSFNGKSQGGNNPKLVKFD 1990
            MAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDRNGGGFRNGGWGGRRNGGFNNDRKGGGVKRSFNGKSQGGNNPKLVKFD
Sbjct:    1 MAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANLIDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVKNRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFVKGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDRNGGGFRNGGWGGRRNGGFNNDRKGGGVKRSFNGKSQGGNNPKLVKFD 508          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Match: SMESG000079612.1 (SMESG000079612.1)

HSP 1 Score: 213.001 bits (541), Expect = 2.441e-57
Identity = 131/362 (36.19%), Postives = 202/362 (55.80%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFESLTSSK-LKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDL--IDRGQL-DLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSD-CHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFFEP-KEKY--DLQKVENLAGFT 1363
            PIQ +    I  G+DVI  AKTG+GKT A+ +P++  ++     ++ G  P  IVM+PTREL  QI  +   LT+ K ++ + IYGG    +Q++ LK G +I+   PGRM D+  ++ G++ ++ +  +++LDE DRM DMGF   V  IL +I P          QT++FSAT P  +  + +K L      I +   G S     V   A+     E+   + +++ +Y  G   + I+F E++++AD L      +   C  +HG + Q+ R+  +  F+ G+  +L+ T+VAARGLDV D++LV+    P   EDY+HR GRTGRAG KGV   F  P +EKY  D+ K   L+G T
Sbjct:  315 PIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVK-AQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDR--------QTVMFSATFPRKMEALARKVLNNP---IEIEVGGKSIVCQDVSQNALILDETEKFNKLLELLGLYQEG--GKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGAT 662          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 208.764 bits (530), Expect = 1.574e-56
Identity = 125/344 (36.34%), Postives = 185/344 (53.78%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRK-----PKVIVMAPTRELVSQIASDFESLT-SSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDAVNICLVEKGDSKAAS-TVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKS-DCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            PIQ      I E +D++A A+TG+GKT AF +P+I  L  +S  L P R      PK +++APTREL  QI S+ +  + ++++++  +YGG     Q+  ++ G  ++   PGR+ D I++ ++ L   +Y++LDE DRMLDMGF   + +I   I   +     NR QTL+FSAT P  I K+   +L     N   +  G   + S +++   I     E+   + +I        N   +IF E KK AD LA     K      +HGD  Q +RE  L  FR G+  +LV T VAARGLD+P++  VI    P D+E+Y+HR GRTGR G  G    F+
Sbjct:  210 PIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHL--ISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQIGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDMGFEPQIRKI---IEESNMPSGINR-QTLMFSATFPKEIQKLAADFL----YNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLNYLKNIFNTTAP--NTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFY 541          
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Match: SMESG000011907.1 (SMESG000011907.1)

HSP 1 Score: 207.223 bits (526), Expect = 4.587e-55
Identity = 124/351 (35.33%), Postives = 191/351 (54.42%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGRK---PKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYLRTDA-VNICLVEKGDSKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVL-----------HGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            PIQ   +  +  G+D+I  A+TGTGKT AF LP    +E   G  KP  K   P V++++PTREL  QI ++ +  T   + ++  YGG     Q+  LK   +IV G PGR++DL D G L+L  + Y++LDE DRMLDMGF     ++++ IY       + + QT++ SAT P  + +I   +++    VN+  +   D  A  TV+       + ++   + +I+      +  + IIF  RK    +LA    +K    +L           HGD+ Q++RE+ LK  R G  ++++ T+VA+RGLD+PD+  VI    PK++E+Y+HR GRTGRAGR G    F 
Sbjct:  381 PIQCIAWPILMTGRDLIGIAQTGTGKTLAFLLPAFIHIE---GQPKPREKRQGPTVLILSPTRELAIQIQNEVQKYTYHDIDSVVCYGGADKRDQIYQLKENPEIVVGTPGRIQDLKDSGVLNLKDVSYLVLDEADRMLDMGFE---IQVVNLIYAV-----RRQRQTVMTSATWPFGVQRIALTHMKNPVQVNVGTL---DLNACHTVKQHVEYVDYHDKTQRLVEILAHIKPED--KIIIFVARKAQCSDLAFELFLKRSKGLLGPKGAVKACEIHGDLDQQEREMALKMMRSGARNIMIATDVASRGLDIPDLTKVINYDFPKNIEEYVHRVGRTGRAGRTGEAFTFM 715          

HSP 2 Score: 205.297 bits (521), Expect = 2.112e-54
Identity = 127/361 (35.18%), Postives = 186/361 (51.52%), Query Frame = 2
Query:  302 PIQIKTFSHIFEGKDVIAQAKTGTGKTFAFALPVITKLENVSGSLKPGR---KPKVIVMAPTRELVSQIASDFESLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDLSQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSATMPDWIHKIVKKYL----RTDAVNICLVEKGD--------SKAASTVEHLAIQCPWRERAGTIPDIIRVYGGGNNARCIIFCERKKDADELASH----------SAMKSDCHVLHGDVPQEKRELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSGRTGRAGRKGVCICFF 1309
            PIQ   +  I  G+D I  A+TGTGKT  F LP +  +E   G +KP +    P V++++PTREL  QI S+   +    +K++  YGG     Q+++L+   +IV G PGR+ DL+  G L+L  + Y++LDE DRMLDMGF   V  I+        ND + + Q+++ SAT P+ + +I   Y+    + +  ++ L+   D        +    T E + I C   E                  + I+F  RK     L  +          S   S C + HGD+ QE RE  L  FR+G  S+L+ TNVA+RGLD+ DI  V+    PKD+E+Y+HR GRTGRAG+ G  I F 
Sbjct:  994 PIQCIGWPVILGGRDFIGIAQTGTGKTLTFVLPALIHIE---GQMKPRQYRYGPTVLILSPTRELAMQIESEILKIKYHNIKSVCCYGGAEKMYQINSLRDNPEIVVGTPGRINDLVLMGCLNLKDVSYLVLDEADRMLDMGFEPQVVSII--------NDTRKQRQSIMTSATWPECVRQIALLYMDNPVQVNVGSLDLIACNDVVQEIKFVTNFDKTNELINIICDMNE----------------TDKVIVFVTRKVQCRSLTKYLDKLIRSNQLSPFASICEI-HGDLSQEDREQSLSWFRDGHCSILIATNVASRGLDIADITCVVNYDFPKDIEEYVHRVGRTGRAGKAGKSITFM 1326          
The following BLAST results are available for this feature:
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX210.000e+051.67DExD-box helicase 21 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX210.000e+051.67DExD-box helicase 21 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX501.389e-17648.16DExD-box helicase 50 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX508.862e-17147.61DExD-box helicase 50 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX49.446e-6034.72DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y54G11A.31.180e-6037.10pep chromosome:WBcel235:II:14276621:14283973:1 gen... [more]
ddx-237.577e-5737.33DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-171.268e-5634.79DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-171.268e-5634.79DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-171.268e-5634.79DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vas3.944e-5836.16gene:FBgn0283442 transcript:FBtr0445187[more]
vas3.944e-5836.16gene:FBgn0283442 transcript:FBtr0445185[more]
vas3.944e-5836.16gene:FBgn0283442 transcript:FBtr0445186[more]
Rm622.364e-5634.97gene:FBgn0003261 transcript:FBtr0301947[more]
Rm622.364e-5634.97gene:FBgn0003261 transcript:FBtr0078650[more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx213.820e-17947.89DEAD (Asp-Glu-Ala-Asp) box helicase 21 [Source:ZFI... [more]
ddx41.124e-5833.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.153e-5833.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.171e-5833.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.178e-5833.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nasp1.883e-15444.30nuclear autoantigenic sperm protein (histone-bindi... [more]
nasp2.467e-15444.30nuclear autoantigenic sperm protein (histone-bindi... [more]
nasp5.015e-15444.30nuclear autoantigenic sperm protein (histone-bindi... [more]
nasp1.210e-14844.93nuclear autoantigenic sperm protein (histone-bindi... [more]
nasp5.863e-14544.74nuclear autoantigenic sperm protein (histone-bindi... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx210.000e+051.47DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Source:... [more]
Ddx501.178e-17447.79DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 [Source:... [more]
Ddx49.256e-5934.72DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx42.351e-5834.72DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx176.108e-5736.13DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3B8Q1|DDX21_RAT0.000e+051.85Nucleolar RNA helicase 2 OS=Rattus norvegicus OX=1... [more]
sp|Q9JIK5|DDX21_MOUSE0.000e+051.47Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 ... [more]
sp|Q9NR30|DDX21_HUMAN0.000e+051.67Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 G... [more]
sp|Q9BQ39|DDX50_HUMAN6.668e-17648.16ATP-dependent RNA helicase DDX50 OS=Homo sapiens O... [more]
sp|Q99MJ9|DDX50_MOUSE8.238e-17447.79ATP-dependent RNA helicase DDX50 OS=Mus musculus O... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6M80.000e+075.72Nucleolar RNA helicase II/Gu protein (Fragment) OS... [more]
G1MYU60.000e+049.91DExD-box helicase 21 OS=Meleagris gallopavo OX=910... [more]
A0A218UQN10.000e+049.63Nucleolar RNA helicase 2 OS=Lonchura striata domes... [more]
A0A3L8S7620.000e+049.82Uncharacterized protein (Fragment) OS=Chloebia gou... [more]
A0A0Q3TTS00.000e+049.72Nucleolar RNA helicase 2-like protein OS=Amazona a... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx210.000e+048.81DExD-box helicase 21 [Source:NCBI gene;Acc:1030321... [more]
ddx216.201e-18048.35DExD-box helicase 21 [Source:NCBI gene;Acc:1030321... [more]
ddx43.101e-5733.97DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
ddx45.093e-5734.43DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
DDX55.635e-5535.65probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.13.463e-5433.52pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx231.631e-5134.01DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx462.509e-4932.98DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ENSPMAT00000000216.19.525e-4934.17pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
DDX544.493e-4733.51DEAD-box helicase 54 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP31.673e-6034.97RNA-Dependent ATPase, member of DExD/H-box family;... [more]
DED11.677e-5934.15ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP25.552e-5934.27ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP11.247e-5734.41Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
PRP284.362e-5435.28RNA binding protein; involved in RNA isomerization... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
VAS16.213e-5736.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380613.616e-5635.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379562.560e-5433.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
PL103.719e-5433.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492471.028e-5334.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx211.015e-17847.99DExD-box helicase 21 [Source:NCBI gene;Acc:1011554... [more]
ddx44.856e-6335.26DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
ddx47.847e-6235.26DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
ddx432.745e-5836.84DEAD-box helicase 43 [Source:NCBI gene;Acc:1011663... [more]
si:dkey-156n14.59.780e-5736.24probable ATP-dependent RNA helicase DDX17 [Source:... [more]
back to top
BLAST of Nucleolar RNA helicase II/Gu protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065959.10.000e+0100.00SMESG000065959.1[more]
SMESG000065959.10.000e+0100.00SMESG000065959.1[more]
SMESG000079612.12.441e-5736.19SMESG000079612.1[more]
SMESG000013025.11.574e-5636.34SMESG000013025.1[more]
SMESG000011907.14.587e-5535.33SMESG000011907.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010637 ID=SMED30010637|Name=Nucleolar RNA helicase II/Gu protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2478bp
ATAAAGTTTTCATTACAAATAAAATTGTTTAAATATTCCACTTTAATTGA
TTAACGTGATTGTAATGGTACGCAAATATTATTTTAGGTGCAAAAGTGAA
AAGTTGCAAAAGGACGTAAAGGAAAAAAATGAATCAGAAAAAGAAAATTT
TGGTAAAGGGAAAAAGGTGAAATCTGAAAAATTAAAACTAAAAAAAAATA
CTAGCGAAGAATGTGAGAGTACCGAAGGAGATTTAAACAACTTTCCTTTA
AGTGTTGAATTAAAGAAAAATTTGGAGGCAAGAGGTGTAAAAGTCTTATT
TCCCATCCAAATCAAAACCTTTAGTCATATATTTGAAGGAAAAGATGTTA
TCGCACAAGCCAAAACTGGAACAGGAAAAACTTTTGCGTTTGCATTACCA
GTAATTACTAAATTAGAAAACGTTAGTGGATCACTGAAACCCGGACGTAA
GCCGAAAGTCATTGTGATGGCTCCTACCAGAGAATTAGTTAGTCAGATCG
CTTCTGATTTTGAAAGTTTGACAAGCAGTAAATTGAAAACTTTGACAATA
TATGGTGGTGTATCATATGATAAACAAGTGTCAGCCTTAAAGAGTGGTGT
TGACATCGTTGCTGGAGCACCTGGTCGGATGAGAGATTTGATTGATCGCG
GTCAGTTGGATTTATCTCAAATCGAATACGTAATTCTTGACGAAGTCGAT
CGCATGCTTGATATGGGCTTCAGTGACATCGTTGATGAAATTCTGTCCTA
TATTTACCCTAAAGATACCAACGATAACAAAAATCGACCACAAACTCTTT
TATTTTCTGCTACTATGCCTGATTGGATCCATAAAATTGTCAAGAAATAT
CTGAGAACTGACGCGGTTAATATTTGTCTCGTTGAAAAAGGTGATTCTAA
AGCGGCTTCTACTGTTGAACATCTCGCTATTCAATGTCCGTGGCGTGAGC
GAGCTGGTACGATTCCTGACATAATACGAGTGTACGGAGGAGGAAATAAC
GCCCGATGTATTATTTTCTGTGAGCGGAAAAAAGATGCCGACGAATTAGC
GTCTCATTCAGCCATGAAAAGCGACTGTCACGTTCTCCACGGTGACGTTC
CACAAGAAAAACGAGAATTGGTATTGAAGAAGTTCCGAGAAGGAAAGTAC
AGCGTGCTGGTTACGACAAATGTTGCCGCGCGAGGTCTCGATGTTCCCGA
TATCGATCTCGTCATTCAATGCCACCCACCGAAAGACGTTGAGGATTACA
TTCATCGATCCGGTAGAACGGGACGTGCCGGTCGCAAAGGAGTTTGCATT
TGTTTCTTTGAGCCGAAAGAAAAATACGATTTGCAAAAAGTCGAAAATCT
CGCGGGATTTACATTCAAACGGATTTTCCCACCGAGTGCAGCATCGATTA
TCGAAGCAAATCTCATTGACACGATTCAGGCGTTTAAATCCATCCCGGAA
ACCGTTGCTGACAGTTTCCAGGCGAGCGCGAATCAATTGATTGAAATGTT
CGGCGCAGAGAAAGCAATGGCGTTGGCACTTGCTAAAATATCGGGTAAAG
TCGACGAAGTGAAAAATAGATCCCTTCTGAGTTCAGCCGAAGGGTTCACC
ACGTATCTATTGACCACCACTGATGAGATTAAGTTCAAGGGTTACGCGTA
TTCGGCACTGAAAAAGTGTTTGCCAGATAATATCGTTGAGCAGGTTAAAT
TGCTTCAATTTGTCAAGGGTAGGAAAGGACTGGTATTCGATATGCCAGCG
GAACACGATGAGATTGTGAAAACCAGTTGGACCGATGGGAAATATAACAC
TTTGGTCAAAGTAGTAGATGTGCCAGAACTCGAAGAAACCGAAGATAGGA
ACGGAGGCGGTTTCAGAAATGGAGGCTGGGGAGGACGAAGGAACGGAGGG
TTCAATAATGACAGAAAAGGAGGGGGAGTGAAACGGAGCTTCAATGGTAA
ATCACAAGGAGGAAATAATCCAAAATTAGTGAAATTCGATTAATAAATTT
CAATTTTAATAGATAATTTTTATTTGTTTATAACTTATATCAACTGAAAT
TTTATCGAGTACTTTCCGGATGTTTTGAATGATTGGATGTTGTGAATGAC
TGAGTGTTGTAAATGATTGGATGCTGTGAATAATTAGATTTTGTAATGGT
TGGATACTGTCAGTTTCATTTTAAGGAATTCTGTTATTTCATATGTCCTT
TAGTCAAAGAATAAGCAAATACAGATAAAATGTATAATTAGGTTGCAAGT
GTCCAATTTAATGATTTATCTCATTCTATAATTCAAATTGATTTTTGAGC
TTCCTGGATTTCCATTGCTTTGAAATTTTGATTTTGCTATTAATTCCGGG
TTTTGTGATATGATTGGCCTTTTCTTATTTATAATATTTACTCTTTTGGA
TTTGTTAAGCTAATGCATTTACCTTTCGAAACATTGCGTATTTGTTTGGA
TAATTCTAAAGAACATAGTACAGTATAG
back to top

protein sequence of SMED30010637-orf-1

>SMED30010637-orf-1 ID=SMED30010637-orf-1|Name=SMED30010637-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=643bp
MVRKYYFRCKSEKLQKDVKEKNESEKENFGKGKKVKSEKLKLKKNTSEEC
ESTEGDLNNFPLSVELKKNLEARGVKVLFPIQIKTFSHIFEGKDVIAQAK
TGTGKTFAFALPVITKLENVSGSLKPGRKPKVIVMAPTRELVSQIASDFE
SLTSSKLKTLTIYGGVSYDKQVSALKSGVDIVAGAPGRMRDLIDRGQLDL
SQIEYVILDEVDRMLDMGFSDIVDEILSYIYPKDTNDNKNRPQTLLFSAT
MPDWIHKIVKKYLRTDAVNICLVEKGDSKAASTVEHLAIQCPWRERAGTI
PDIIRVYGGGNNARCIIFCERKKDADELASHSAMKSDCHVLHGDVPQEKR
ELVLKKFREGKYSVLVTTNVAARGLDVPDIDLVIQCHPPKDVEDYIHRSG
RTGRAGRKGVCICFFEPKEKYDLQKVENLAGFTFKRIFPPSAASIIEANL
IDTIQAFKSIPETVADSFQASANQLIEMFGAEKAMALALAKISGKVDEVK
NRSLLSSAEGFTTYLLTTTDEIKFKGYAYSALKKCLPDNIVEQVKLLQFV
KGRKGLVFDMPAEHDEIVKTSWTDGKYNTLVKVVDVPELEETEDRNGGGF
RNGGWGGRRNGGFNNDRKGGGVKRSFNGKSQGGNNPKLVKFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR012562GUCT
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0004386helicase activity
GO:0005524ATP binding
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0004004ATP-dependent RNA helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0010501RNA secondary structure unwinding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 326..406
e-value: 6.9E-30
score: 115.3
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 311..406
e-value: 1.5E-28
score: 99.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 299..446
score: 21.429
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 74..287
e-value: 1.9E-52
score: 190.2
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 86..269
score: 29.17
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 302..507
e-value: 1.2E-50
score: 174.3
NoneNo IPR availableGENE3DG3DSA:3.30.70.2280coord: 508..583
e-value: 1.4E-15
score: 58.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 10..271
e-value: 4.1E-68
score: 231.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 592..642
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 17..42
NoneNo IPR availablePANTHERPTHR24031:SF237NUCLEOLAR RNA HELICASE 2coord: 35..614
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 35..614
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 284..415
e-value: 4.81731E-51
score: 170.766
NoneNo IPR availableCDDcd12937GUCT_RH7_likecoord: 502..580
e-value: 2.27913E-25
score: 98.0227
NoneNo IPR availableCDDcd00268DEADccoord: 66..270
e-value: 7.69831E-85
score: 262.378
IPR012562GUCTPFAMPF08152GUCTcoord: 497..590
e-value: 1.5E-21
score: 76.5
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 79..257
e-value: 3.5E-49
score: 167.0
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 499..580
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 129..425