WD repeat-containing protein 13

Overview
NameWD repeat-containing protein 13
Smed IDSMED30010635
Length (bp)2596
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 13 (SMED30010635) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 13 (SMED30010635) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 13 (SMED30010635) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 13 (SMED30010635) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010635

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30010635SMESG000049468.1 dd_Smed_v4_5274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010635SMESG000049468.1 dd_Smed_v4_5274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010635SMESG000049468.1 dd_Smed_v4_5274_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Match: WDR13 (WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:14352])

HSP 1 Score: 358.992 bits (920), Expect = 2.547e-114
Identity = 209/500 (41.80%), Postives = 290/500 (58.00%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT  A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +     E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLRVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---SAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Match: WDR13 (WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:14352])

HSP 1 Score: 358.992 bits (920), Expect = 2.547e-114
Identity = 209/500 (41.80%), Postives = 290/500 (58.00%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT  A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +     E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLRVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---SAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Match: WDR13 (WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:14352])

HSP 1 Score: 169.474 bits (428), Expect = 1.028e-47
Identity = 85/188 (45.21%), Postives = 120/188 (63.83%), Query Frame = 3
Query:  951 VLTVAFQPMNNNLFVA----------GGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDV 1484
            +L   FQP+NNNL V           G +   + V+N+STGK VK G  KL G + +++F+   G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV
Sbjct:    1 LLCCTFQPVNNNLTVVRLQDTHSPRVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFDAP-GRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDV 186          
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 55.8398 bits (133), Expect = 1.679e-7
Identity = 89/367 (24.25%), Postives = 149/367 (40.60%), Query Frame = 3
Query:  564 PTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKP---CTI---SSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVL----KNKFPIRHT-EKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            PT  +SA+++      V+  YA   +K      + AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS+     C I   +S Q    +  +   P   V  S N   +   A+ D  + L    K K    +T  K    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   17 PTPSSSATQSKP--TPVKPNYA---LKFTLAGHTKAVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNG-KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Match: WDR83 (WD repeat domain 83 [Source:HGNC Symbol;Acc:HGNC:32672])

HSP 1 Score: 50.447 bits (119), Expect = 6.969e-6
Identity = 64/272 (23.53%), Postives = 109/272 (40.07%), Query Frame = 3
Query:  840 NDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRL--TVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISF---RQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSV--IDVAVSCDELVLASCDDKGHVILWKRVN 1634
             ++ LT   D T+ LWN    +L R Y+      G EVL  A    +N+   +GG D  + + ++++G+ V+  R   G + T    EE+            +I S       G I+ + R     S +P  + +L        EARD    V  S + +L     S DG++    ++ +R  +        P+      R G C +  S D  + + D   G+L      +   +GH+     +D  +S  +  + SC + G V  W  V 
Sbjct:   37 GNYCLTCGSDKTLKLWNPLRGTLLRTYSGH----GYEVLDAAGS-FDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEAT-----------VILS-------GSIDSSIRCWDCRSRRPEPVQTLD-------EARDGVSSVKVSDHEIL---AGSVDGRV---RRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGEL------LGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVE 266          
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 55.0694 bits (131), Expect = 1.836e-7
Identity = 79/369 (21.41%), Postives = 155/369 (42.01%), Query Frame = 3
Query:  543 SRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTG---KAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPL--ISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVI--DVAVSCDELVLASCDDKGHVILWKR 1628
            S I    P    + + + +G     E   F+ +K I  H + +V+ I+F++     L  G  D  + +  T      + LA     H+ GI D +WSS + FI +AS D+TV +++V S +  R            V   +F P  ++L  + G D  ++V +  TG   K + +  D     ITS+++    G  +   +  G I+  +++  +G      +  V T    ++ +             C   N  +  LL  ++ S+      K   P+++     +  +C    +S   G  +++GSEDG +L++ +   Q+      + +L+GH   V+  D   + + +     +    + +W+R
Sbjct:  174 STIQVAPPRDPVAPTTSSSGITKKPENGEFSLVKTISGH-TKSVSVIKFSYC-GKYLGTGSADKQIKVWNTVDMTYLQTLA----SHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACLRTMRGHT----NYVFCCSFNPQ-SSLIASAGFDETVRVWDFKTGLCVKCIPAHSDP----ITSISYNHD-GNTMATSSYDGCIR--VWDAASGS---CLKTLVDTDHAPVTFV-------------CFSPNGKY--LLSAQLDSSLKLWDPKKAKPLKYYNGHKNKKYCLFANMSVPLGKHIISGSEDGRILVWSIQTKQI------VQILEGHTTPVLATDSHPTLNIIASGGLEPDNVIRIWRR 500          
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Match: W07E6.2 (pep chromosome:WBcel235:II:480722:484386:-1 gene:WBGene00021074.1 transcript:W07E6.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07E6.2)

HSP 1 Score: 52.373 bits (124), Expect = 1.208e-6
Identity = 76/311 (24.44%), Postives = 124/311 (39.87%), Query Frame = 3
Query:  711 LAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLT-VAFQPMNNN----LFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECL-WIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRA-WINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILW 1622
            LA G  D ++ I   W  + E  L   K  HKS +  +AWS     I +A ++  +C+WN ++         K L   K+ +T +A+QPM+ +    L  + G DG I + +   G  V+     L G   S+T       CL W G  +G+I S       G  +R  ++  +       ++   A WIN  A           N+    R +  +          +   +K+  + +   +    G  +V+GS+D  + M++         K  IN + GH   V  V  S D   +AS      V LW
Sbjct:  120 LASGSGDQTMRI---WDIELELPLHTCK-SHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGE----QIGKTLKRHKQWITSLAWQPMHKDPTCRLLASCGKDGNIFIWDTVQGTVVRC----LSGHTASVT-------CLRWGG--EGLIYS-------GSQDRTVKMWRADDGVMCRNMTGHAHWINTLA----------LNTDYALRTSCFEPSKRCIKPDTVEECQKVAQTRYEAALEIAGGERLVSGSDDFTLFMWNP-----KETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLW 387          
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 51.6026 bits (122), Expect = 2.247e-6
Identity = 30/109 (27.52%), Postives = 56/109 (51.38%), Query Frame = 3
Query:  693 HNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVI 1019
            H     +A G  D    +   W  +    LA ++ +HKS +  + ++   +++LT  RD  V ++++      R Y + +    KEV+++A+ P++  LFV+GG DG I
Sbjct:   63 HPTKGLIATGSRDTQQPVKI-WDPKSGSCLATLQ-EHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHK----KEVISLAWHPIHEGLFVSGGGDGSI 165          
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 51.6026 bits (122), Expect = 2.693e-6
Identity = 30/109 (27.52%), Postives = 56/109 (51.38%), Query Frame = 3
Query:  693 HNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVI 1019
            H     +A G  D    +   W  +    LA +++ HKS +  + ++   +++LT  RD  V ++++      R Y + +    KEV+++A+ P++  LFV+GG DG I
Sbjct:  279 HPTKGLIATGSRDTQQPVKI-WDPKSGSCLATLQE-HKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMKEMRTYRAHK----KEVISLAWHPIHEGLFVSGGGDGSI 381          
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Match: cor-1 (Coronin-like protein cor-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21624])

HSP 1 Score: 51.2174 bits (121), Expect = 2.880e-6
Identity = 26/90 (28.89%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  795 DQHKSGITDLAWSSANDFILTASRDSTVC-LWNVESSSLARIYTSKELNIG---KEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAV 1052
            D HK+   ++AWS  ND ++ +  + T C +W +    L R  +   + +    K V T+A+ P+ NN+ +  G + V+ + N+ TG+A+
Sbjct:   76 DAHKAPCLEVAWSPFNDNVIASCSEDTTCKVWVIPDRGLNRNLSEPAVELTGHQKRVNTIAWHPVANNVLLTAGGENVMFMWNVGTGEAL 165          
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Match: CG3909 (gene:FBgn0027524 transcript:FBtr0082172)

HSP 1 Score: 58.5362 bits (140), Expect = 1.075e-8
Identity = 70/292 (23.97%), Postives = 114/292 (39.04%), Query Frame = 3
Query:  756 WPFQEERVLAVMKD--QHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGK-EVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILW 1622
            W  QE+  L +      H  G+  +A SS    I ++S DST+CLW+  S     +     L+ G  ++ TV F P N  + ++G +DG I + ++ TGKA ++   + G    S+ +    G+ +  G   GII   +F+V  GK+              + +L+  A                                      P+R        CF P         ++T S+DG++ ++DVT   +      +  L GH   V+ VA S D    AS      V +W
Sbjct:   67 WDLQEDNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHL-----LSFGPVDLWTVQFSPCNKYV-ISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPD-GKYIASGAIDGIIT--IFDVAAGKV--------------VQTLEGHA-------------------------------------MPVRSL------CFSP-----NSQLLLTASDDGHMKLYDVTHSDV------VGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIW 281          
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078713)

HSP 1 Score: 53.9138 bits (128), Expect = 5.720e-7
Identity = 52/232 (22.41%), Postives = 100/232 (43.10%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSI--------------------CCTWPFQEERVLAVMKDQ--------------------HKSGITDLAWSSANDFILTASRDSTVCLWNVES-SSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSL 1241
            A+  I F+  + S+   G DDG+L I                    C  W  Q+  +++  KD                     HKS + DL W+   ++++TASRD  + L+++ +     +++   +    KE  +V++ P++  LF +GGSDG I   N+ T K +         ++ ++ +   +G  L  G+    I+ +      G + R K   ++T P ++++L
Sbjct:  231 AIRGISFSPTD-SKFVSGSDDGTLRIWDFMRCQEERVLRGHGADVKCVHWHPQKGMIVSGSKDNQQPIKIWDPKSGIALATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRGHK----KEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKEIGCVETAHDSIVWTLAW-HPLGHILCSGSNDHTIK-FWTRNRPGDLMRDK-YNLNTLPASLAAL 454          
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Match: Wdr33 (gene:FBgn0046222 transcript:FBtr0078714)

HSP 1 Score: 53.9138 bits (128), Expect = 5.720e-7
Identity = 52/232 (22.41%), Postives = 100/232 (43.10%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSI--------------------CCTWPFQEERVLAVMKDQ--------------------HKSGITDLAWSSANDFILTASRDSTVCLWNVES-SSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSL 1241
            A+  I F+  + S+   G DDG+L I                    C  W  Q+  +++  KD                     HKS + DL W+   ++++TASRD  + L+++ +     +++   +    KE  +V++ P++  LF +GGSDG I   N+ T K +         ++ ++ +   +G  L  G+    I+ +      G + R K   ++T P ++++L
Sbjct:  231 AIRGISFSPTD-SKFVSGSDDGTLRIWDFMRCQEERVLRGHGADVKCVHWHPQKGMIVSGSKDNQQPIKIWDPKSGIALATLHAHKSTVMDLKWNDNGNWLVTASRDHLLKLFDIRNLREEVQVFRGHK----KEASSVSWHPIHEGLFCSGGSDGSILFWNVGTDKEIGCVETAHDSIVWTLAW-HPLGHILCSGSNDHTIK-FWTRNRPGDLMRDK-YNLNTLPASLAAL 454          
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Match: Rbbp5 (gene:FBgn0036973 transcript:FBtr0078242)

HSP 1 Score: 53.5286 bits (127), Expect = 6.231e-7
Identity = 49/174 (28.16%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  711 LAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNN-LFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCT 1229
            LA+GC+DG + I   W F   R +A +   H   +  L+W+     +L+AS D+ VC+W+V +  L   Y          VL V F P N+N L V       + V    T + +    D  G +    +F+   G+ ++ GN +G I   + +V T ++  + R+ V T   T
Sbjct:   39 LAVGCNDGRIVI---WDFLT-RGIAKIISAHVHPVCSLSWTRNGHKLLSASTDNNVCIWDVLTGELEHKY-----RFPSPVLKVQFDPRNDNRLLVCPMRYAAVLVEVGGTHRCLPLDSD--GDLNIVASFDRR-GKHIYTGNAKGKI--LVLDVETFEVVASFRIIVGTSSAT 198          
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Match: CG6015 (gene:FBgn0038927 transcript:FBtr0084183)

HSP 1 Score: 53.5286 bits (127), Expect = 7.420e-7
Identity = 41/154 (26.62%), Postives = 72/154 (46.75%), Query Frame = 3
Query:  645 HIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNN--NLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTF 1100
            H +   +  ++ IR+    A  L  G  D  + +   W    ER        H+  I D+AW++     L+AS D  + LW+ E+  +   +T++++        V F P N+  +LFVAG SD  I   +  +G  V+   D+  G ++++TF
Sbjct:  279 HTWSGHNKGISSIRWFPKTAHLLLSGSMDCRVKL---WEVYGERRCIRTFSGHRQAIKDIAWNNRGTNFLSASYDRYIKLWDAETGDVVSRFTTRKM-----PFCVKFHPDNSKQHLFVAGTSDKKIICWDTRSGDIVQE-YDRHLGSVSTITF 423          
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Match: wdr13 (WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-050522-274])

HSP 1 Score: 355.14 bits (910), Expect = 4.487e-113
Identity = 219/499 (43.89%), Postives = 297/499 (59.52%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+ S  S   ++S+RS SRT    +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    DG+LSI    P      + V    H   +TD AWS +ND I++ S+D T+ +WN E     R     E   G E+L   FQPMNNNL V G S   +QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL V+ +  +ISS+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLALRYGPL-SEQSSFRASSVRS-SRT----TLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDGTLSIMTLSP--PPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSKDGTLRIWNTEDGRCIREVVDPE---GSELLCCTFQPMNNNLTVVGNSKQHLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVN-EGSSISSISARSWISREARDPSLLVNACVNKLLLYRVVDNEGTLQLKRSFPIQHGSQPLHSIFCPLMSFRQGACVVTGSEDACVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESLLASSDASGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Match: wdr13 (WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-050522-274])

HSP 1 Score: 67.0106 bits (162), Expect = 3.825e-13
Identity = 33/69 (47.83%), Postives = 47/69 (68.12%), Query Frame = 3
Query:  558 VVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWP 761
            +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    DG+LSI    P
Sbjct:   14 LVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDGTLSIMTLSP 82          
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 53.1434 bits (126), Expect = 7.934e-7
Identity = 80/332 (24.10%), Postives = 134/332 (40.36%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKP---CTI---SSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVL----KNKFPIRHT-EKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ +    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS+     C I   +S Q    +  +   P   V  S N   +   A+ D  + L    K K    +T  K    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPS-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNG-KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQT------KEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Match: ahi1 (Abelson helper integration site 1 [Source:ZFIN;Acc:ZDB-GENE-060803-1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.305e-6
Identity = 38/116 (32.76%), Postives = 54/116 (46.55%), Query Frame = 3
Query:  687 FAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINL 1034
            F+H+  + LA  C D        +     +VL+   + H S + DL WS  +  +LTAS D TV +WNVE     +    K L     V    F P   +L   GG DGV++V N+
Sbjct:  554 FSHDGRA-LAAACADRDAFPIIIYEIPSGKVLSSF-NGHLSVVYDLCWSRDDKGLLTASSDGTVRVWNVER---LQTLAHKTLPHPSFVYCAKFHPQAQSLVATGGYDGVLRVWNV 664          
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Match: ahi1 (Abelson helper integration site 1 [Source:ZFIN;Acc:ZDB-GENE-060803-1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.349e-6
Identity = 38/116 (32.76%), Postives = 54/116 (46.55%), Query Frame = 3
Query:  687 FAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINL 1034
            F+H+  + LA  C D        +     +VL+   + H S + DL WS  +  +LTAS D TV +WNVE     +    K L     V    F P   +L   GG DGV++V N+
Sbjct:  554 FSHDGRA-LAAACADRDAFPIIIYEIPSGKVLSSF-NGHLSVVYDLCWSRDDKGLLTASSDGTVRVWNVER---LQTLAHKTLPHPSFVYCAKFHPQAQSLVATGGYDGVLRVWNV 664          
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 60.077 bits (144), Expect = 5.826e-9
Identity = 79/325 (24.31%), Postives = 132/325 (40.62%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCL--LVNASFNSLLFFRIASTDGQIVLK--NKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS      SS      I   A   CL  L++     + F +  S +G+ +L     +     EK    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVS------SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKF-SPNGKYILACLKTYTCHKNEKY---CIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 315          
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 55.4546 bits (132), Expect = 1.739e-7
Identity = 79/337 (23.44%), Postives = 135/337 (40.06%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCL--LVNASFNSLLFFRIASTDGQIV---LKNKFPIRHTEK----MIHSC-----FCPLISFR--QGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS      SS      I   A   CL  L++     + F + +     I+   L N   +    K      ++C     +C   +F    G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVS------SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 55.4546 bits (132), Expect = 1.739e-7
Identity = 79/337 (23.44%), Postives = 135/337 (40.06%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCL--LVNASFNSLLFFRIASTDGQIV---LKNKFPIRHTEK----MIHSC-----FCPLISFR--QGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS      SS      I   A   CL  L++     + F + +     I+   L N   +    K      ++C     +C   +F    G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVS------SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 55.4546 bits (132), Expect = 1.739e-7
Identity = 79/337 (23.44%), Postives = 135/337 (40.06%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCL--LVNASFNSLLFFRIASTDGQIV---LKNKFPIRHTEK----MIHSC-----FCPLISFR--QGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS      SS      I   A   CL  L++     + F + +     I+   L N   +    K      ++C     +C   +F    G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVS------SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 55.4546 bits (132), Expect = 1.739e-7
Identity = 79/337 (23.44%), Postives = 135/337 (40.06%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCL--LVNASFNSLLFFRIASTDGQIV---LKNKFPIRHTEK----MIHSC-----FCPLISFR--QGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ N    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS      SS      I   A   CL  L++     + F + +     I+   L N   +    K      ++C     +C   +F    G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPN-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVS------SSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 331          
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Match: Wdr13 (WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:1914661])

HSP 1 Score: 362.844 bits (930), Expect = 6.587e-116
Identity = 210/500 (42.00%), Postives = 292/500 (58.40%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT +A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +   G E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSVAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLHVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---GAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGALQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Match: Wdr13 (WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:1914661])

HSP 1 Score: 362.844 bits (930), Expect = 6.587e-116
Identity = 210/500 (42.00%), Postives = 292/500 (58.40%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT +A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +   G E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSVAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLHVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---GAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGALQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Match: Wdr13 (WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:1914661])

HSP 1 Score: 309.301 bits (791), Expect = 8.850e-97
Identity = 161/358 (44.97%), Postives = 229/358 (63.97%), Query Frame = 3
Query:  558 VVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VVPT +A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +   G E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:   44 VVPTSVAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLHVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---GAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGALQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 390          
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Match: Wdr13 (WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:1914661])

HSP 1 Score: 125.176 bits (313), Expect = 5.670e-32
Identity = 88/222 (39.64%), Postives = 116/222 (52.25%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMK 794
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT +A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSVAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVPAPPT-VLHVLR 214          
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 58.151 bits (139), Expect = 1.370e-8
Identity = 76/296 (25.68%), Postives = 125/296 (42.23%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKS-------------GRDKLGGMITSMTFEESIGEC-LWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVL----KNKFPIRHT-EKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+              RD  G +I S +++   G C +W   +   +++ +  V     +  KR  + T PC             +   P   V  S N   +   A+ D  + L    K K    +T  K    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   17 HKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRD--GSLIVSSSYD---GLCRIWDTASGQCLKTLIVFV----TSHEKRSPLRT-PC------------DDDNPPVSFVKFSPNG-KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQT------KEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 278          
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q91V09|WDR13_MOUSE (WD repeat-containing protein 13 OS=Mus musculus OX=10090 GN=Wdr13 PE=1 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 4.607e-115
Identity = 210/500 (42.00%), Postives = 292/500 (58.40%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT +A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +   G E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSVAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLHVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---GAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGALQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q5RF24|WDR13_PONAB (WD repeat-containing protein 13 OS=Pongo abelii OX=9601 GN=WDR13 PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 1.250e-114
Identity = 210/500 (42.00%), Postives = 291/500 (58.20%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT  A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +   G E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLRVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---GAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q6DKP5|WDR13_PANTR (WD repeat-containing protein 13 OS=Pan troglodytes OX=9598 GN=WDR13 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.223e-113
Identity = 209/500 (41.80%), Postives = 290/500 (58.00%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT  A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +     E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+ +G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLRVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---SAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDRGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q9H1Z4|WDR13_HUMAN (WD repeat-containing protein 13 OS=Homo sapiens OX=9606 GN=WDR13 PE=1 SV=2)

HSP 1 Score: 358.607 bits (919), Expect = 1.577e-113
Identity = 209/500 (41.80%), Postives = 289/500 (57.80%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +     P +R +Y  +R Q+L   YGP+   GS  A SNS+   SRT    +L R  D +         G++  +SR S                   VVPT  A ASRA+AG+ S+ E YAF G+ H+FD H   AV R+RFA+++  RLA    DGS+S+C   P     VL V++  H  G++D AWS +ND +++ S D+T+ +W  E     R     +     E+L   FQP+NNNL V G +   + V+N+STGK VK G  KL G + +++F+ + G  LW G+  G + S+LF++ TGK+ +AKRL V  +   ++S+ +R+W++REARDP LL+NA  N LL +R+   +G + LK  FPI  +   + S FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH   V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKAGHPPALRRQYLRLRGQLLGQRYGPLSEPGSARAYSNSIVRSSRT----TLDRMEDFEDDPRALGARGHRRSVSRGSYQLQAQMNRAVYEDRPPGSVVPTSAAEASRAMAGDTSLSENYAFAGMYHVFDQHVDEAVPRVRFANDDRHRLACCSLDGSISLCQLVP-APPTVLRVLRG-HTRGVSDFAWSLSNDILVSTSLDATMRIWASEDGRCIREIPDPD---SAELLCCTFQPVNNNLTVVGNAKHNVHVMNISTGKKVKGGSSKLTGRVLALSFD-APGRLLWAGDDHGSVFSFLFDMATGKLTKAKRLVVH-EGSPVTSISARSWVSREARDPSLLINACLNKLLLYRVVDNEGTLQLKRSFPIEQSSHPVRSIFCPLMSFRQGACVVTGSEDMCVHFFDVE----RAAKAAVNKLQGHSAPVLDVSFNCDESLLASSDASGMVIVWRR 482          
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Match: sp|Q9M2Z2|WDR5A_ARATH (COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.921e-10
Identity = 74/277 (26.71%), Postives = 128/277 (46.21%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKM-IHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            H++GI+D+A+SS   FI++AS D T+ LW+VE+ SL +      +        V F P +N + V+G  D  +++ +++TGK +K         +T++ F    G  +   +  G+ +  +++ GTG     K L     P         +++        +LV    N+L  + I+S         KF   +T  +    C     S   G  +V+GSED  V M+     +LNS K  +  L+GH  +V++VA    E ++AS      V +W +
Sbjct:   70 HENGISDVAFSSDARFIVSASDDKTLKLWDVETGSLIKTL----IGHTNYAFCVNFNPQSN-MIVSGSFDETVRIWDVTTGKCLKV-LPAHSDPVTAVDFNRD-GSLIVSSSYDGLCR--IWDSGTGHC--VKTLIDDENPPV-------SFVRFSPNGKFILVGTLDNTLRLWNISSA--------KFLKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCVHMW-----ELNS-KKLLQKLEGHTETVMNVACHPTENLIASGSLDKTVRIWTQ 314          
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Match: A0A0B7A8T4 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF99749 PE=4 SV=1)

HSP 1 Score: 393.275 bits (1009), Expect = 3.200e-124
Identity = 229/500 (45.80%), Postives = 302/500 (60.40%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYG-PIIS-SGS-EAGSNSLRSKSR-TPSLPSLI----------RQMDLDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSN 1646
            VWQQVLA DA +N YR PN  + Q R LY+RRR+QL RE+ Q    + +D   R +Y  +R Q+L S YG P  S  GS ++ S SLRS  R T SL S+I           +  +  S       G    +    E+VPT  A ASRA+AG  S+ E YAFTG+ HIFD  S AV R++FA+++ SR+A    DG+LSIC   P     V+ ++K  H +G+TD  WS +ND IL+ S D T  LW+V + S  R+       +G E+L   FQP+NNN+FV G S   +Q++N+STGK  K G  K+ G + ++TF+ S G  LW G+ +G + S+  +V TGK+ + +R+TVS     I+SL +RAWI+REARDPCLLVN   NSL  FRI S DG + LK  FPI+    +I S FCPL+SFRQGACV++GSED  V  FDVT       K  +N L GH   VIDV+ +CDE +LASCD  G VI+WKR     N
Sbjct:    4 VWQQVLALDAKFNAYRSPN--NPQFRTLYIRRRSQLLREHAQ----IERDGTSRREYLHLRAQLLNSRYGSPAFSDQGSIKSRSFSLRSIGRNTESLESMIVGGSDNRKYYHRRHMSTSSLKYLYEGPMKHVYDSIELVPTSAAEASRAMAGGKSLSENYAFTGMHHIFDQHSAAVTRVKFANDDKSRVACSSLDGTLSICQVIP-PPATVICMLKG-HSAGVTDFVWSLSNDVILSVSLDGTARLWDVAAGSCMRVIVD---GLGSELLCCVFQPLNNNMFVTGSSRSQVQLMNMSTGKGYKGGSSKVTGRVNALTFDGS-GRILWAGDERGSVYSFTIDVATGKLTKTRRMTVSEGH-PITSLSARAWISREARDPCLLVNCCINSLCLFRIVSDDGALQLKKSFPIKQRSSLIKSTFCPLMSFRQGACVISGSEDMCVYFFDVT----KETKPCVNKLLGHSAPVIDVSFNCDESLLASCDANGMVIIWKREGKQGN 486          
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Match: A0A433U7D4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_002540 PE=4 SV=1)

HSP 1 Score: 389.037 bits (998), Expect = 9.616e-123
Identity = 225/498 (45.18%), Postives = 301/498 (60.44%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYG-PIIS-SGS-EAGSNSLRSKSRTPSLPSLIRQMD---------LDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSN 1646
            VWQQVLA DA +N YR PN  + Q R LY+RRR+QL RE+ +    V +D   R +Y   R Q+L S YG P  S  GS ++ S SLRS++   SL S+    D         +  S       G    +     VVPT  A ASRA+AG  ++ E YAFTG+ HIFD  S AV  ++FA+++ SR+A    DG+LSIC   P     V+ ++K  HK+G+TD  WS +ND IL+ S DST  LW+V + S  R+    E ++G E+L  AFQP+NNN+FV G S   +QV+N+STGK  K G  K+ G + ++TF+ S G  LW G+ +G + S++ +V TGK+ + +R+TVS     ++SL +RAWI+REARDPCLLVN   N L  +RI S DG + LK  FP++     + S FCPL+SFRQGACV++GSED  V  FDVT       K  +N L GH   V DVA +CDE +LASCD  G VI+WKR     N
Sbjct:    3 VWQQVLALDAKFNAYRSPN--NPQFRTLYIRRRSQLLREHAK----VEKDGNSRKEYLHTRAQLLNSRYGSPAFSDQGSIKSRSYSLRSRNTEQSLESMAVGGDSRKYHHRRHMSTSSLKYLYEGPMKHVYDSITVVPTVAAEASRAMAGGKTLSENYAFTGMHHIFDQHSAAVTSVKFANDDKSRVACCSLDGTLSICQVIP-PPATVICMLKG-HKAGVTDFVWSLSNDVILSVSEDSTARLWDVAAGSCLRVI---EDSVGAELLCCAFQPLNNNMFVTGNSRSQVQVMNMSTGKMYKGGSSKVTGRVNALTFDAS-GRILWAGDERGSVFSFMVDVATGKLTKTRRMTVSDGH-PVTSLSARAWISREARDPCLLVNCCINCLSLYRITSDDGALQLKKTFPVKQRSAFVKSTFCPLMSFRQGACVISGSEDMCVYFFDVT----KEAKPCVNKLLGHSAVVTDVAFNCDESLLASCDANGMVIIWKREGKQGN 483          
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Match: C3Y8Z9 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_57357 PE=4 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 7.525e-120
Identity = 219/489 (44.79%), Postives = 301/489 (61.55%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDG--------LSPISGNKSFISRISE-VVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQ+LAQDA YN YR P     Q R  Y+RRR+QL RE     + V+ DP IR +Y  +R QIL   YG   +S SE GS   RS S+  S      ++ LD  +G         S  SG  S  S   + +VPT+ A ASRA+ G+ +++E YAF G+ HIFD  S AV  ++FA+++ +RLA    DG+LS+C   P +   VL V+K  H SG+TD +WS +ND I++ S D TV LW V + +  R+    +   G E+++ AFQP+NNN+ V G   G + V+N STGK VK G  K  G + + TF+ S G+ LWIG+  G + S+ F+VGTGK++RA+RL V  +   I+ + +R+W++REARDP LL+N   N+L  +R++  +G + LK KFPI+     I S FCPL+SFRQGACVV+GSED +V  FDV      S K  +N LQGH   VIDV+ + DE +LAS D +G VI+WKR
Sbjct:    4 VWQQILAQDARYNAYRLPGS--PQFRTQYIRRRSQLLRE----NAKVDHDPIIRKQYLKVRGQILGQRYG---TSLSEQGSQRSRSASKCSS------RLTLDREEGDFRGHRRYHSSGSGKFSLPSPTEDGLVPTRAAEASRAMVGDKTLDENYAFAGMHHIFDQHSEAVMAVKFANDDKARLACCSLDGTLSVCQVIP-EPATVLCVLKG-HTSGVTDFSWSLSNDVIVSCSLDGTVRLWQVPTGTCLRVVGDCD---GAEIMSCAFQPVNNNMIVTGNKKGFVHVLNFSTGKYVKGGSSKASGSVLTTTFD-SGGKTLWIGDENGCVYSFAFDVGTGKLSRAQRLVV-CEGHPITCISARSWMSREARDPSLLINCGANALCLYRVSGVEGSLQLKRKFPIKQRNLRIRSGFCPLMSFRQGACVVSGSEDMSVYFFDVE----RSNKPVVNKLQGHSAPVIDVSFNYDESLLASADSEGMVIVWKR 466          
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Match: A0A5A9NVY2 (WD repeat-containing protein 13 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti016607 PE=4 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 9.893e-119
Identity = 219/499 (43.89%), Postives = 300/499 (60.12%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+ S  S   ++S+RS SRT    +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    DG+LSI    P     ++ VM   H   +TD AWS +ND I++ S+D T+ +WN E     R     E   G E+L   FQPMNNNL V G S  ++QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL V+ +   ISS+ +R+WI+REARDP LL+NA  N +L +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSEDG V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLALRYGPL-SEQSSFRASSVRS-SRT----TLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVHDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMYHIFDQHVDSAVPRLQFANDDKHLLACCSLDGTLSIMTLSP--PPPIVKVMLKGHAGPVTDFAWSLSNDIIVSTSKDGTLRIWNTEDGRCIREVVDPE---GSELLCCTFQPMNNNLTVVGNSKHLLQVVNISTGKKVKGGSSKLTGQVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLIVN-EGSLISSISARSWISREARDPSLLINACVNKVLLYRVVDNEGTLQLKRSFPIQHGSQQLHSIFCPLMSFRQGACVVTGSEDGCVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESLLASSDATGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Match: A0A5C6MUM3 (WD repeat-containing protein 13 OS=Takifugu flavidus OX=433684 GN=D4764_08G0010340 PE=4 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 8.548e-117
Identity = 218/499 (43.69%), Postives = 294/499 (58.92%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+      +  +S R+ S   S  +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    DG+LSI  T      RV   +K  H   +TD AWS +ND I++ S D T+ +WN E     R     E     E+L   FQPMNNNL V G S   +QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL VS +  +I S+ +R+WI+REARDP LLVNA  N LL +R+A  DG + LK  FPI+   +++HS FCPL+SFRQGACVVTGSEDG V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLAQRYGPL------SEQSSFRASSVRSSRTTLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDGTLSIM-TLSSSPPRVKVSLKG-HGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPE---SSELLCCTFQPMNNNLTVVGNSKHHLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVS-EGSSICSISARSWISREARDPSLLVNACVNKLLLYRVADNDGTLQLKRSFPIQQGSQLVHSIFCPLMSFRQGACVVTGSEDGCVYFFDVE----RNTKAIVNKLQGHGGPVLDVSFNCDESLLASADSTGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:103038963])

HSP 1 Score: 350.517 bits (898), Expect = 1.999e-111
Identity = 218/499 (43.69%), Postives = 295/499 (59.12%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+ S  S   ++S+RS SRT    +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V    H   +TD AWS +ND I++ S+D T+ +WN E     R     E     E+L   FQPMNNNL V G S  ++QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL VS    +ISS+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLALRYGPL-SEQSSFRASSVRS-SRT----TLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYEERPPGALVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDCTLSIMTLSP--SPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSQDGTLRIWNTEDGRCIREVVDPE---ASELLCCTFQPMNNNLTVVGNSKHLLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVSEG-SSISSISARSWISREARDPSLLVNACVNKLLLYRVVDNEGTLQLKRSFPIQHGSQPLHSIFCPLMSFRQGACVVTGSEDACVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESMLASSDATGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:103038963])

HSP 1 Score: 350.517 bits (898), Expect = 1.999e-111
Identity = 218/499 (43.69%), Postives = 295/499 (59.12%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+ S  S   ++S+RS SRT    +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V    H   +TD AWS +ND I++ S+D T+ +WN E     R     E     E+L   FQPMNNNL V G S  ++QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL VS    +ISS+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLALRYGPL-SEQSSFRASSVRS-SRT----TLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYEERPPGALVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDCTLSIMTLSP--SPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSQDGTLRIWNTEDGRCIREVVDPE---ASELLCCTFQPMNNNLTVVGNSKHLLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVSEG-SSISSISARSWISREARDPSLLVNACVNKLLLYRVVDNEGTLQLKRSFPIQHGSQPLHSIFCPLMSFRQGACVVTGSEDACVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESMLASSDATGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:103038963])

HSP 1 Score: 350.903 bits (899), Expect = 3.599e-111
Identity = 218/499 (43.69%), Postives = 295/499 (59.12%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R +Y  +R Q+L   YGP+ S  S   ++S+RS SRT    +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V    H   +TD AWS +ND I++ S+D T+ +WN E     R     E     E+L   FQPMNNNL V G S  ++QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL VS    +ISS+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:   26 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRQYLRLRSQLLALRYGPL-SEQSSFRASSVRS-SRT----TLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYEERPPGALVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDCTLSIMTLSP--SPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSQDGTLRIWNTEDGRCIREVVDPE---ASELLCCTFQPMNNNLTVVGNSKHLLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVSEG-SSISSISARSWISREARDPSLLVNACVNKLLLYRVVDNEGTLQLKRSFPIQHGSQPLHSIFCPLMSFRQGACVVTGSEDACVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESMLASSDATGMVIIWRR 501          
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:103038963])

HSP 1 Score: 301.982 bits (772), Expect = 4.972e-94
Identity = 170/358 (47.49%), Postives = 230/358 (64.25%), Query Frame = 3
Query:  558 VVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V    H   +TD AWS +ND I++ S+D T+ +WN E     R     E     E+L   FQPMNNNL V G S  ++QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL VS    +ISS+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + +HS FCPL+SFRQGACVVTGSED  V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:   53 LVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDCTLSIMTLSP--SPPTVKVTLKGHAGPVTDFAWSLSNDIIVSTSQDGTLRIWNTEDGRCIREVVDPE---ASELLCCTFQPMNNNLTVVGNSKHLLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDRGSIFSFLFDMATGKLTKAKRLVVSEGS-SISSISARSWISREARDPSLLVNACVNKLLLYRVVDNEGTLQLKRSFPIQHGSQPLHSIFCPLMSFRQGACVVTGSEDACVYFFDVE----RNTKAIVNKLQGHSGPVLDVSFNCDESMLASSDATGMVIIWRR 399          
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 56.225 bits (134), Expect = 5.673e-8
Identity = 79/326 (24.23%), Postives = 131/326 (40.18%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVL----KNKFPIRHT-EKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ +    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+                              + ++   V     NR   L VS+ P     L    W   +   P   V  S N   +   A+ D  + L    K K    +T  K    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   47 AVSSVKFSPS-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT------------------------------LPAHSDPVSAVHFNRDGSLIVSSSP----QLLLFNW--DDDNPPVSFVKFSPNG-KYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQT------KEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 319          
BLAST of WD repeat-containing protein 13 vs. Ensembl Sea Lamprey
Match: wdr13 (WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-050522-274])

HSP 1 Score: 362.844 bits (930), Expect = 8.486e-117
Identity = 215/505 (42.57%), Postives = 296/505 (58.61%), Query Frame = 3
Query:  186 NVWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS-EAGSNSLRSKSRTPSLPSLIRQMDLDLSDGL-----SPISGNKSFISRISE-----------------VVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            +VWQQVLA DA YN YR PN  + Q R  Y+RRR+QL RE     +    DP +R +Y  +R Q+L   YGP+    S  A SNS+RS SRT    +L R  D +  DG          G++  +SR S                  VVPT +A ASRA+AG+ S+EE YAF G+ H+FD H   AV +++FA+++ +R A    DG++S+C   P      +      H   +TD AWS +ND +++ S D  + LW+       R     +   G E+L   FQPMNNNL V G S   + V+N+STGK VK G  KL G + +++F+ S G  LW G+ +G I S+LF++ TG++ +AKR+ V+ +   I+S+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+     IHS FCPL+SFRQGACVV+GSED  V  FDV      S K  +N LQGH   V+DV+ +CDE +LAS D +G +I+WKR
Sbjct:    3 SVWQQVLAVDARYNAYRTPN--NPQFRTQYIRRRSQLLRE----NAKAGHDPSVRKQYLRLRCQMLSQRYGPLSEQSSFRAYSNSIRS-SRT----TLDRMEDFE--DGSYDQRGQGSRGHRRSMSRSSYQYQAQLNRAIEDRSTVGVVPTSVAEASRAMAGDTSLEENYAFAGMFHVFDQHTDAAVPKVQFANDDKTRFAACSLDGTVSVCVLVP---APAMVCALRGHTRAVTDFAWSLSNDLMVSTSLDGALRLWDTADGRCLRQVPDPD---GSELLCCTFQPMNNNLIVVGNSKHNVHVVNISTGKRVKGGTSKLTGRVLALSFD-SPGRILWAGDERGSIFSFLFDMTTGRLTKAKRMVVN-EGSAITSISARSWISREARDPSLLVNACVNMLLLYRVLDNEGALQLKKTFPIQQRTHHIHSIFCPLMSFRQGACVVSGSEDLCVYFFDVE----RSSKPVVNKLQGHCAPVLDVSFNCDESLLASSDAQGMIIIWKR 482          
BLAST of WD repeat-containing protein 13 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010368.1 (pep scaffold:Pmarinus_7.0:GL478893:6524:33683:1 gene:ENSPMAG00000009388.1 transcript:ENSPMAT00000010368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 6.412e-7
Identity = 65/278 (23.38%), Postives = 125/278 (44.96%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQ--PMNNNLFVAGGS-DGVIQVINLSTGKAVKSGR-----DKLGGMITSMTFEESIGECLWIGNTQGII---QSYLFEVGTGKINRAKRLTVSTKPCTISSLQ-SRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFP-IRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC 1595
            H   + DL+WS  +  +L+AS D T  LWNVE     R+  ++++ +     T A Q  P         G+ DGV++  ++      + GR     D   G + ++ F ++ G  ++ G++ G++   ++++ +       R   +T   K   +  +  +  W +   R   LLV+A  ++L    I     ++ +  KF    +  + +HSC  P  +F     +++GSEDG   +++V  G  +    Y  +  G++  V DV     E ++A C
Sbjct:  374 HLGLVYDLSWSHDSSHLLSASSDGTARLWNVE----GRVRAAEKV-LPHPCFTYAGQLHPGATAAVAVTGAYDGVLRAWDVGGAMGTRDGRLLRELDGHRGYVNAVCF-DADGLQMFSGDSTGVVLVWRTFVSQTANSNPVRDWAVTKEIKEPDLKGVPINHLWAHPNGRR--LLVHARDSALRLIDI-----RVQVTRKFTGASNQRERVHSCISPCGTF-----LLSGSEDGVAYVWNVDTG--DQVAMYSEL--GYQAPVRDVHFHPHEHMVAFC 629          
BLAST of WD repeat-containing protein 13 vs. Ensembl Sea Lamprey
Match: rbbp5 (retinoblastoma binding protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-886])

HSP 1 Score: 51.2174 bits (121), Expect = 7.353e-7
Identity = 72/315 (22.86%), Postives = 131/315 (41.59%), Query Frame = 3
Query:  711 LAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNAS------FNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFR-QGACVVTGSEDGNVL-MFDVTAGQLNSPKHYINMLQGHRGS-VIDVAVSCDELVLASCDDKGHVILWKR 1628
            LA+GC+DG + +   W F   R +A +   H   +  L WS     +++AS D+ V LW+V S         +       +L V F P + N  +         ++ LS  K V    D    +    +F+   GE ++ GN +G I   + +  T  +  + R+T  T     ++++S  +  +     C L+N +      ++SL        DG+       PI+  + +++        F   G  +  GS   + L +++ + G L      + +L G RG  ++DVA      ++AS    G V +W +
Sbjct:   50 LAVGCNDGRIVV---WDFLT-RGIAKIISAHIHPVCSLCWSRDGHKLVSASTDNMVSLWDVLSGD-----CEQRFRFPVPILKVQFHPRDPNRVLVCPMKSAPVLLTLSDSKHVCLPVDDDSDLNIVASFDRR-GEYMYTGNAKGKI--LVLKTDTQDLVASFRVTTGTS--NTTAIKSIEFARKGRNSSCFLINTADRIIRVYDSLEIL-TCGKDGE-----PEPIQKLQDLVNRTPWKKCCFSGDGEYICAGSARQHALYIWEKSIGNL------VKILHGTRGELLLDVAWHPVRPIIASI-SSGVVSIWAQ 337          
BLAST of WD repeat-containing protein 13 vs. Ensembl Sea Lamprey
Match: WDR33 (WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:25651])

HSP 1 Score: 48.1358 bits (113), Expect = 9.466e-6
Identity = 28/101 (27.72%), Postives = 52/101 (51.49%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVES-SSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTF 1100
            HK+ + ++ W+   +++LTASRD    L+++ +     +I+   +    KE   VA+ P++   F +GGSDG +   ++   K V        GMI S+ +
Sbjct:  287 HKNTVMEVKWNQNGNWLLTASRDHLCKLFDIRNLKEEVQIFRGHK----KEATAVAWHPIHEGFFASGGSDGSLLFWHVGVEKEVGGTDVAHEGMIWSLAW 383          
BLAST of WD repeat-containing protein 13 vs. Ensembl Yeast
Match: RSA4 (WD-repeat protein involved in ribosome biogenesis; may interact with ribosomes; required for maturation and efficient intra-nuclear transport or pre-60S ribosomal subunits, localizes to the nucleolus [Source:SGD;Acc:S000000668])

HSP 1 Score: 51.2174 bits (121), Expect = 5.138e-7
Identity = 79/344 (22.97%), Postives = 142/344 (41.28%), Query Frame = 3
Query:  687 FAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVES----SSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTG--KAVKSGRD------KLG--GMITSMTFEESIGECLWIGNTQG----IIQSYLFEVGTGKINRAKRLTVST------KPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKF----PIR----HTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILW 1622
            FA + +SR+  G  D +  I   W    +  +  +K  H + +  ++WS   + I T S D+T+ LW+ +S        R ++    ++  E + +  +P +     +   DG I++ +  +   +   SG        K G  G++ S + + ++   +W  N+QG    I++S+   V    ++    L +        KP T    Q +A  N E      +   + NS      AS D  + L N      PI     H + + H  F P      G  +V+ S D ++ ++D   G+      +I+  +GH  SV  VA S D  +L SC     + +W
Sbjct:  151 FAPHTSSRMVTGAGDNTARI---WDCDTQTPMHTLKG-HYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPIHL-VKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRTVR--VWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEK-----ICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP-----DGRYIVSASFDNSIKLWDGRDGK------FISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVW 471          
BLAST of WD repeat-containing protein 13 vs. Ensembl Nematostella
Match: EDO48319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJS6])

HSP 1 Score: 322.398 bits (825), Expect = 5.118e-101
Identity = 219/504 (43.45%), Postives = 288/504 (57.14%), Query Frame = 3
Query:  186 NVWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGS---EAGSNSLRSKSRTPSLPSLIRQMD-LDLSDGLSP---------ISGNKSFI-------SRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGN--TQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            N+ QQ+LA DA YN YR PN  + Q R LY+RRR+QL RE   N      DP  R +Y  IRKQ+L   Y P  SS     + GSN      +T S  SL   +D  D S G SP          SG+  F+       S    VVPTK A ASR +AGN ++ E YAF G+ HIFD H S  V  I+FA+++  RLA    D +LS+C   P     V+  ++  H + ++D  WS  NDFIL+AS D + C+WN  S +     ++   N    ++   FQP NNN+F+ G   G I V N STGK VK G  K+   + SM F+ S G  LW+G+   +G I S+ F++ TG+++++KR+ VS + C ++SL  R+WI+REARDP LLVN S + L  +R+    G + LK  FPI H    I SCFCPL+SFRQGACVVTGSED  V  FDV      S K  +N L GH   V+DV  + DE +LASCD +G VI+WKR
Sbjct:    2 NISQQILALDARYNAYRAPN--NPQFRTLYIRRRSQLLRE---NAKKEKVDPTCRRQYLYIRKQLLSKRYSPSESSQLSSLKQGSNQSLFGFQT-SFDSL--HIDPTDTSHGHSPNRPSHRRYHSSGSFKFLPPPDKVESPPRGVVPTKKAEASRKMAGNTTLGENYAFAGMYHIFDQHLSAGVTAIKFANDDKYRLACSSSDCTLSVCRLMP-SPPSVICTLRG-HTATVSDFDWSVTNDFILSASLDGSACVWNPTSGA---CLSTVNDNHSCGMVACRFQPSNNNMFMTGNQKGHISVFNTSTGKGVKGGTGKVASGVCSMEFDSS-GMVLWVGDEKAKGSIYSFCFDIATGRLHKSKRIAVS-EGCPVTSLSYRSWISREARDPMLLVNVSADCLQLYRVTDDMGGLKLKLSFPIAHRTHNIRSCFCPLMSFRQGACVVTGSEDMAVYFFDVE----RSEKPCVNKLLGHSAPVLDVCWNYDESLLASCDTEGTVIVWKR 486          
BLAST of WD repeat-containing protein 13 vs. Ensembl Nematostella
Match: EDO40986 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5J4])

HSP 1 Score: 55.8398 bits (133), Expect = 3.694e-8
Identity = 37/137 (27.01%), Postives = 65/137 (47.45%), Query Frame = 3
Query:  693 HNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFE 1103
            H + S L  G  D    I   W  +    LA +   HKS +  + W+   +++LTASRD  + L+++ +    + +   +    +E   +A+ P++ NLF +GGSDG I      + K V +      GM+ S+ + 
Sbjct:  217 HPHKSLLVSGSKDSQQPIKL-WDTRTGNGLATLH-LHKSTVMSIKWNQNGNWLLTASRDHLLKLFDIRAMKELQAFRGHK----REATAIAWHPIHENLFASGGSDGAIMFWMSGSDKDVGNMESAHEGMVWSLAWH 347          
BLAST of WD repeat-containing protein 13 vs. Ensembl Nematostella
Match: EDO43209 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZB4])

HSP 1 Score: 56.225 bits (134), Expect = 4.786e-8
Identity = 91/356 (25.56%), Postives = 138/356 (38.76%), Query Frame = 3
Query:  615 EEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLA-----VMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVA--GGSDGVIQVINLSTGKAVKSGRDK---------LGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVL----KNKFPIRHTEKMIHSCFCPL------ISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDK 1604
             EG  F   KH+    +  VN I +A +    +A G  DG L   C +  +E  ++A      +K  H  GI  L+WS  + FILTAS D +  +WN+E  SL  ++   E+    E   +    M +NL      G+   +   N ST   +  G  K             I S +F+  I    W  N QG   SY    G G  N    + V        SLQ          +       SF+S      A  DG +++    ++   I   +K++H+   P       +   Q   V  GS+ G+V ++ +    L         + G +  VID+A S D   LA   D+
Sbjct:  175 HEGPPFK-FKHLNSEPTNFVNCIGYAPSGDFFIA-GSADGKL---CLYDGKEGNLVAEIVDPALKKAHSGGIYGLSWSDDSKFILTASGDKSCKIWNIEDKSLQTVF---EMGSNLEDQQLGCLWMGDNLLSVSLSGNINYLDRNNPSTPSRIIKGHYKNISAVAASSSHKKIYSASFDGRI--VSWAENGQG---SYF--KGKGHENHIPFMQVVGDELVTCSLQDEMRFTPLDTEEYGDDKISFDSQPKRFGAGKDGLLIVAFEQQHHVVIVRNKKVVHTVKVPYEPTSASVHIGQDE-VAVGSKRGDVYIYKLDQDTLEEK----TQISGEKQEVIDLAYSPDGGWLAVASDR 510          
BLAST of WD repeat-containing protein 13 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 50.447 bits (119), Expect = 1.722e-6
Identity = 36/140 (25.71%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  639 IKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKS 1058
            +K+     + AV+ ++F+HN    LA    D  + I   +  + E+ +      HK GI+D+AWS+ +  +++AS D T+ +W+  +    +            V    F P  +NL V+G  D  +++ ++ TGK +K+
Sbjct:   57 LKYTLTGHNKAVSSVKFSHN-GEWLASSSADKVIKIWGAYDGKFEKTIT----GHKLGISDVAWSTDSRHLVSASDDKTLKIWDFATGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKT 186          
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 364.77 bits (935), Expect = 8.934e-117
Identity = 212/499 (42.48%), Postives = 288/499 (57.72%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R  Y  +R Q+L   YGP+      +  +S R+ S   S  +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V+   H   +TD AWS +ND I++ S D T+ +WN E     R     E     E+L   FQPMNNNL V G     +QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL V T+  +I S+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + + S FCPL+SFRQGACVVTGSEDG V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRHYLKLRSQLLALRYGPL------SEQSSFRASSVRSSRTTLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSP--PPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPE---SSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDKGSIFSFLFDMATGKLTKAKRLVV-TEGTSICSISARSWISREARDPSLLVNAGLNKLLLYRVVDNEGTLQLKRSFPIQHGSQPVRSIFCPLMSFRQGACVVTGSEDGCVYFFDVE----RNTKAIVNKLQGHGGPVLDVSFNCDESLLASSDSTGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 364.77 bits (935), Expect = 8.934e-117
Identity = 212/499 (42.48%), Postives = 288/499 (57.72%), Query Frame = 3
Query:  189 VWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRIS------------------EVVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            VWQQVLA DA YN YR P     Q R  Y+RRR+QL RE     +    +P +R  Y  +R Q+L   YGP+      +  +S R+ S   S  +L R  D +         G++  +SR S                   +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V+   H   +TD AWS +ND I++ S D T+ +WN E     R     E     E+L   FQPMNNNL V G     +QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL V T+  +I S+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + + S FCPL+SFRQGACVVTGSEDG V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:    4 VWQQVLAVDARYNAYRTPTF--PQFRTQYIRRRSQLLRE----NAKCGFEPGLRRHYLKLRSQLLALRYGPL------SEQSSFRASSVRSSRTTLDRMEDFEEDPRAQGARGHRRSVSRGSYQLQAQMNRAVYDERPPGSLVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSP--PPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPE---SSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDKGSIFSFLFDMATGKLTKAKRLVV-TEGTSICSISARSWISREARDPSLLVNAGLNKLLLYRVVDNEGTLQLKRSFPIQHGSQPVRSIFCPLMSFRQGACVVTGSEDGCVYFFDVE----RNTKAIVNKLQGHGGPVLDVSFNCDESLLASSDSTGMVIIWRR 479          
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Match: wdr13 (WD repeat domain 13 [Source:NCBI gene;Acc:101170185])

HSP 1 Score: 317.39 bits (812), Expect = 8.173e-100
Identity = 168/358 (46.93%), Postives = 228/358 (63.69%), Query Frame = 3
Query:  558 VVPTKIASASRALAGNDSVEEGYAFTGIKHIFD-HCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKR 1628
            +VPT +A ASRA+AG+ ++ E YAF G+ HIFD H  +AV R++FA+++   LA    D +LSI    P      + V+   H   +TD AWS +ND I++ S D T+ +WN E     R     E     E+L   FQPMNNNL V G     +QV+N+STGK VK G  KL G + S++F+ + G  LW G+ +G I S+LF++ TGK+ +AKRL V T+  +I S+ +R+WI+REARDP LLVNA  N LL +R+   +G + LK  FPI+H  + + S FCPL+SFRQGACVVTGSEDG V  FDV      + K  +N LQGH G V+DV+ +CDE +LAS D  G VI+W+R
Sbjct:   54 LVPTSVAEASRAMAGDTTLSENYAFAGMHHIFDQHVDSAVPRLQFANDDKHLLACCSLDATLSIMMLSP--PPASVKVILKGHGGPVTDFAWSLSNDIIVSTSLDGTLRIWNTEDGRCIREVRDPE---SSELLCCTFQPMNNNLTVVGNGKNHLQVVNISTGKKVKGGSSKLTGRVLSLSFD-APGRILWAGDDKGSIFSFLFDMATGKLTKAKRLVV-TEGTSICSISARSWISREARDPSLLVNAGLNKLLLYRVVDNEGTLQLKRSFPIQHGSQPVRSIFCPLMSFRQGACVVTGSEDGCVYFFDVE----RNTKAIVNKLQGHGGPVLDVSFNCDESLLASSDSTGMVIIWRR 400          
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 55.0694 bits (131), Expect = 1.361e-7
Identity = 78/334 (23.35%), Postives = 137/334 (41.02%), Query Frame = 3
Query:  669 AVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKS-------------GRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASC--DDKGHVILWK 1625
            AV+ ++F+ +    LA    D  + I   +  + E+ ++     HK GI+D+AWSS ++ +++AS D T+ +W+V S    +            V    F P  +NL V+G  D  +++ ++ TGK +K+              RD  G +I S +++   G C             +++  +G+    K L     P         +++        +L     NS L F     + Q +    +     EK    C     S   G  +V+GSED  V ++++        K  +  LQGH   VI  A    E ++AS   ++   + LWK
Sbjct:   46 AVSSVKFSPS-GEWLASSSADKLIKIWGAYDGKFEKTIS----GHKLGISDVAWSSDSNLLVSASDDKTLKIWDVNSGKCLKTLKGHS----NYVFCCNFNPQ-SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRD--GSLIVSSSYD---GLC------------RIWDTASGQC--LKTLIDDDNP-------PVSFVKFSPNGKYILAATLDNSSLTFVFFYVNSQCL--KTYTGHKNEKY---CIFANFSVTGGKWIVSGSEDNMVYIWNLQT------KEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWK 332          
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Match: dtl (denticleless E3 ubiquitin protein ligase homolog [Source:NCBI gene;Acc:101156296])

HSP 1 Score: 55.8398 bits (133), Expect = 1.714e-7
Identity = 73/332 (21.99%), Postives = 131/332 (39.46%), Query Frame = 3
Query:  768 EERVLAVMKD--QHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKA------------------------VKSGRDKLGGMITSMTFEESIGECLW--------IGNTQGIIQSYLFEVGTGKI-NRAKRLTVSTKP----CTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPI------RHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVA-VSCDELVLASCDDKGHVILWK 1625
            E R   ++K+   H++ + D+AW      ++TA+ D T  LW+V+S  L   +     ++     +VAF      +F  GG DG I V +    K                          K  R  L GM  S+  ++S+   L+         G   G+I+  ++++    + +R + L + T P    CT   L     +   +R   ++ N + +S+  F +           + P+      +++   + S   P   F     + +GS D +  M+     +++ P+H   MLQGH   V  V     D   +ASC D   V +W+
Sbjct:   86 ESRGNPLLKEWLAHENAVFDIAWVPGEPQLVTAAGDQTARLWDVKSGELLGSFRGHLCSLK----SVAFTAEEKAVFCTGGRDGNIMVWDTRCSKKDGFYRPVNQISGAHHKAEANPSSKTKKRRSSLRGMAPSVDTQQSVTVVLFRDQHTLISAGAVDGVIK--MWDLRKNYVAHRHEPLPLQTYPYAGSCTRMRLGYSGLVLDSSRS-NVMCNCTDDSIYMFNVCGV-------KRTPVAVFSGHQNSSFYVKSSISPDDQF-----LASGSSDNHAYMW-----KISDPQHPPMMLQGHSEEVTSVVWCPTDFTKIASCSDDHTVRIWR 393          
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Match: SMESG000049468.1 (SMESG000049468.1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 498/499 (99.80%), Postives = 498/499 (99.80%), Query Frame = 3
Query:  168 MSISRQNVWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSNSPINGV 1664
            MSISRQNVWQQVLAQDALYNNYRFPNK DHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSNSPINGV
Sbjct:    1 MSISRQNVWQQVLAQDALYNNYRFPNKCDHQNRNLYLRRRTQLSREYFQNKSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSLPSLIRQMDLDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVEEGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQEERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSNSPINGV 499          
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 50.447 bits (119), Expect = 6.979e-6
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  801 HKSGITDLAWSS-ANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKL--------GGMITSMTFEESIGECLWIGNTQGIIQSY-LFEVGTGKINRAKRLTVSTKPCTISSLQ 1244
            H + +  + WS   ND  L+ S D T+ LW++E  +    + S      K V ++A+ P ++ +F A  ++G ++V NL       S  D L          ++TS+TF ES GECL +G++ GI+ ++ L  +     N+ + L  + + C  S LQ
Sbjct:  654 HTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQS----AVKSVNSIAWSPKSSVIF-ACVNEGAVEVWNLQL-----STLDPLIVENICPEYTVLTSVTFTES-GECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQ 800          
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.867e-6
Identity = 46/158 (29.11%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  801 HKSGITDLAWSS-ANDFILTASRDSTVCLWNVESSSLARIYTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRDKL--------GGMITSMTFEESIGECLWIGNTQGIIQSY-LFEVGTGKINRAKRLTVSTKPCTISSLQ 1244
            H + +  + WS   ND  L+ S D T+ LW++E  +    + S      K V ++A+ P ++ +F A  ++G ++V NL       S  D L          ++TS+TF ES GECL +G++ GI+ ++ L  +     N+ + L  + + C  S LQ
Sbjct:  655 HTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQS----AVKSVNSIAWSPKSSVIF-ACVNEGAVEVWNLQL-----STLDPLIVENICPEYTVLTSVTFTES-GECLIVGDSDGILHTFALRNMPPYPKNQTEALDKTIQSCIASQLQ 801          
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Match: SMESG000019085.1 (SMESG000019085.1)

HSP 1 Score: 49.6766 bits (117), Expect = 7.880e-6
Identity = 72/312 (23.08%), Postives = 134/312 (42.95%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSK-------ELN---------------------IGKEVLTVAFQPM--------NNNLFVAGGS-DGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFN-SLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILW 1622
            HK  ++ + + S+N+ I+++  D T  +WN+ + S+ R Y          ELN                      G+  LT+ F  +         +NL V G   D ++ ++++ +G+ +KS +       TS         C +I +   I+ + +    T KI   +  +V+      S++ S A I++      +LV  S++ SLL + I S       ++  P++  +       C   S + G+ +++G  D N++++D+T  Q+   K     LQGH   V DV +S D   + SC     + LW
Sbjct:   31 HKDKVSSVHFCSSNNKIISSGFDKTCKIWNISTGSILRTYEGHNSFINYCELNKNESKFLSCGWDSNVMIWDTETGQIPLTMKFGGIVSCSRFSSTDNLIVVGSDLDNLVTIVDIKSGQKIKSIKGLHNSTPTS---------CRFITSDNRILTTSMDR--TCKIYDLRTDSVTITLEDHSNIVSSADISKNEH---ILVTGSWDKSLLVYDINSG----TYRSSGPVKLIDGHEGCVSCCYFS-KDGSLLISGGYDSNIVIWDMTK-QVKDLK-----LQGHIDWVEDVKISNDNNWILSCSKDHTIRLW 317          
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Match: SMESG000019085.1 (SMESG000019085.1)

HSP 1 Score: 49.2914 bits (116), Expect = 8.620e-6
Identity = 72/312 (23.08%), Postives = 134/312 (42.95%), Query Frame = 3
Query:  801 HKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARIYTSK-------ELN---------------------IGKEVLTVAFQPM--------NNNLFVAGGS-DGVIQVINLSTGKAVKSGRDKLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVSTKPCTISSLQSRAWINREARDPCLLVNASFN-SLLFFRIASTDGQIVLKNKFPIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHYINMLQGHRGSVIDVAVSCDELVLASCDDKGHVILW 1622
            HK  ++ + + S+N+ I+++  D T  +WN+ + S+ R Y          ELN                      G+  LT+ F  +         +NL V G   D ++ ++++ +G+ +KS +       TS         C +I +   I+ + +    T KI   +  +V+      S++ S A I++      +LV  S++ SLL + I S       ++  P++  +       C   S + G+ +++G  D N++++D+T  Q+   K     LQGH   V DV +S D   + SC     + LW
Sbjct:   31 HKDKVSSVHFCSSNNKIISSGFDKTCKIWNISTGSILRTYEGHNSFINYCELNKNESKFLSCGWDSNVMIWDTETGQIPLTMKFGGIVSCSRFSSTDNLIVVGSDLDNLVTIVDIKSGQKIKSIKGLHNSTPTS---------CRFITSDNRILTTSMDR--TCKIYDLRTDSVTITLEDHSNIVSSADISKNEH---ILVTGSWDKSLLVYDINSG----TYRSSGPVKLIDGHEGCVSCCYFS-KDGSLLISGGYDSNIVIWDMTK-QVKDLK-----LQGHIDWVEDVKISNDNNWILSCSKDHTIRLW 317          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR132.547e-11441.80WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR132.547e-11441.80WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR131.028e-4745.21WD repeat domain 13 [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR51.679e-724.25WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR836.969e-623.53WD repeat domain 83 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr-5.31.836e-721.41WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
W07E6.21.208e-624.44pep chromosome:WBcel235:II:480722:484386:-1 gene:W... [more]
pfs-22.247e-627.52Polyadenylation Factor Subunit homolog [Source:Un... [more]
pfs-22.693e-627.52Polyadenylation Factor Subunit homolog [Source:Un... [more]
cor-12.880e-628.89Coronin-like protein cor-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG39091.075e-823.97gene:FBgn0027524 transcript:FBtr0082172[more]
Wdr335.720e-722.41gene:FBgn0046222 transcript:FBtr0078713[more]
Wdr335.720e-722.41gene:FBgn0046222 transcript:FBtr0078714[more]
Rbbp56.231e-728.16gene:FBgn0036973 transcript:FBtr0078242[more]
CG60157.420e-726.62gene:FBgn0038927 transcript:FBtr0084183[more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr134.487e-11343.89WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr133.825e-1347.83WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
wdr57.934e-724.10WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
ahi11.305e-632.76Abelson helper integration site 1 [Source:ZFIN;Acc... [more]
ahi11.349e-632.76Abelson helper integration site 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp4r1l5.826e-924.31protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.739e-723.44protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.739e-723.44protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.739e-723.44protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l1.739e-723.44protein phosphatase 4 regulatory subunit 1 like (p... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr136.587e-11642.00WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr136.587e-11642.00WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr138.850e-9744.97WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr135.670e-3239.64WD repeat domain 13 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr51.370e-825.68WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91V09|WDR13_MOUSE4.607e-11542.00WD repeat-containing protein 13 OS=Mus musculus OX... [more]
sp|Q5RF24|WDR13_PONAB1.250e-11442.00WD repeat-containing protein 13 OS=Pongo abelii OX... [more]
sp|Q6DKP5|WDR13_PANTR1.223e-11341.80WD repeat-containing protein 13 OS=Pan troglodytes... [more]
sp|Q9H1Z4|WDR13_HUMAN1.577e-11341.80WD repeat-containing protein 13 OS=Homo sapiens OX... [more]
sp|Q9M2Z2|WDR5A_ARATH1.921e-1026.71COMPASS-like H3K4 histone methylase component WDR5... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7A8T43.200e-12445.80Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A433U7D49.616e-12345.18Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
C3Y8Z97.525e-12044.79Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A5A9NVY29.893e-11943.89WD repeat-containing protein 13 OS=Triplophysa tib... [more]
A0A5C6MUM38.548e-11743.69WD repeat-containing protein 13 OS=Takifugu flavid... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr131.999e-11143.69WD repeat domain 13 [Source:NCBI gene;Acc:10303896... [more]
wdr131.999e-11143.69WD repeat domain 13 [Source:NCBI gene;Acc:10303896... [more]
wdr133.599e-11143.69WD repeat domain 13 [Source:NCBI gene;Acc:10303896... [more]
wdr134.972e-9447.49WD repeat domain 13 [Source:NCBI gene;Acc:10303896... [more]
wdr55.673e-824.23WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wdr138.486e-11742.57WD repeat domain 13 [Source:ZFIN;Acc:ZDB-GENE-0505... [more]
ENSPMAT00000010368.16.412e-723.38pep scaffold:Pmarinus_7.0:GL478893:6524:33683:1 ge... [more]
rbbp57.353e-722.86retinoblastoma binding protein 5 [Source:ZFIN;Acc:... [more]
WDR339.466e-627.72WD repeat domain 33 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RSA45.138e-722.97WD-repeat protein involved in ribosome biogenesis;... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO483195.118e-10143.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409863.694e-827.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432094.786e-825.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332971.722e-625.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr138.934e-11742.48WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
wdr138.934e-11742.48WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
wdr138.173e-10046.93WD repeat domain 13 [Source:NCBI gene;Acc:10117018... [more]
wdr51.361e-723.35WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
dtl1.714e-721.99denticleless E3 ubiquitin protein ligase homolog [... [more]
back to top
BLAST of WD repeat-containing protein 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049468.10.000e+099.80SMESG000049468.1[more]
SMESG000047563.16.979e-629.11SMESG000047563.1[more]
SMESG000047563.17.867e-629.11SMESG000047563.1[more]
SMESG000019085.17.880e-623.08SMESG000019085.1[more]
SMESG000019085.18.620e-623.08SMESG000019085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010635 ID=SMED30010635|Name=WD repeat-containing protein 13|organism=Schmidtea mediterranea sexual|type=transcript|length=2596bp
GTTAATTATCGTTAGCAATTTTCAATTTAGTGTATTTTAACAACCTTTTA
ATGTTTTTATGTTAATCTCATTTCTTTGATAATTTTTATTAAAATTTTAG
TAATAAATTTTAATTAAAATTTCACAAATATTTTAGTCTCATTATAATTC
ACATTGATGACTTACGTATGTCTATATCACGACAGAATGTGTGGCAACAA
GTTTTAGCTCAGGATGCTCTTTACAATAATTATAGATTTCCTAATAAGCG
TGATCATCAAAACAGAAATCTTTATTTGCGTCGCCGTACACAATTATCTA
GAGAATATTTTCAGAATAAATCATTTGTCAACCAAGATCCCCAAATTCGT
TATAAATATTACTTAATTCGAAAACAAATATTGTGTAGTCTATACGGGCC
AATAATTTCCAGTGGGTCAGAAGCCGGATCCAATTCCCTCAGATCAAAAA
GTCGAACCCCAAGTTTACCATCTTTAATCAGACAAATGGATCTTGATTTA
TCTGATGGATTATCTCCGATTTCTGGAAATAAATCTTTTATTAGTCGAAT
TTCAGAAGTCGTGCCGACAAAAATCGCCTCGGCTAGTCGAGCATTAGCTG
GAAATGATTCAGTAGAAGAAGGCTATGCTTTCACTGGAATCAAACACATT
TTTGATCATTGCTCAACTGCAGTTAATCGAATCAGATTTGCACATAATAA
TGCCTCAAGATTAGCAATCGGCTGTGATGACGGCTCGTTATCAATCTGCT
GTACGTGGCCATTTCAAGAAGAGCGCGTATTGGCAGTAATGAAAGACCAA
CACAAAAGTGGAATCACTGATTTAGCGTGGTCAAGCGCCAACGATTTCAT
TCTCACTGCTTCTCGAGATTCAACGGTCTGTTTATGGAACGTCGAATCAT
CATCTCTCGCTCGTATTTACACATCAAAAGAATTAAATATTGGAAAAGAA
GTATTAACGGTGGCATTTCAACCAATGAATAACAATCTATTTGTTGCTGG
CGGATCTGACGGAGTCATTCAAGTGATCAATTTGTCAACTGGAAAAGCGG
TAAAATCCGGTCGAGATAAATTGGGAGGAATGATCACCTCGATGACATTC
GAGGAATCGATTGGAGAATGTTTATGGATCGGCAACACTCAAGGAATCAT
CCAGTCATATCTTTTCGAAGTCGGAACCGGAAAAATCAATCGAGCCAAAC
GCTTGACAGTGTCGACAAAACCGTGCACTATTTCCAGCTTGCAATCGCGC
GCTTGGATCAATCGGGAAGCTCGTGATCCGTGCCTACTTGTTAACGCATC
GTTTAATTCCCTTCTGTTCTTTCGAATTGCCTCAACAGACGGACAAATCG
TTCTCAAAAATAAATTCCCGATTCGTCACACTGAAAAAATGATTCACAGT
TGCTTCTGTCCTTTGATCTCGTTCCGCCAAGGAGCGTGCGTTGTCACTGG
CAGTGAAGATGGGAACGTGTTGATGTTCGACGTAACCGCTGGACAGTTGA
ATTCACCCAAACATTACATCAATATGTTACAGGGTCATAGGGGCTCGGTT
ATCGATGTTGCAGTCAGTTGCGATGAATTGGTACTTGCATCGTGCGATGA
TAAGGGTCATGTAATTCTATGGAAACGCGTCAATGATGATTCCAATTCAC
CGATAAATGGAGTTTAATTTTATTATTTTCAATTGATTTGTAATCGATTT
AAATTGATTCAAATATTCTTACATTTTGCCTTCCGAATATCTCTTGTGTG
TATTTTGTGATTGCTCGTGTGTATTTTGTTGTGTCTATATTGTGTGTGCG
AAGGTTGGAGTTTGTGTGTATTTCGTTAATTGCGCACACTGTATTACACT
GTACAGTACTCGGTAATTTGAAAGCTTTAATTTTCGATTGTCTTACATTC
CTGAGCATAATAATTACTATTTGATAAGGCTGTGTAGAATTTTGTTGTTA
TTTCTTTATCACTTATTTATGTAGATATCGCAATACATATTTAATACGTG
TTTTGTTTCAAATAAATATATATTTTATGCTACTATAATTGTTTTCGATA
ATGAGTAATTAAATTTTATTTCCATTGTTATTCATTTAGATTTGTTTATT
TTGTCATTTTAAAAAAATGGCATTGTTTAAATAAGGCATTTGCTAGTGTG
TTGCAGAGTCAAAGAAAATTCGGCATTTTGAATTAAATATTTTGACTATC
TAATTGTTAGTAAATAATGAATTGAATTTGTTACTGCGAATCTTTATATT
AAAAAACGTAATCACAATTGAAATTGTGAAAGATGAAATTTGTTTGTTTG
CAATAATAACATGAAAATCAGTTCAAAATTTATGTGATTTATCGTTTTGA
ACTCGTTAGTGAGCGAAGAATAAATTGCAGAATTAATTATTACTGTTAAA
CTTTATCAAGCCAGAATAATTTTATAGAACAAACAGGCAGAAAGACGCCA
AAACCTCCTTGATACAGAACAAATTTAACAAATCATTAGATATTTTGTAA
ACTTTAATATGAACGATTGGCTGTTTACTATTATATTTGATAGGCATTTT
GTTGAGGCCTTTAATTAAAATAAATGCAAAGTAATTTTGAAGATCG
back to top

protein sequence of SMED30010635-orf-1

>SMED30010635-orf-1 ID=SMED30010635-orf-1|Name=SMED30010635-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MSISRQNVWQQVLAQDALYNNYRFPNKRDHQNRNLYLRRRTQLSREYFQN
KSFVNQDPQIRYKYYLIRKQILCSLYGPIISSGSEAGSNSLRSKSRTPSL
PSLIRQMDLDLSDGLSPISGNKSFISRISEVVPTKIASASRALAGNDSVE
EGYAFTGIKHIFDHCSTAVNRIRFAHNNASRLAIGCDDGSLSICCTWPFQ
EERVLAVMKDQHKSGITDLAWSSANDFILTASRDSTVCLWNVESSSLARI
YTSKELNIGKEVLTVAFQPMNNNLFVAGGSDGVIQVINLSTGKAVKSGRD
KLGGMITSMTFEESIGECLWIGNTQGIIQSYLFEVGTGKINRAKRLTVST
KPCTISSLQSRAWINREARDPCLLVNASFNSLLFFRIASTDGQIVLKNKF
PIRHTEKMIHSCFCPLISFRQGACVVTGSEDGNVLMFDVTAGQLNSPKHY
INMLQGHRGSVIDVAVSCDELVLASCDDKGHVILWKRVNDDSNSPINGV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:1990841promoter-specific chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005815microtubule organizing center
GO:0005886plasma membrane
Vocabulary: biological process
TermDefinition
GO:1904691negative regulation of type B pancreatic cell proliferation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 201..241
e-value: 6.9E-7
score: 38.9
coord: 252..288
e-value: 0.66
score: 18.2
coord: 447..486
e-value: 3.6E-4
score: 29.9
coord: 401..438
e-value: 170.0
score: 2.9
coord: 155..195
e-value: 4.1
score: 13.1
IPR001680WD40 repeatPFAMPF00400WD40coord: 211..241
e-value: 1.9E-5
score: 25.3
coord: 453..486
e-value: 0.02
score: 15.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 209..250
score: 13.483
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 454..486
score: 8.537
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 157..362
e-value: 5.3E-25
score: 90.6
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 370..498
e-value: 3.6E-12
score: 47.7
NoneNo IPR availablePANTHERPTHR22838WD REPEAT PROTEIN 26-RELATEDcoord: 6..488
NoneNo IPR availablePANTHERPTHR22838:SF4WD REPEAT-CONTAINING PROTEIN 13coord: 6..488
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 228..242
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 425..495
score: 8.94
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 209..297
score: 15.663
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 159..486