Importin N-terminal domain-containing protein

Overview
NameImportin N-terminal domain-containing protein
Smed IDSMED30010633
Length (bp)2614
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Importin N-terminal domain-containing protein (SMED30010633) t-SNE clustered cells

Violin plots show distribution of expression levels for Importin N-terminal domain-containing protein (SMED30010633) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Importin N-terminal domain-containing protein (SMED30010633) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Importin N-terminal domain-containing protein (SMED30010633) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010633

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30010633SMESG000039949.1 Contig6514newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30010633SMESG000039949.1 Contig6514uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30010633SMESG000039949.1 SMESG000039948.1 SmedASXL_009184SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30010633SMESG000039949.1 SMESG000039948.1 dd_Smed_v4_9074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010633SMESG000039949.1 SMESG000039948.1 dd_Smed_v4_9074_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30010633SMESG000039949.1 SMESG000039948.1 dd_Smed_v6_9074_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 133.265 bits (334), Expect = 6.195e-31
Identity = 132/579 (22.80%), Postives = 250/579 (43.18%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVHGVLRS----GTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIV-EDYFKS-QILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENL-SGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPE 1825
            + IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWGV  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +   +    SVT ME++  + R+     +  +L   R  + L ++P +    F    E     ++E K ++        + + Y   +            R      +EF ++V +D +   Q L  +    L   +   ++D++  +        S  R     LL + ++     + +  + ++TG++G GK+  +A ++      +       VF+HF GA       L++L+RL  YL+               LV+ L   +       L KS E+L  G    ++ID  D + D +   I    PK   + + L++S   D  +     +  +Q    + L P+E   + +L+    + L  +GK+L+ +    Q+  LL    S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  +L+     P+
Sbjct:  897 RSIRLFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVE-------NAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQ--KGITCRRYPCEWGGVAAG------RPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARP---RLLQDTVQRLMLPHGR--LSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRL-------LPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQ--SQGAHVLALGPLEASARARLV---REELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRTLPK 1443          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 129.413 bits (324), Expect = 9.905e-30
Identity = 153/700 (21.86%), Postives = 290/700 (41.43%), Query Frame = 2
Query:  191 KDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVHGVLRS----GTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIV-EDYFKS-QILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENL-SGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDN---SHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAG-----------IWESLIK-----EILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIK--IRHRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYD-NAGDTF-------LSDYMYHLVKSNARNRMIDFM 2104
            +  + IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWGV  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +   +    SVT ME++  + R+     +  +L   R  + L ++P +    F    E     ++E K ++        + + Y   +            R      +EF ++V +D +   Q L  +    L   +   ++D++  +        S  R     LL + ++     + +  + ++TG++G GK+  +A ++      +       VF+HF GA       L++L+RL  YL+               LV+ L   +       L KS E+L  G    ++ID  D + D +   I    PK   + + L++S   D  +     +  +Q    + L P+E   + +L+    + L  +GK+L+ +       F+N   S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G           +W +L K     E      N  +P     ++ ++  L+  L    +  P  +  +    ++ + +         +   H  I+  L +  D +A  TF       L D  YHL++S  R  +  F+
Sbjct:  244 QGWRSIRLFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVE-------NAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQ--KGITCRRYPCEWGGVAAG------RPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARP---RLLQDTVQRLMLPHGR--LSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRL-------LPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQ--SQGAHVLALGPLEASARARLV---REELALYGKRLEES------PFNNQRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRTLPKGTKSWEEAVAAGNSGDPYPMGPFACLVQSLRSLLGEGPLERPGARLCLPDGPLRTAAKRCYGKRPGLEDTAHILIAAQLWKTCDADASGTFRSCPPEALGDLPYHLLQSGNRGLLSKFL 905          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 119.398 bits (298), Expect = 1.382e-26
Identity = 132/579 (22.80%), Postives = 250/579 (43.18%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVHGVLRSG----TENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIV-EDYFKS-QILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENL-SGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPE 1825
            + IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWGV  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +   +    SVT ME++  + R+     +  +L   R  + L ++P +    F    E     ++E K ++        + + Y   +            R      +EF ++V +D +   Q L  +    L   +   ++D++  +        S  R     LL + ++     + +  + ++TG++G GK+  +A ++      +       VF+HF GA       L++L+RL  YL+               LV+ L   +       L KS E+L  G    ++ID  D + D +   I    PK   + + L++S   D  +     +  +Q    + L P+E   + +L+    + L  +GK+L+ +    Q+  LL    S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  +L+     P+
Sbjct:  789 RSIRLFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVE-------NAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQ--KGITCRRYPCEWGGVAAG------RPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARP---RLLQDTVQRLMLPHGR--LSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRL-------LPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQ--SQGAHVLALGPLEASARARLV---REELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRTLPK 1335          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Match: TEP1 (telomerase associated protein 1 [Source:HGNC Symbol;Acc:HGNC:11726])

HSP 1 Score: 119.398 bits (298), Expect = 1.396e-26
Identity = 132/579 (22.80%), Postives = 250/579 (43.18%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVHGVLRSG----TENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIV-EDYFKS-QILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENL-SGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPE 1825
            + IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWGV  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +   +    SVT ME++  + R+     +  +L   R  + L ++P +    F    E     ++E K ++        + + Y   +            R      +EF ++V +D +   Q L  +    L   +   ++D++  +        S  R     LL + ++     + +  + ++TG++G GK+  +A ++      +       VF+HF GA       L++L+RL  YL+               LV+ L   +       L KS E+L  G    ++ID  D + D +   I    PK   + + L++S   D  +     +  +Q    + L P+E   + +L+    + L  +GK+L+ +    Q+  LL    S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  +L+     P+
Sbjct:  897 RSIRLFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVE-------NAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQ--KGITCRRYPCEWGGVAAG------RPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARP---RLLQDTVQRLMLPHGR--LSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRL-------LPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQ--SQGAHVLALGPLEASARARLV---REELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRTLPK 1443          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Match: NWD2 (NACHT and WD repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:29229])

HSP 1 Score: 51.2174 bits (121), Expect = 9.568e-6
Identity = 33/97 (34.02%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQ-GLFLVECDLRWGVPVD--------ATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFG 463
            + +R+FIS+  +D   ER  L +NV+PKLR++C E  GL     DL WGV  D         T ++ +  CL        +T+    F+ L+GE++G
Sbjct:   39 RSVRVFISANPEDTGAERQALRENVYPKLREFCRENYGLEFQVIDLYWGVEEDEWDSPELQKTRMKLLENCL--------KTSAGPCFVGLLGEKYG 127          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Celegans
Match: T05C3.2 (pep chromosome:WBcel235:V:5493747:5503010:1 gene:WBGene00020254.1 transcript:T05C3.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T05C3.2)

HSP 1 Score: 50.8322 bits (120), Expect = 4.835e-6
Identity = 41/109 (37.61%), Postives = 65/109 (59.63%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQ-GLFLVECDLRWGVPVDATNLEAVS-YCLDEIEKSREETNNHNF--FLCLIGERFGW--VPSE--ETLMEKLK 502
            K++R+F SSTF D   ER+ L++ ++PKL+++C E  GL     D+RWGV  ++T+    +  CL EI   +  +   NF  FLC   +++G+  +PSE   T +E LK
Sbjct:   99 KLVRVFTSSTFTDTTVERNALMEEIYPKLKEYCRETYGLDFQVVDMRWGVRDESTDDHMTTKLCLSEIANCQRLSVGANFVVFLC---QKYGYRPIPSEILSTELEMLK 204          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Xenopus
Match: hs3st5 (heparan sulfate-glucosamine 3-sulfotransferase 5 [Source:Xenbase;Acc:XB-GENE-5795358])

HSP 1 Score: 134.035 bits (336), Expect = 4.144e-31
Identity = 133/571 (23.29%), Postives = 263/571 (46.06%), Query Frame = 2
Query:  179 SSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLE-AVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIK----DSSVTLMEIVHGVLRSGTEN-----SLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFS-KIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKN-PVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPNLSK--SLENLSGPKLK------IVIDALDEIWDL--DIVSQF-PKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEI 1810
            S + +  + IRIFISSTF+D ++ER++++  V P+LR       L + E DLRWG+  + T  +  +  CL E+ +S+        F+ ++GER+G VP   +L   L  +Y++I+      S+T +E +  +  S TEN     + F +R  ++L ++P   +  F       +  ++  K  +  H  +S +   YS  +       + GK  +  +    F  +++ED +++   D+    E ++A ++  E++  +         S  R+  +    +QI+  +  +  N  + ++ G+   GK+  +A +++      +  V YHF GA+  +H    +L R+   L    N            LS+   L  L+   L+      ++ID  D +     +  S++ P+   + I L++S    +S+   YS    ++ + + + +  L      ++   +L  +GKKL+ +    Q+  LL    + +PL+L  ACEELR    +  L+  I  LP ++  L +  ++ L  +     +   L ++ +SR G+ E  +  IL+ +
Sbjct:  998 SPITQRWRSIRIFISSTFRDMHSERNLIIGQVIPELRSRAACHYLSVEEVDLRWGITEEETRKDRQLHLCLSEVCRSQ-------IFIGILGERYGHVPKTYSL--PLLSEYEWIQRYPPGRSITELEAMQFLQNSDTENPGHCKAFFYLRDADLLRSIPSKWVSDFGAESAEAEMKMSSLKSRLTEH--SSAATYRYSCQWGGE----LQGKPHL--TRLQNFGIRVLEDIWQAIERDYIK--EGTLASNEDEEELAQEGFQERQTSLSCARSKLVLSTCSQIQERTHASPTNGRLFLVCGDRSQGKTIFMADLVKQLRSSASTTVIYHFMGATPGAHEVEKMLTRICKQLSQGLNRECCNFTSYRALLSEFHDLLRLTSHSLRRNNTLTLLIDGADLLCGRAGETTSEWIPEHLPQRINLVLSVTEGSSLG--YS--LARQKDTVSISLTSLQPSDRAELVRHWLAVYGKKLEESAFNNQMRLLLIKKGTKHPLYLTMACEELRATAVFERLSDDIEKLPATLPALIQRRLESLEQEHGVTTVSIALAVICLSRKGLPERDLLRILSSL 1545          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000003639.1 (uncharacterized LOC101730828 [Source:NCBI gene;Acc:101730828])

HSP 1 Score: 55.4546 bits (132), Expect = 4.314e-7
Identity = 69/286 (24.13%), Postives = 136/286 (47.55%), Query Frame = 2
Query:  956 LKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN--VFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENP---NLSKSLE--NLSGPKLKIVIDALDEI-WDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYS--KFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHN---PLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGI 1774
            + R S+++ L + I +A+ +     ++++ GE+GSGKS+IIA I    S+    +  V   F G +  S +   +L  L   +  ++N+ +  S +        S  LE  N   P L + +D +DE+    D +S  P+   +++  I+    +++  SF +  K T Q+  + Q+P   LD  ++ ++   ++    ++L   Q  K + FD       PL+++S+  E  +   YSS +   + L P++  L   ++ RL       V+K V   + +S+ G+
Sbjct:    1 MGRESFLQELQDCITSANKQ-----LVVVHGESGSGKSSIIAKIATLASQWIGRDIRVVTRFIGRTGESRNPRMLLYSLCFQIAEIYNITMDFSEDLKGLINEFSTLLEFANKCRP-LMVAVDGIDELSVHEDSLSWIPRVLPRHVYFIVCASTESACSSFRTLQKLTMQQNVH-QIP--PLDSEEIRNMIEVWMERDNRRLTGRQ--KKVLFDACAACPLPLYVVSSYMESCLWTSYSSESD--SYLQPNLHKLYSAVLGRLEKSHGEQVMKMVASYISLSKNGV 273          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Xenopus
Match: ccnol.13 (Putative ortholog of g2/mitotic-specific cyclin B3, 13 of 14 [Source:Xenbase;Acc:XB-GENE-940407])

HSP 1 Score: 53.1434 bits (126), Expect = 2.272e-6
Identity = 34/92 (36.96%), Postives = 49/92 (53.26%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRW---GVP--VDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFG 463
            I  ++ ST KDF  ER+ L KN+F +L  +C  +G      DLRW   G P  V   N+ E ++  LD IE+S        FF+C++G  +G
Sbjct:   15 ICPYVCSTIKDFQEERNYLSKNIFEQLNDFCYARGTSFKAVDLRWPLEGQPYHVKPFNVAEQLTLSLDYIERSSP------FFICILGHTYG 100          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Match: Tep1 (telomerase associated protein 1 [Source:MGI Symbol;Acc:MGI:109573])

HSP 1 Score: 117.087 bits (292), Expect = 4.501e-26
Identity = 135/587 (23.00%), Postives = 251/587 (42.76%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLME--KLKLKYDFIKDSSVTLMEIVH----GVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLK---RTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENLSGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIM 1858
            IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWG+  + T     +  CL E+E       N   F+ ++G R+G++P    L +       +++    SVT ME++     G     +  +L   R  + L ++P +    F    E     V+E K+++  H     + + YS  +            R      +EF ++V     S I     K  L      +    I +  LI  +   LK     +   LL + ++     + +  + ++TG+AG GK+  +A ++      +  N    VF+HF  A       L++L+RL  +L+               LV+ L   +  +     ++SL+      L ++ID  D++ D +   I    PK   + + L++S     S DS   +   Q      + +  L       +  + L  +GK+L+ +    Q+  LL+   S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  IL+  L  P+     +W +++
Sbjct:  908 IRLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRNRQLEVCLGEVE-------NSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYFRDPDFLSSVPDAWKPDFISESEEAAHRVSELKRYL--HEQKEVTCRSYSCEWGGVAAG------RPYTGGLEEFGQLVLQDVWSMI----QKQHLQPGAQLEQPTSISEDDLIQTSFQQLKTPTSPARPRLLQDTVQQLLLPHGR--LSLVTGQAGQGKTAFLASLVSALKVPDQPNEPPFVFFHFAAARPDQCLALNLLRRLCTHLRQKLGELSALPSTYRGLVWELQQKLLLK----FAQSLQ--PAQTLVLIIDGADKLVDRNGQLISDWIPKSLPRRVHLVLS----VSSDSGLGETLQQSQGAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHDVLPQALTALEVTRSGLTVDQLHAILSTWLILPK--ETKSWEEVL 1461          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Match: Tep1 (telomerase associated protein 1 [Source:MGI Symbol;Acc:MGI:109573])

HSP 1 Score: 88.9669 bits (219), Expect = 6.241e-18
Identity = 73/301 (24.25%), Postives = 129/301 (42.86%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVH----GVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLK---RTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTII 1078
            IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWG+  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +  ++    SVT ME++     G     +  +L   R  + L ++P +    F    E     V+E K+++  H     + + YS  +            R      +EF ++V     S I     K  L      +    I +  LI  +   LK     +   LL + ++     + +  + ++TG+AG GK+  +
Sbjct:  184 IRLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRNRQLEVCLGEVE-------NSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYFRDPDFLSSVPDAWKPDFISESEEAAHRVSELKRYL--HEQKEVTCRSYSCEWGGVAAG------RPYTGGLEEFGQLVLQDVWSMI----QKQHLQPGAQLEQPTSISEDDLIQTSFQQLKTPTSPARPRLLQDTVQQLLLPHGR--LSLVTGQAGQGKTAFL 463          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Match: Nwd1 (NACHT and WD repeat domain containing 1 [Source:MGI Symbol;Acc:MGI:2442268])

HSP 1 Score: 67.3958 bits (163), Expect = 8.241e-11
Identity = 34/98 (34.69%), Postives = 56/98 (57.14%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVP-VDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEK 496
            + IFISST  D   ER+ L    +P+++ +C+  GL     DLRWG+P   AT+      CL+E+E+  ++T+    F+ L+G+++G  P    + EK
Sbjct:   31 VVIFISSTISDMDTEREALQCTAYPEVQSFCQRHGLAFEVVDLRWGIPNTQATDYLTTELCLEELERC-QKTSIGPAFVALLGDQYGPCPVPRRIEEK 127          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Match: Ttc41 (tetratricopeptide repeat domain 41 [Source:MGI Symbol;Acc:MGI:2387653])

HSP 1 Score: 56.9954 bits (136), Expect = 6.530e-8
Identity = 48/181 (26.52%), Postives = 75/181 (41.44%), Query Frame = 2
Query:  161 NNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSY----CLDE--IEKSREETNN-HNFFLCLIGERFG-----WVP--------------SEETLMEKLKLKYDFI---KDSSVTLMEIVHGVLRSGTENSLFMIRSKNIL 616
              RY    + K  K I  +I ST  DF  ERD L K++FP+L   C  +G +    DLRW       +  +  +    CL    ++ S +  N    FF+ L+G+ +G     + P               E+ L    K  Y ++    + S+T  EI+  V R  ++   F  R+ N L
Sbjct:    9 GQRYNGQPILKRQKPILPYICSTL-DFQEERDFLAKSIFPRLNDICSSRGTYFKAVDLRWSAVKAHKSFTSNQFRQYSCLQSQHLKLSLDYVNRCFPFFIGLLGQTYGDFLPDYTPFLLSQVKDFESLSKGEQNLYIAAKNGYPWVLKTPNCSLTEFEIIQAVFRKKSQFQFFYFRTSNSL 188          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Match: Ttc41 (tetratricopeptide repeat domain 41 [Source:MGI Symbol;Acc:MGI:2387653])

HSP 1 Score: 56.9954 bits (136), Expect = 6.530e-8
Identity = 48/181 (26.52%), Postives = 75/181 (41.44%), Query Frame = 2
Query:  161 NNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSY----CLDE--IEKSREETNN-HNFFLCLIGERFG-----WVP--------------SEETLMEKLKLKYDFI---KDSSVTLMEIVHGVLRSGTENSLFMIRSKNIL 616
              RY    + K  K I  +I ST  DF  ERD L K++FP+L   C  +G +    DLRW       +  +  +    CL    ++ S +  N    FF+ L+G+ +G     + P               E+ L    K  Y ++    + S+T  EI+  V R  ++   F  R+ N L
Sbjct:    9 GQRYNGQPILKRQKPILPYICSTL-DFQEERDFLAKSIFPRLNDICSSRGTYFKAVDLRWSAVKAHKSFTSNQFRQYSCLQSQHLKLSLDYVNRCFPFFIGLLGQTYGDFLPDYTPFLLSQVKDFESLSKGEQNLYIAAKNGYPWVLKTPNCSLTEFEIIQAVFRKKSQFQFFYFRTSNSL 188          
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99973|TEP1_HUMAN (Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 6.706e-26
Identity = 132/579 (22.80%), Postives = 250/579 (43.18%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKY--DFIKDSSVTLMEIVHGVLRSG----TENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIV-EDYFKS-QILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENL-SGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPE 1825
            + IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWGV  + T     +  CL E+E       N   F+ ++G R+G++P    L +     +   +    SVT ME++  + R+     +  +L   R  + L ++P +    F    E     ++E K ++        + + Y   +            R      +EF ++V +D +   Q L  +    L   +   ++D++  +        S  R     LL + ++     + +  + ++TG++G GK+  +A ++      +       VF+HF GA       L++L+RL  YL+               LV+ L   +       L KS E+L  G    ++ID  D + D +   I    PK   + + L++S   D  +     +  +Q    + L P+E   + +L+    + L  +GK+L+ +    Q+  LL    S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  +L+     P+
Sbjct:  897 RSIRLFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCLGEVE-------NAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAARRISELKSYLSRQ--KGITCRRYPCEWGGVAAG------RPYVGGLEEFGQLVLQDVWNMIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKPPSPARP---RLLQDTVQRLMLPHGR--LSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLVFFHFSGARPDQGLALTLLRRLCTYLRGQLKEPGALPSTYRSLVWELQQRL-------LPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSSDAGLGETLEQ--SQGAHVLALGPLEASARARLV---REELALYGKRLEESPFNNQMRLLLVKRESGRPLYLRLVTDHLRLFTLYEQVSERLRTLPATVPLLLQHILSTLEKEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRTLPK 1443          
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|P97499|TEP1_MOUSE (Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.149e-25
Identity = 135/587 (23.00%), Postives = 251/587 (42.76%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLME--KLKLKYDFIKDSSVTLMEIVH----GVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLK---RTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRLENYLK---------------LVFNLNVSISNEENPNLSKSLENLSGPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIM 1858
            IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWG+  + T     +  CL E+E       N   F+ ++G R+G++P    L +       +++    SVT ME++     G     +  +L   R  + L ++P +    F    E     V+E K+++  H     + + YS  +            R      +EF ++V     S I     K  L      +    I +  LI  +   LK     +   LL + ++     + +  + ++TG+AG GK+  +A ++      +  N    VF+HF  A       L++L+RL  +L+               LV+ L   +  +     ++SL+      L ++ID  D++ D +   I    PK   + + L++S     S DS   +   Q      + +  L       +  + L  +GK+L+ +    Q+  LL+   S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   +VL   L  L ++R+G+    +  IL+  L  P+     +W +++
Sbjct:  908 IRLFISSTFRDMHGERDLLMRSVLPALQARVFPHRISLHAIDLRWGITEEETRRNRQLEVCLGEVE-------NSQLFVGILGSRYGYIPPSYDLPDHPHFHWTHEYPSGRSVTEMEVMQFLNRGQRSQPSAQALIYFRDPDFLSSVPDAWKPDFISESEEAAHRVSELKRYL--HEQKEVTCRSYSCEWGGVAAG------RPYTGGLEEFGQLVLQDVWSMI----QKQHLQPGAQLEQPTSISEDDLIQTSFQQLKTPTSPARPRLLQDTVQQLLLPHGR--LSLVTGQAGQGKTAFLASLVSALKVPDQPNEPPFVFFHFAAARPDQCLALNLLRRLCTHLRQKLGELSALPSTYRGLVWELQQKLLLK----FAQSLQ--PAQTLVLIIDGADKLVDRNGQLISDWIPKSLPRRVHLVLS----VSSDSGLGETLQQSQGAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHDVLPQALTALEVTRSGLTVDQLHAILSTWLILPK--ETKSWEEVL 1461          
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|O08653|TEP1_RAT (Telomerase protein component 1 OS=Rattus norvegicus OX=10116 GN=Tep1 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.960e-23
Identity = 135/577 (23.40%), Postives = 238/577 (41.25%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNL-EAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYD--FIKDSSVTLMEIVH----GVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLK---RTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN----VFYHFCGASNTSHSQLSILKRL---------------ENYLKLVFNLNVSISNEENPNLSKSLENLS-GPKLKIVIDALDEIWDLD---IVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDST----QLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPE 1825
            IR+FISSTF+D + ERD+L+++V P L+       + L   DLRWG+  + T     +  CL E+E       N   F+ ++G R+G+ P    L +     +   +    SVT ME++     G     ++ +L   R    L ++P      F    E     V+E K+F++       + + YS  +            R      +EF ++V     S I     K  L      +    I +  LI  +   LK     +   LL + ++     + +  ++I  G+AG GK+  +A ++      +  N    VF+HF  A        ++L+RL                 Y  LV+ L   +       L KS + L  G  L ++ID  D++ D +   I    PK   + + L++S     S DS   +   Q      + +  L       +  + L  +GK+L+ +    Q+  LL+   S  PL+L    + LR+   Y  +++ + +LP ++  L + I+  L  +   NVL   L  L ++ +G+    +  +L+  L  P+
Sbjct:  912 IRLFISSTFRDMHGERDLLMRSVLPALQARAFPHRISLHAIDLRWGITEEETRRNRQLEVCLGEVE-------NSQLFVGILGSRYGYTPPSYDLPDHPHFHWTQRYPSGRSVTEMEVMQFLNRGQRSEPSDQALIYFRDPGFLSSVPDVWKPDFISESEEAAHRVSELKRFLQEQ--KEVTCRRYSCEWGGVAAG------RPYTGGLEEFGQLVLQDVWSVI----QKRYLQPGAQLEQPGSISEEDLIQASFQQLKSPPSPARPRLLQDTVQQLMLPHGRLSLVI--GQAGQGKTAFLASLVSALKVPDQPNVAPFVFFHFSAARPDQCLAFNLLRRLCTHLHQKLGEPSALPSTYRGLVWELQQKL-------LLKSAQWLQPGQTLVLIIDGADKLVDHNGQLISDWIPKSLPRRVHLVLS----VSSDSGLGETLQQSQSAYVVALGSLVPSSRAQLVREELALYGKRLEESPFNNQMRLLLAKQGSSLPLYLHLVTDYLRLFTLYEQVSERLRTLPATLPLLLQHILSTLEQEHGHNVLPQALTALEVTHSGLTVDQLHAVLSTWLTLPK 1456          
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54KD0|Y7407_DICDI (TPR repeat-containing protein DDB_G0287407 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0287407 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.994e-22
Identity = 148/645 (22.95%), Postives = 274/645 (42.48%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLE-AVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSE----------ETLMEKLKLKYDFIK---DSSVTLMEIVHGV-LRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKK-FIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKN------------KHELSVAMDDQNEDMIHKSHL-------ISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENEN-VFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISN---------------------------------------EENPNLSK---SLENLSGPKLKIVIDALDEIWDLDIVSQ----FPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSL--PPSIIDLNRMIIKRLS---DQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFL 1879
            I+IFISS FKD   +RD +VK V P++RK C E+ + L   DLRWGV  + +     +S CL E+EK        N  + L GER+GW   E          ++ +++    + ++K   DSS+T +E    +  R    N  F  R    LE + +     F    +  K  + + K+  IK+ F +S           + + D++          +++  K ++  + S   + K             K+   + + ++N  M   ++L        S NKS    +S    L + +KN        PV +I GE+GSGKS++I++ ++ + +   E+ V  H+ GAS +S+   SIL R+ N +K    ++  I+N                                        E P   +   S  +L+G +L ++ID LD++ D    SQ    FP+    N+++I+S +  +       K  +  +    LP  + ++  ++ +   YL  + KKL   Q   +    ++ NP +L    +++ + GDY  L   I +L    +  +L  +I+ R+    D     ++   L+ +   R G+  S++  +L       + I  + W  ++  ++ ++
Sbjct:  369 IKIFISSPFKDMQLDRDQIVKVVIPRIRKLCIERDIVLSYVDLRWGVTSNQSEQSTGLSMCLKELEKC-------NILIGLFGERYGWSSQEKQDPKSQQLLQSTLDRAIQDFPWVKNYRDSSITEIEFRMLLNQRQQQRNGFFYFRDPYYLEEVSQMDKNNFVSEGQRSKEKLEKLKQEIIKSPFKSS------EYRRPTNLSDVL----------YEDLEKYIDKKYPSGNCELKGFEKERFLHSVFIKNLTKIYITNENYFMEIDTYLSGSATSSGSGNKSISIGSSINSGLLSSLKN-------KPVFLIQGESGSGKSSLISNWLKQHKEQHPEDLVVSHWIGASPSSNKFTSILIRIMNEIKNQIEIDQKIANGGSNSSSSSSSSMFSTTSTSSVSWLPEIPDETFESEKIVSEFPQFLQYVMSHPSLNGKRLVLLIDGLDKL-DPRENSQELIWFPRNFPHNVKVIVSSIQGSRQSEVLKKRGSHILSI--LPFTEAERKSMVRL---YLQKYAKKLSDQQEIAIAISKSTTNPRFLQLLLDDILVFGDYERLNDRIKTLLRAKNTSELYEIILDRIEKDYDPKAKGLVSEFLKYIWAGRRGVEMSMLSTLL-----LKKNIDPAEWGSLLVLMEAYI 972          
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P3V7|TTC41_RAT (Tetratricopeptide repeat protein 41 OS=Rattus norvegicus OX=10116 GN=Ttc41 PE=2 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.912e-9
Identity = 48/186 (25.81%), Postives = 75/186 (40.32%), Query Frame = 2
Query:  164 NRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGV-------------PVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFG-----WVP--------------SEETLMEKLKLKYDFI---KDSSVTLMEIVHGVLRSGTENSLFMIRSKNIL 616
             RY    + K  K IR +I ST  DF +ERD L K +FP+L  +C  +G +    DLRW                    + + +  CLD + +         FF+CL+G+ +G     + P               E+ L    K  Y ++    + S+T  EI+    R  ++   F  R+ N L
Sbjct:   10 QRYNSQPILKRQKPIRPYICSTI-DFQDERDFLAKTIFPQLNDFCSSRGTYFKAVDLRWSALKAHKSFTNNQFRQYSCLHSQHLKLCLDYVNRC------FPFFICLLGQTYGDFLPDYTPFLLSKVKDLESLSKGEQNLYVAAKNGYPWVLKTPNCSLTEFEIIQAAFRKKSQFQFFYFRTSNSL 188          
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Match: A0A267FDI5 (DUF4062 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012051g1 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 2.932e-94
Identity = 234/826 (28.33%), Postives = 397/826 (48.06%), Query Frame = 2
Query:  203 VIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYF-EESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQI----------------LDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNP----------------VIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLEN-YLKLVFNLNVSISNEENP--NLSKSLENLSGPKLKIVIDALDEIWDLDIVSQ-FPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKR-LSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEP--------ISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLS-DYMYHLVKSNAR---NRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKLT--DKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNL------VPASINDENKLFPCQFHKNPNPQMGKCSLCNSIVPAKQGEPVKACQMCSLSNPRNCGMIINEKDILYR 2503
             +RIFISSTFKDF+ ER+ LVK VFP LR+WCE++ + L + DLRWGVP D+T+ EAV  CL+ +++ + ET    FFL L+G+RFGWVP    L E+L+L+YD+   SSVT ME+VHG +   + N+LFM+R      ++P +  K F E +  +   +V  QK  +   F  S  V+ YS+ Y  +V +    +ER+ FS F+EF + V  +F+  I                +    K     A D    + +H  ++ ++  ++  +T+ + L+ +       +  K P                 + I G+ G+GKST++A + + +   +  +V  HF   S TS    ++ K+L + +L  V   NV+   ++    N+ + +  ++  +  ++IDA +  ++        P     N++ I++C    +   F  +        + L  +E L+      +   YL  FGK+LD+ QL  LL   ++ NPLWL  ACEELR+ GDY++L+++I + P    +L + I  R L D     ++ T+L L+ +SR G+WE   + +L    N  E         +  + +  +  + K FL   +     +  +HR  + +++E L  + E  I  H  ++ ++     N  D  LS D  +HL   + R   ++++ F +S +   +       S +  S RC   K+T   KQ +L++C  C N      + ++    C +CG +      VPA          CQ H+ P+  M +C  C           +  C MC++S+P  C   + E D  +R
Sbjct:   74 TVRIFISSTFKDFFAERESLVKRVFPSLREWCEKRRIALYDYDLRWGVPKDSTSSEAVRTCLELLDRCQTETGGRVFFLGLVGDRFGWVPGPADLDEELQLQYDWTFGSSVTQMEVVHGAMAKLSPNALFMVRDSACYADIPDAQRKDFVEPAGSVTARHVARQKLELAKRFPPS-QVRLYSVRYAGSVKE--GKRERVQFSGFEEFERQVLTFFQKTIAAEFPLHVASEPPEEPVTSSEKPTSEAASDSGESNEMHICYMFALAGNAQGQTACLNLMRDFASADDPDASKLPPLFGDLEEASETSDLRALAICGDTGAGKSTVLARLGQLFVDKKGFDVMAHFSQFSPTSGDAQALRKKLRDFFLDFVPKENVTAITKDTSVENILELVSKITSRRFIVLIDAYECFFESSHPRDLLPAAWPANVRCILTCHKSEAARCFGDRV-------VHLYNLEPLEPEACRAVCRGYLDAFGKRLDAAQLTSLLGKASATNPLWLTQACEELRVFGDYAALSQMIANFPDDTHELLKTIGARILKDDKPDGLVATLLSLVSVSRVGLWEKHARRLLHFASNGQETKYESENDEVPLAEYLRLRRETKAFLRSIARESTCLTFQHRASRAAVQELLLAEPEAVIRWHSLVANFILSRLRNGFDAVLSRDLPHHLYYCDRRSELHKILSFDQSSRHIAIRIPTITSSYVYNSWRCRQVKVTPESKQASLVVCTFCKNLP--TRVGTLRSAGCAYCGMMIMRGHSVPAGT--------CQMHQAPHASMLRCWFCGRT--DSNAAQLSICSMCNMSSPMWCCQPVLETDRQFR 877          
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Match: A0A267FXV2 (AAA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012051g3 PE=4 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.472e-91
Identity = 233/827 (28.17%), Postives = 395/827 (47.76%), Query Frame = 2
Query:  203 VIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYF-EESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQI----------------LDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNP----------------VIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLEN-YLKLVFNLNVSISNEENP--NLSKSLENLSGPKLKIVIDALDEIWDLDIVSQ-FPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKR-LSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEP--------ISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLS-DYMYHLVKSNAR---NRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKLT--DKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNL------VPASINDENKLFPCQFHKNPNPQMGKCSLCNSIVPAKQGEPVKACQMC-SLSNPRNCGMIINEKDILYR 2503
             +RIFISSTFKDF+ ER+ LVK VFP LR+WCE++ + L + DLRWGVP D+T+ EAV  CL+ +++ + E     FFL L+G+RFGWVP    L E+L+L+YD+   SSVT ME+VHG +   + N+LFM+R      ++P +  K F E +  +   +V  QK  +   F  S  V+ YS+ Y  +V +    +ER+ FS F+EF + V  +F+  I                +    K     A D    +  H  ++ ++  ++  +T+ + L+ +       +  K P                 + I G+ G+GKST++A + + +   +  +V  HF   S TS    ++ K+L + +L  V   NV+   ++    N+ + +  ++  +  ++IDA +  ++        P     N++ I++C    +   F  +        + L  +E L+      +   YL  FGK+LD+ QL  LL   ++ NPLWL  ACEELR+ GDY++L+++I + P    +L + I  R L D     ++ T+L L+ +SR G+WE   + +L    N  E         +  + +  +  + K FL   +     +  +HR  + +++E L  + E  I  H  ++ ++     N  D  LS D  +HL   + R   ++++ F +S +   +       S +  S RC   K+T   KQ +L++C  C N      + ++    C +CG +      VPA          CQ H+ P+  M +C  C           +  C MC ++S+P  C   + E D  +R
Sbjct:   74 TVRIFISSTFKDFFAERESLVKRVFPSLREWCEKRRIALYDYDLRWGVPKDSTSSEAVRTCLELLDRCQTEAGGRVFFLGLVGDRFGWVPGPADLDEELQLQYDWTFGSSVTQMEVVHGAMAKLSPNALFMVRDSACYADIPDAQRKDFVEPAGSVTARHVARQKLELAKRFPPS-QVRLYSVRYAGSVKE--GKRERVQFSGFEEFERQVLTFFQKTIAAEFPLHVASEPPEEPVTSSEKPTSEAASDSGESNETHICYMFALAGNAQGQTACLNLMRDFASADDPDASKLPPLFGDLEEASETSGLRALAICGDTGAGKSTVLARLGQLFVDKKGFDVMAHFSQFSPTSGDAQALRKKLRDFFLDFVPKENVTAITKDTSVENILELVSKITSRRFIVLIDAYECFFESSHPRDLLPAAWPANVRCILTCHKSEAARCFGDRV-------VHLYNLEPLEPEACRAVCRGYLDAFGKRLDAAQLTSLLGKASATNPLWLTQACEELRVFGDYAALSQMIANFPDDTHELLKTIGARILKDDKPDGLVATLLSLVSVSRVGLWEKHARRLLHFASNGQETKDESENDEVPLAEYLRLRRETKAFLRSIARESTCLTFQHRASRAAVQELLLAEPEAVIRWHSLVANFILSRLRNGFDAVLSRDLPHHLYYCDRRSELHKILSFDQSSRHIAIRIPTITSSYVYNSWRCRQVKVTPESKQASLVVCTFCKNLP--TRVGTLRSAGCAYCGMMIMRGHSVPAGT--------CQMHQAPHASMLRCWFCGRT--DSNAAQLSICSMCNNMSSPMWCCQPVLETDRQFR 878          
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Match: A0A267F7M9 (AAA domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012051g2 PE=4 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 3.102e-91
Identity = 232/823 (28.19%), Postives = 393/823 (47.75%), Query Frame = 2
Query:  203 VIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYF-EESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQI----------------LDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNP----------------VIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLEN-YLKLVFNLNVSISNEENP--NLSKSLENLSGPKLKIVIDALDEIWDLDIVSQ-FPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQL-PIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKR-LSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEP--------ISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLS-DYMYHLVKSNAR---NRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKLT--DKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNL------VPASINDENKLFPCQFHKNPNPQMGKCSLCNSIVPAKQGEPVKACQMC-SLSNPRNCGMIINEKD 2491
             +RIFISSTFKDF+ ER+ LVK VFP LR+WCE++ + L + DLRWGVP D+T+ EAV  CL+ +++ + E     FFL L+G+RFGWVP    L E+L+L+YD+   SSVT ME+VHG +   + N+LFM+R      ++P +  K F E +  +   +V  QK  +   F  S  V+ YS+ Y  +V +    +ER+ FS F+EF + V  +F+  I                +    K     A D    +  H  ++ ++  ++  +T+ + L+ +       +  K P                 + I G+ G+GKST++A + + +   +  +V  HF   S TS    ++ K+L + +L  V   NV+   ++    N+ + +  ++  +  ++IDA +  ++        P     N++ I++C    +   F  +        + L  +E L+      +   YL  FGK+LD+ QL  LL   ++ NPLWL  ACEELR+ GDY++L+++I + P    +L + I  R L D     ++ T+L L+ +SR G+WE   + +L    N  E         +  + +  +  + K FL   +     +  +HR  + +++E L  + E  I  H  ++ ++     N  D  LS D  +HL   + R   ++++ F +S +   +       S +  S RC   K+T   KQ +L++C  C N      + ++    C +CG +      VPA          CQ H+ P+  M +C  C           +  C MC ++S+P  C   + E D
Sbjct:   74 TVRIFISSTFKDFFAERESLVKRVFPSLREWCEKRRIALYDYDLRWGVPKDSTSSEAVRTCLELLDRCQTEAGGRAFFLGLVGDRFGWVPGPADLDEELQLQYDWTFGSSVTQMEVVHGAMAKLSPNALFMVRDSACYADIPDAQRKDFVESAGSVTARHVARQKLELAKRFPPS-QVRLYSVRYAGSVKE--GKRERVQFSGFEEFERQVLTFFQKTIAAEFPLHVASEPPEEPVTSSEKPTSEAAGDSGESNETHICYMFALAGNAQGQTACLNLMRDFASADDPDASKLPPLFGDLEEASETSGLRALAICGDTGAGKSTVLARLGQLFVDKKGFDVMAHFSQFSPTSGDAQALRKKLRDFFLDFVPKENVTAITKDTSVENILELVSKITSRRFIVLIDAYECFFESSHPRDLLPAAWPANVRCILTCHKSEAARCFGDRV-------VHLYNLEPLEPDACRAVCRGYLDAFGKRLDAAQLTSLLGKASATNPLWLTQACEELRVFGDYAALSQMIANFPDDTHELLKTIGARILKDDKPDGLVATLLSLVSVSRVGLWEKHARRLLHFASNGQETKDESENDEVPLAEYLRLRRETKAFLRSIARESTCLTFQHRASRAAVQELLLAEPEAVIRWHSLVANFILSRLRNGFDAVLSRDLPHHLYYCDRRSELHKILSFDQSSRHIAIRIPTITSSYVYNSWRCRQVKVTPESKQASLVVCTFCKNLP--TRVGTLRSAGCAYCGMMIMRGHSVPAGT--------CQMHQAPHASMLRCWFCGRT--DSNAAQLSICSMCNNMSSPMWCCQPVLETD 874          
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Match: A0A1S3H5Q5 (telomerase protein component 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152319 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 4.951e-90
Identity = 235/804 (29.23%), Postives = 398/804 (49.50%), Query Frame = 2
Query:  176 DSSVDKDL---KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVV--DLISGKERIVFSDFDEFSKIVEDYFKSQI-LDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELL--------------------------SNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISN--EENPNLSKSLENL-------SGPKLKIVIDALDEI-WDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIR--HRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLSDYMYHLVKSNARNRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKLTDKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNLVPASINDENKLFPCQFHKNPNPQMG-KCSLCNSIVPAKQGEPVKACQMCSLS 2452
            D ++  D+   K  RIF+SSTF+DF++ER+VLVK VFP+LR+WCEE+ + LVECDLRWG+P D+T    ++ CL+E+++   ET    FFL L+GER+GW+PS   + E ++ KY ++ ++S+T ME+++G  R+   N+ F IR K+ L ++P+     + E   L + ++   K+ +   F N       + HY   V   +    + +   +  ++F+  V  ++K+ I   F N+ ++     D+ ED + K ++   ++  + R   +++L                           + I+  SS+ E  P++ I  +AG GK++++A +++  S+ E  NVFYHF G+S  S+    +L RL   L+        I    E    L K  E+L         P L IVID LDE    LD +     F SK     I C+  T  ++  +    + +      +  L +        +YL  + K LDSTQ++ LL+   ++ PLWL  ACEELR+ G++  +T  I   P S+  L + +I RL ++D TN +K  L L+ +S  G+ E  +  +L    +  +PI    W+++  QLK FL   S    + ++   H+   E+++E+L   E+     H  ++ Y E  +    +    +   H  K+ A +++I F ++ +    L    VR   +    C  P   +    + MCI C+++ G LS +   +++CF CG   P  +  +  L  CQ H  P  Q   KC LCN ++   +  PVK C  C ++
Sbjct:   77 DQTLQSDVTGWKTARIFVSSTFRDFHSEREVLVKKVFPELREWCEERKIHLVECDLRWGIPSDSTTAATIATCLEELDRCHSETEGKPFFLNLLGERYGWIPSLSDVPEAVQEKYLWVPNTSITCMEVLYGGYRTKNLNAAFFIREKDFLADLPEQCADAYYEKGVLPREHLKVLKENLNKRFPNQ------TFHYSCEVSLENEHGTRPKAKLTGLEDFATQVLYFYKNAIEKTFPNQRDIKTLPSDEYEDAMQKKYVEQKSEGLIGREEEVQVLLAYAKGGPYPADNTCGDFENPKDEESKSGIEGQSSDTE-TPILCICSQAGCGKTSLMAGLVQKASE-EGLNVFYHFVGSSPYSNDHALLLYRLICKLEPDKESMDKIKGMKENETALVKHFEDLLLKLTNSEQPPLLIVIDGLDEFSHGLDWLPA--SFPSK-----IRCILATRRENLPTIARLKALRPKWWLLPGLTENAKSSYVEQYLKRYSKVLDSTQMKLLLANPLANCPLWLTIACEELRVFGNFKKITTKIQKFPDSLSGLLKQVITRLVEEDETNCMKKFLCLMKVSGTGLPEYALLSLLGNAAHG-QPIPLMVWANVRRQLKPFLRCVSCNSAVERVVFFHKTFCEAVQEQLITSEKDAAYWHLYLADYYEN-FSGQPEMHTIEIAKHYSKAEAEDKLIAFFQNARHNSQLTH--VRRMYLPRYLCRLPVPGETGVKVEMCIFCSSKMG-LSYFGQRKDACFICGQFAP--MYKQGVL--CQKHGFPLKQPNKKCYLCNGVLLEGKTNPVKICNFCPVT 856          
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Match: A0A1S3IKR8 (telomerase protein component 1-like OS=Lingula unguis OX=7574 GN=LOC106164677 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 5.889e-90
Identity = 229/803 (28.52%), Postives = 393/803 (48.94%), Query Frame = 2
Query:  176 DSSVDKDL---KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVV--DLISGKERIVFSDFDEFSKIVEDYFKSQI-LDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELL--------------SNQIKNASSENEKN-----------PVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISN--EENPNLSKSLENL-------SGPKLKIVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIR--HRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLSDYMYHLVKSNARNRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKLTDKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNLVPASINDENKLFPCQFHKNPNPQMG-KCSLCNSIVPAKQGEPVKACQMCSLSN 2455
            D ++  D+   K  RIF+SSTF+DF++ER+VLVK VFP+LR+WCEE+ + LVECDLRWG+P D+T    ++ CL+E+++   ET    FFL L+GER+GW+PS   + E ++ KY ++ ++S+T ME+++G  R+   N+ F IR K+ L ++P+     + E   L + ++   K+ +   F N       + HY   V   +    + +   +  ++F+  V  ++K+ I   F N+ ++     D+ ED + K ++   ++  + R   +++L                  +NA  E  K+           P++ I  +AG GK++++A +++  S+ E  NVFYHF G+S  S+    +L RL   L+        I    E    L+   ENL         P + IVID LDE       S    +   N    I C+  T  ++  +    + +      +  L +        +YL  + K LDSTQ++ LL+   ++ PLWL  ACEELR+ G++  +T  I   P S+  L + +I RL ++D TN +K  L L+ +S  G+ E  +  +L    +  +PI    W+++  QLK FL   S    + ++   H+   E+++E+L   E+     H  ++ Y E  +    +    +   H  K+ A +++I F ++ +    L    VR   +    C  P   +    + +CI C+++ G  S +   +++CF CG   P  +  +  L  CQ H  P  Q   KC LCN ++   +  PVK C  C ++ 
Sbjct:   77 DQTLQSDVTGWKTARIFVSSTFRDFHSEREVLVKKVFPELREWCEERKIHLVECDLRWGIPSDSTTAATIATCLEELDRCHSETEGKPFFLNLLGERYGWIPSLSDVPEAVQEKYLWVPNTSITCMEVLYGGYRTKNPNAAFFIREKDFLADLPEQCADAYYEKGVLPREHLKVLKENLNKRFPNQ------TFHYSCEVSLENEHGTRPKAKLTGLEDFATQVLYFYKNAIEKTFPNQRDIKTLPSDEYEDAMQKKYVEQKSEGLIGREEEVQVLLAYAKGGPYPADNTCGDFENAKDEESKSGIEGQSSDTETPILCICSQAGCGKTSLMAGLVQKASE-EGLNVFYHFVGSSPYSNDHALLLYRLICKLEPDKESMDKIKGMKENETALANYFENLLLKLRDSEQPPMLIVIDGLDEF------SHGLDWLPANFPSKIRCILATRKENLPTIARLKALRPKWWLLPGLTENAKSSYVEQYLKRYSKVLDSTQMKLLLANPLANCPLWLTIACEELRVFGNFKKITTKIQKFPDSLSGLLKQVITRLVEEDETNCMKKFLCLMKVSGTGLPEYALLSLLGNAAHG-QPIPLMVWANVRRQLKPFLRCVSCNSAVERVVFFHKTFCEAVQEQLITSEKDAAYWHLYLADYYEN-FSGQPEMHTIEIAKHYSKAGAEDKLIAFFQNARHNSQLTH--VRRMYLPRYLCRLPVPGETGVKVEICIFCSSKMGQ-SYFGQRKDACFICGQFAP--MYKQGVL--CQKHGFPFKQPNKKCYLCNGVLLEGKTNPVKICNFCPVTT 857          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044252.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:2462631:2463659:1 gene:ENSAMXG00000035043.1 transcript:ENSAMXT00000044252.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.046e-19
Identity = 43/96 (44.79%), Postives = 62/96 (64.58%), Query Frame = 2
Query:  206 IRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLME 493
            +R+FISSTF+D + ERDVLV++VFP+LR+      L+L E +LRWGV  + +N +A+  CL E+ +S          L ++GER+G VP   TL E
Sbjct:   43 VRVFISSTFRDMHAERDVLVRSVFPELRRRAAPHCLYLQEVELRWGVTEEESN-QAIQLCLSEVCRS-------QLLLSILGERYGQVPPRPTLPE 130          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO39396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA50])

HSP 1 Score: 266.544 bits (680), Expect = 2.763e-79
Identity = 176/558 (31.54%), Postives = 304/558 (54.48%), Query Frame = 2
Query:   86 EQTTTGLIKLSLWDQIEFEYSKALMNNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQI-LDFK-NKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKN-----ASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPNLSKSLENLSG---PKLKIVIDALDEIWDLDIVSQ----FPKFTSKNIQLIISCLYDT-SIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQ 1714
            E+  T +++   W++IE      +       ++     KV+R+F+SSTF D++ ER++LVK VFP+LR+WCE + + L+ECDLRWGVP  ++    +  CL EI+K +EET+   FFL ++GER+GW+P E  +  +++  YD++  +S+T MEI+H   R+   N+ FMIR    L+ +P      F ++  L K  +   K+ ++  F   G V DY+  Y  T +D  +GK ++     D+F   V + FK+ I + F   + EL++   +Q E   H S + S     L R + ++ +   I        + E++  P++++ G  GSGKS+++A+      KL++  +FYHF G+   S S L ++ RL  +L+ + +   +I   ++    K++ N +G    K+ I+IDAL+++ D D  S            N+++I+S +  + S+    ++   ++    ++ IE+LD+    ++    L  + KKLD  QL+ L+S + + NPLWL  ACEELR+ G +  +T  I SLP  +  L   I+KR  D+
Sbjct:    3 EEDATQVVR-RCWEKIEEGCQDEMAARPGIHAAGSGGWKVVRLFVSSTFTDYHAERELLVKKVFPELREWCEHRRVQLIECDLRWGVPKYSSTEMTIKTCLGEIDKCKEETDGVPFFLNMLGERYGWMPGESDVPNEIQKGYDWVFPASITHMEILHAAYRNKNPNAAFMIRDPAFLDEIPTDMKGAFIDNSVLSKAQLQMLKEKLRLRF--PGQVFDYNCEY--TGIDKSTGKPKVCLRALDDFGNRVLEVFKAAIEMTFPVVEKELTL---EQTEAAAHDSFVRSRGALLLGRHNEVKQVMEYITREHEPLGNEESDSRPIMLVQGVPGSGKSSLVAYCTLEAKKLDS-LLFYHFVGSGPGSTSPLRVVNRLFAWLRDITHYTGNIYPLKH---LKNVLNEAGKLNKKVVIIIDALNQLADADHGSSHLDWLQTGCPSNVRVIVSAVESSRSVRMLINE--DRKPCPCEVYIEELDETSRKEMVQHLLGIYNKKLDQEQLDMLVSMEGAANPLWLSLACEELRVFGVFERVTDHIKSLPEYLKGLLEFILKRFIDE 546          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO32895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STP2])

HSP 1 Score: 233.417 bits (594), Expect = 3.901e-67
Identity = 178/554 (32.13%), Postives = 277/554 (50.00%), Query Frame = 2
Query:  191 KDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMI------HKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHII----------EHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEEN-PNLSKSLENLSGPKLK---IVIDALDEIWDLDI---VSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWES 1783
            +  K IR+F+SSTF+DF+ ER+VLVK +FP LR WCEE+ L LVECDLRWGVP D++  E V  CL+EI++   + N   +FL L   R GW+P    L   L ++Y ++   S+T MEIVHG  R    N+LFMIR     E++P+     F +  + L   + + K  +K  F  S ++    + Y       I G+         EF  +V  +FK++I       E    +D   ED +      H+S L +  +  L R   ++ + + I    S   + P++++ G AGSGKS I+A             ++ S  +   VFYHF GA+  S      L+RL   L     L + +S+ ++   L+ SL  LS P  K   I++DA++++ D  I       P+  S NI++++S + +T        F T   E +     +LD      I    L  + K+LD  Q+  LL  + S NPLWL  ACEELR+ G ++ + + I+SL   +I L   ++ R   ++   ++   + LL  SR G+ E+
Sbjct:   26 RGWKTIRLFVSSTFRDFHEEREVLVKEIFPDLRLWCEERKLHLVECDLRWGVPKDSSTEETVRICLEEIDRCYRD-NVMPYFLNLTCGRSGWIPDFGDLTYNLAVQYGWVYGLSITEMEIVHGAFRKCNPNALFMIRDSKFCEDLPEEVKDAFIDEKDFLNEKLKKLKDALKEQFPVSTTLLYLFLVY------CIHGRV--------EFQFLVFKFFKNRI-------EYQYPLDPTPEDPLEAQRSAHESFLDTRGQVVLGRDKILKEIDSYISTGQS---RAPLLLV-GNAGSGKSAIMARAACDALDKSSSRQYSSTGDTWKVFYHFVGATPGSTDLAFFLQRLTKELGSAKVLWMQLSDLDSLVQLTNSL--LSNPNTKPAIIIVDAINQLDDDKIQYLTRWLPETLSPNIRVVLSMIDNTECHRLLRAFKTGPREIL---CGELDYSSRKAIVENILKLYNKRLDDQQMSLLLKKEGSANPLWLTLACEELRVFGHFNMMDEKISSLKNDLISLEEQLLTRFELENGGPIVIGTVCLLETSRHGLLET 548          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO32345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVC1])

HSP 1 Score: 129.028 bits (323), Expect = 1.054e-30
Identity = 149/619 (24.07%), Postives = 270/619 (43.62%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVD-ATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKL---KLKYDFI---KDSSVTLMEIVHGVLRS-GTENSLFMIRSKNILENMPKSHLKYFEESDELLKFN--------VNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKE--RIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAH-IIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYL-----KLVFNLNVSI----------SNEENPNLSKSLENL------SGPKLKIVIDALDEIWDLDIVSQ-------FPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPS--IIDLNRMIIKRL------SDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQS 1891
            K  R+F SS F     ER+ L K  +P+L   C + G   +  DLRWG+  + +++   +  CL E+++S       +  +   G+R+GW  + E L +      +KY ++   +D +VT +E +HG LR+ G   + F  R K          ++Y+   D +L  N          +    I+NH    G  K       +  +   + +E  R++F       + ++ YF   +L F  +      +++   D+   S L  +  + +    YI ++   +   S++ +  P++++ G AG GKS ++++ I  H  +   + + YHF G+S+ S     +L RL N L     +   N NV+           S++  P+L + +  L      +G  + +V+DAL+++   D+  Q        PK       L+ S L   + +    +  T+  E I   I  L   +  +I    L   GK L + Q E++     + NPL+L +  +EL   G++  L   I+ L  +     L    +KRL       D D  N+++ VL  +++ R G+ E+ +K IL         IS   WS + + L  FL+ +S
Sbjct:    4 KTARVFFSSPFGGLEEEREELTKKYWPQLESMCSKAGYEFIPVDLRWGITSEMSSSAVTIKVCLSEMDRS-------DMIVGFFGQRYGWHGNNELLQKSFDVAAVKYPWVNEYRDRAVTELEFLHGHLRNPGARPACFFFRDK----------VRYY---DAILGKNACSPNQPQAQKMNTTIENHARLGGKQKKTCTTCLAVHMSYATPQEGARLMF-------ETIKKYFNEVLLAFPAESLKEQDLENVQHDVFLASRL-GMGGAYVGGAKYISMIDRHL---STKGQSRPIVVL-GNAGDGKSCLLSNWITAHQLRHPTDVIVYHFVGSSSESTVPKFLLSRLVNELFEEVQEKQINNNVTFGPLDEGLRAASSDNEPDLIRKIRALTAKLTETGASVFLVVDALNKV---DVTGQTMKALYWLPKDLPHGAHLVASTLASDTAN--IRELETRGCETIS--IAALQHSEREEIALATLKIRGKTLSTQQRERIFQKQQTQNPLYLKTLLQELLSFGEFFQLDAYIDDLLEANDTKGLFTKFLKRLETDYNPEDFD-GNLIEQVLSCILVCRQGLSENELKSILQ--------ISDQNWSALYFALDDFLVFRS 574          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO45428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT98])

HSP 1 Score: 103.219 bits (256), Expect = 1.991e-22
Identity = 131/569 (23.02%), Postives = 246/569 (43.23%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVS-----YCLDEIEKSREETNNHNFFLCLIGERFGW----------VPSEETLMEKLKLK----YDFIKD-----SSVTLMEIVHGVLRSGTENSLFMIR----------------SKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVD-LISGKERIVFSD-----FDEFS--KIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFY-HFCGASNTSHSQLSILKRLENYLKLVF---NLNVSISNEENPNLSKSLENLS-----GPKLKIVIDALDEI--------WDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYL-YNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSL--PPSIIDLNRMIIKR 1702
            +VIR F+  TF+DF+ ERD L  +VFPKL + C+E+G   +  DLRW    D+   ++ S      CLD +E+         +F+CL+G+R+G           V +EE L +  +L     Y+++K+     SS+T +E+V    R   +   F  R                 K IL +  K   +Y  +    LK  V + +  ++ HF     + D  +   ++V++ L S  E  VFS+     F ++S  + V + ++   +      E+S  +       +H      + + +    S++ +LS  + +    +   P++ + GE GSGKS ++++ ++ ++    E V   H  G  ++S    + ++R    L+  +   +LN  I N +  +  +  E        GP + IV+D   E         +    ++  PK   +  +LII+ +     D  Y     ++  Y       LD      +  +Y+  N+   +D     K+LS   S  P++ ++   ELR+ G   +  + ++      S+ +L + II+R
Sbjct:   19 EVIRPFVCGTFRDFHAERDFLNDHVFPKLHRLCQERGTSFLPVDLRW----DSKQGQSASDHILRVCLDNVERCAP------YFICLLGDRYGVHRPSESEPPDVATEEWLTKNYELATSHGYEWLKEDEYRCSSLTELEVVQASFRKKYDYGYFYFRDPEHLKEKIDSADSEEEKEILLSNHKIESEYSAKKLRELKQQVIDTELPVR-HFRTLEELGDLVLADWTSVINTLYSPIEPFVFSNTNTEPFRQWSLHETVSESYRRTFIRTPRTREISDVLS------VHAEVEQGVTRKTSVALSHV-MLSTFMTSVPGGDSLPPILTLLGERGSGKSALVSYWLKQFTTARPEVVLVPHHVGCDSSSADVTNFMRRCTRELRTQYLGSDLNDIIDNNDITDFRRVTEAFHAAIELGPSV-IVLDGASEFGKSHDLPAYQAKELTWLPKEIPEFCRLIITTIKS---DITYRALKQRKDSYFIELNNVLDAKSKRKLLEEYVGANYTNFMDEQHYAKILSSKLSELPMYYVALASELRILGTVKNPERQLDMYVHATSVGELWKQIIRR 565          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Match: EDO47107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNA8])

HSP 1 Score: 90.1225 bits (222), Expect = 1.368e-18
Identity = 134/587 (22.83%), Postives = 245/587 (41.74%), Query Frame = 2
Query:  200 KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVS-YCLDEIEKSREETNNHNFFLCLIGERFGWVP-------SE-ETLMEKLKLKYD-------FIKD----------SSVTLMEIVHGVLRSGTENSLFMIR--SKNILENMPKSHLKYFEESDE-----------LLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISIN-KSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFC---GASNTSHSQLSILKRLENYL-KLVFNLNVSISN-------EENPN-LSKSLENLSGPKLKIVIDALDEIWDLDIVSQ---FPKFTSKNIQLIISCLYDTS---IDSFYSKFTTQEI-EYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQL-EKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWE 1780
            KV+RIF SSTF D   ER+ L++ ++P+++++C++QG      D+RWGV  ++T+    S  C+ E+   +E +   NF +  +G+++G+ P       SE E L   +  K D       F +D            +TL +   G   +  E    + R  +   L N  K  LKY+   D+            LKF    ++  + N      ++ +Y + +    +D  S  E   +   ++  K   D     +LD  N++E +   +   E++   S       K+   R   I  +  ++ N+        V+++ GE+G GK++++A I         E+     C   G S  S S   +++ +   L K    +   I         E  P  L K+ EN    K+ +V+D+LD++   D   Q    P+    N+ +I+S L       + +   ++  Q + E  Q+P+ +        I + +L    + L   Q  E ++SF     PL+L  A +E      Y+ +      L P+I D+ R +  R+       ++   L  +  S+ G+ E
Sbjct:    1 KVVRIFTSSTFTDTSVERNTLMERIYPRIKQFCQQQGYEFQVVDMRWGVRDESTDDHLTSELCMRELRACQELSTGPNF-ITFLGQKYGYRPFPPKIPASEFEKLASAVGSKEDKDLLYHWFRRDDNIVPAEYLLQPITLRKKASGEWWAAFERMQVVFREAADKALTNK-KDRLKYYIFIDKTWGTPPVADTPALKFLSQLREVDLPNVLPKKNTI-EYKVKWNENGIDPKSSPEHAQY--IEKLCKDFYDQLTKMVLDGINENEAADTREAIAEEIFQHSTFCQKKCKTFFGRKEAIASVKEELLNSDDR-----VVVLYGESGCGKTSLMAKIATQVKDWPEEDGVITVCRFIGTSPDSSSIRPLIRSICLQLCKATGQVTADIPEVRMKALVEYFPECLEKASENQ---KVVLVLDSLDQLSVDDSGRQMEWLPRSLPYNVYVIMSTLPGEQYQVLPNLRVRYNPQTLMEVPQIPMSEAGL-----ILDNWLKAANRALQPAQRNEVMISFKECPLPLYLKLAFDESCRWKSYTPMQD--ADLAPNITDIIRALFDRVERIHGKTLVSHSLGYITASKNGLTE 567          
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027048.1 (pep primary_assembly:ASM223467v1:17:3396489:3396977:1 gene:ENSORLG00000023165.1 transcript:ENSORLT00000027048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 1.539e-6
Identity = 26/66 (39.39%), Postives = 37/66 (56.06%), Query Frame = 2
Query:  242 YNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFL 439
            + ERDVLV++VFP+LR+      L L E +LRWGV  + +   A   CL E +   +  N  +F L
Sbjct:    2 HAERDVLVRSVFPELRRRAVPHCLHLQEVELRWGVTEEESE-RAAELCLSENQSINQSINCPSFLL 66          
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000039949.1 (SMESG000039949.1)

HSP 1 Score: 1269.6 bits (3284), Expect = 0.000e+0
Identity = 628/628 (100.00%), Postives = 628/628 (100.00%), Query Frame = 2
Query:   50 MYRKHVSSIDHYEQTTTGLIKLSLWDQIEFEYSKALMNNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPNLSKSLENLSGPKLKIVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMK 1933
            MYRKHVSSIDHYEQTTTGLIKLSLWDQIEFEYSKALMNNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPNLSKSLENLSGPKLKIVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMK
Sbjct:    1 MYRKHVSSIDHYEQTTTGLIKLSLWDQIEFEYSKALMNNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPNLSKSLENLSGPKLKIVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMK 628          
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000039950.1 (SMESG000039950.1)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 363/825 (44.00%), Postives = 543/825 (65.82%), Query Frame = 2
Query:  116 SLWDQIEFEYSKAL---MNNRYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKLKLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYFEESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIVFSDFDEFSKIVEDYF----KSQILDFKNKHELSVAMDDQNEDMIHKSHLISINKSSLKRTSYIELLSNQIKNASSENE--KNPVIIITGEAGSGKSTIIAHIIEHYSKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPN-LSKSLENLSGPKLK------IVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDTSIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLEKLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIKRLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWSDIMWQLKGFLLIQSIPLPLIKIRHRLMKXXXXXXXXXXXXYKIILHHKISIYLERLYDNAGDTFLSDYMYHLVKSNARNRMIDFMRSRKSWKVLKQPFVRSRIMLSTRCINPKL---TDKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNLVPASINDENKLFPCQFHKNPNPQMGKCSLCNSIVPAKQGEPVKACQMC-SLSNPRNCGMIINEKDILYRQQLGFSRAV 2530
            +L + + FEY  A+   ++N+    + +K  K IRIFISSTF+DF+NER++LV  VFP+LR+WC   GL+LVECDLRWG+P D++  E +  C DEIEK ++E N  NFFL LIG+R+GW+PSE  + E ++ +Y +I  SSVTLMEI+HG++R+ T N L M+R  + ++++P +    F E+D     N+N  K+F+KN F    S+  YS  Y   + D    ++R++   FD+F   +E +F    K   L FK   E +  +D+ +E M+        N++ +   ++ +L  + +K   S+N+   N + +++GE GSGKST +AH  +    L N + F+H    ++ S    +I +RL  +L    NLN + S EE  N +   LEN  GPK +      + +D +DE+     +   PK TS  I +IISCL DTS  SFYS+    +   +++ I+ + K QL ++  KYL +FGKKLD+ QL  L+SF NS+NPLWL+SACEELR+HGDY SLTK I SLP +I +L++M+IKRL +QD  N+LKT L+LLVIS++G+WESLIK +LA  L+  +P+SHS W++I+  LKGFLLIQS+ LPLIK RHRLMK +IEEEL+M +++++ LH+++S++ E +  ++GD FL+DY+YHL+KSN+RNR+I F+R+R+SW++ K  F+R +I+ S RC+N  +   + K   LMMC  C   SG+L+ +++N+NSCFFCG  V  +  D  KL+PCQFH++P   + KCSLC +++  ++G  +K CQMC S S   +CG+I+ E+DIL+ QQL FS ++
Sbjct:   10 NLINSLSFEYKNAIEKKISNKIIKYNNNKQ-KTIRIFISSTFRDFHNERNLLVTKVFPRLREWCANHGLYLVECDLRWGIPQDSSREETLMTCFDEIEKGKQECNEMNFFLGLIGDRYGWIPSEAEITENIRKRYKWIDGSSVTLMEILHGMIRTLTPNGLLMVRLPDFIKDLPDNMRSEFLETDPTAVSNLNVFKEFLKNTFEEYNSIYFYSASYDGVIYDKFIDQKRVLVK-FDDFENQIEKHFIKCIKENFLPFK--EEKTDNIDEVHEIMVE----CLTNQNPIPHETFQKLF-DTLKRKLSKNDGSSNSIFMLSGEGGSGKSTTLAHCAKELKILPNCDSFFHSFACTSNSMYNTTICERLYRFLS-ADNLNPNKSFEEKKNKIRHLLEN--GPKRQDKGVFYVFLDGIDEMSSDQKLGWLPKSTSNRIVVIISCLLDTSPSSFYSQLHNCDKSILEISIQSMSKTQLCEMVTKYLDSFGKKLDADQLNCLMSFKNSNNPLWLISACEELRIHGDYFSLTKFILSLPSTICELSKMVIKRLINQDSKNILKTFLQLLVISKSGLWESLIKNMLAIKLDSSQPVSHSLWTEIVCHLKGFLLIQSLSLPLIKFRHRLMKAAIEEELAMSDKFRLKLHYEMSVFFEDIIGSSGDLFLADYIYHLIKSNSRNRLIKFIRTRRSWRIFKTSFIRGKIVSSMRCMNRIVNMPSQKSQELMMCQTCTFVSGELAEHAMNKNSCFFCGAFVFNNNGDVAKLYPCQFHRHPAVTLMKCSLCENLL-GEKGASLKVCQMCKSHSFSGSCGVIVKEEDILFHQQLEFSNSI 821          
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.438e-15
Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  125 DQIEFEYSKALMNN-RYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAV-SYCLDEIEKSREETNNHNFFLCLIGERFGWVP 472
            D I+  ++K L     + D  V    +V RIF+SSTF DF  ER++ +K V P L   C + GL L  CD+RWGV   A N   V S CL EI K  ++T+   FF+ LIG R+G+ P
Sbjct:   29 DIIQLRFNKILSGCINFTDIGVSPPREV-RIFLSSTFSDFKVERNLFIKQVIPSLHSICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEI-KMCQKTSIGPFFVLLIGNRYGYQP 144          
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.459e-15
Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  125 DQIEFEYSKALMNN-RYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAV-SYCLDEIEKSREETNNHNFFLCLIGERFGWVP 472
            D I+  ++K L     + D  V    +V RIF+SSTF DF  ER++ +K V P L   C + GL L  CD+RWGV   A N   V S CL EI K  ++T+   FF+ LIG R+G+ P
Sbjct:   29 DIIQLRFNKILSGCINFTDIGVSPPREV-RIFLSSTFSDFKVERNLFIKQVIPSLHSICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEI-KMCQKTSIGPFFVLLIGNRYGYQP 144          
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Match: SMESG000074035.1 (SMESG000074035.1)

HSP 1 Score: 79.7221 bits (195), Expect = 5.518e-15
Identity = 50/118 (42.37%), Postives = 67/118 (56.78%), Query Frame = 2
Query:  125 DQIEFEYSKALMNN-RYRDSSVDKDLKVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVPVDATNLEAV-SYCLDEIEKSREETNNHNFFLCLIGERFGWVP 472
            D I+  ++K L     + D  V    +V RIF+SSTF DF  ER++ +K V P L   C + GL L  CD+RWGV   A N   V S CL EI K  ++T+   FF+ LIG R+G+ P
Sbjct:   29 DIIQLRFNKILSGCINFTDIGVSPPREV-RIFLSSTFSDFKVERNLFIKQVIPSLHSICNDYGLSLRLCDMRWGVTDYAVNEHLVESLCLKEI-KMCQKTSIGPFFVLLIGNRYGYQP 144          
The following BLAST results are available for this feature:
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEP16.195e-3122.80telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP19.905e-3021.86telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP11.382e-2622.80telomerase associated protein 1 [Source:HGNC Symbo... [more]
TEP11.396e-2622.80telomerase associated protein 1 [Source:HGNC Symbo... [more]
NWD29.568e-634.02NACHT and WD repeat domain containing 2 [Source:HG... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T05C3.24.835e-637.61pep chromosome:WBcel235:V:5493747:5503010:1 gene:W... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hs3st54.144e-3123.29heparan sulfate-glucosamine 3-sulfotransferase 5 [... [more]
ENSXETT00000003639.14.314e-724.13uncharacterized LOC101730828 [Source:NCBI gene;Acc... [more]
ccnol.132.272e-636.96Putative ortholog of g2/mitotic-specific cyclin B3... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tep14.501e-2623.00telomerase associated protein 1 [Source:MGI Symbol... [more]
Tep16.241e-1824.25telomerase associated protein 1 [Source:MGI Symbol... [more]
Nwd18.241e-1134.69NACHT and WD repeat domain containing 1 [Source:MG... [more]
Ttc416.530e-826.52tetratricopeptide repeat domain 41 [Source:MGI Sym... [more]
Ttc416.530e-826.52tetratricopeptide repeat domain 41 [Source:MGI Sym... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99973|TEP1_HUMAN6.706e-2622.80Telomerase protein component 1 OS=Homo sapiens OX=... [more]
sp|P97499|TEP1_MOUSE3.149e-2523.00Telomerase protein component 1 OS=Mus musculus OX=... [more]
sp|O08653|TEP1_RAT4.960e-2323.40Telomerase protein component 1 OS=Rattus norvegicu... [more]
sp|Q54KD0|Y7407_DICDI4.994e-2222.95TPR repeat-containing protein DDB_G0287407 OS=Dict... [more]
sp|Q6P3V7|TTC41_RAT1.912e-925.81Tetratricopeptide repeat protein 41 OS=Rattus norv... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FDI52.932e-9428.33DUF4062 domain-containing protein OS=Macrostomum l... [more]
A0A267FXV21.472e-9128.17AAA domain-containing protein OS=Macrostomum ligna... [more]
A0A267F7M93.102e-9128.19AAA domain-containing protein OS=Macrostomum ligna... [more]
A0A1S3H5Q54.951e-9029.23telomerase protein component 1 isoform X1 OS=Lingu... [more]
A0A1S3IKR85.889e-9028.52telomerase protein component 1-like OS=Lingula ung... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000044252.11.046e-1944.79pep primary_assembly:Astyanax_mexicanus-2.0:1:2462... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO393962.763e-7931.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328953.901e-6732.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323451.054e-3024.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454281.991e-2223.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471071.368e-1822.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000027048.11.539e-639.39pep primary_assembly:ASM223467v1:17:3396489:339697... [more]
back to top
BLAST of Importin N-terminal domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039949.10.000e+0100.00SMESG000039949.1[more]
SMESG000039950.10.000e+044.00SMESG000039950.1[more]
SMESG000074035.15.438e-1542.37SMESG000074035.1[more]
SMESG000074035.15.459e-1542.37SMESG000074035.1[more]
SMESG000074035.15.518e-1542.37SMESG000074035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010633 ID=SMED30010633|Name=Importin N-terminal domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2614bp
CTTGTTGATTACTAATTTTCTATTATTTCTTTCAAAACAAAATTGACAAA
TGTACAGAAAACACGTTAGTTCAATTGACCATTATGAACAGACAACTACA
GGTCTTATCAAATTATCCCTTTGGGACCAAATTGAATTTGAATATTCAAA
GGCTTTGATGAATAATCGCTATCGAGACTCATCTGTTGATAAAGATTTAA
AAGTGATTCGAATTTTTATTTCTTCTACATTCAAAGATTTCTACAATGAA
AGAGATGTATTGGTAAAAAATGTATTTCCAAAATTACGAAAATGGTGTGA
AGAACAAGGATTGTTTCTTGTCGAATGTGACTTAAGATGGGGTGTACCGG
TTGATGCTACAAATTTAGAAGCTGTTTCGTATTGCTTAGATGAAATTGAA
AAATCAAGAGAAGAAACAAATAATCATAACTTTTTTCTTTGTTTAATTGG
AGAAAGATTTGGATGGGTGCCATCAGAAGAAACTCTAATGGAAAAATTGA
AACTCAAATATGATTTTATCAAAGACAGTTCAGTAACACTAATGGAAATT
GTTCATGGTGTGTTGAGAAGTGGAACAGAAAATAGTCTTTTCATGATTCG
ATCTAAAAATATTCTGGAAAATATGCCGAAATCTCATTTAAAATATTTTG
AAGAAAGTGATGAATTATTAAAGTTTAATGTTAACGAACAGAAAAAGTTT
ATTAAAAATCATTTTTCAAACTCTGGTTCGGTAAAAGATTACTCTATTCA
TTATAAGTCAACTGTTGTTGATCTAATATCTGGAAAAGAAAGGATTGTAT
TTTCAGATTTTGATGAATTTTCGAAAATTGTTGAAGATTATTTTAAATCT
CAGATTTTAGATTTTAAAAACAAACATGAACTGTCAGTTGCAATGGACGA
TCAAAATGAGGATATGATTCATAAATCCCATTTAATTTCTATCAATAAAA
GCTCGTTAAAACGAACTTCGTACATAGAACTTTTAAGCAATCAAATAAAA
AACGCATCTTCGGAAAACGAAAAGAATCCAGTTATTATCATAACCGGTGA
GGCCGGTTCCGGCAAATCAACAATAATCGCTCACATTATTGAACATTATT
CAAAACTTGAAAATGAAAATGTGTTTTATCATTTTTGTGGTGCCTCGAAT
ACAAGTCATAGTCAATTGAGTATTCTTAAAAGGTTAGAAAACTATTTGAA
ATTAGTTTTTAATCTTAATGTTTCAATTTCTAACGAAGAAAATCCAAATT
TAAGTAAGTCGTTGGAAAACCTTTCCGGACCAAAACTGAAAATCGTCATC
GATGCACTAGATGAAATATGGGACTTGGATATTGTGAGCCAATTTCCGAA
ATTCACCTCCAAAAACATTCAGCTTATTATTTCATGTTTGTATGACACAA
GTATAGACTCGTTTTACTCAAAATTTACGACTCAGGAAATAGAATATATT
CAGTTGCCCATAGAGAAATTGGATAAGATTCAATTGATAGATATAACAAA
TAAATATTTATACAACTTTGGTAAAAAATTAGATTCTACACAGTTAGAGA
AATTATTGAGTTTTGACAATTCTCACAATCCTTTATGGCTTCTTTCGGCG
TGTGAAGAATTACGAATGCACGGCGACTATTCCAGTCTTACAAAATTAAT
AAACTCACTTCCTCCTTCGATAATAGATTTAAACAGAATGATCATTAAAA
GATTATCTGACCAAGATGTGACAAACGTCCTCAAAACGGTTTTGGAATTA
TTAGTGATTTCAAGAGCAGGAATATGGGAAAGTCTGATAAAGGAAATTCT
AGCTGAGATTTTAAATTTTCCAGAGCCAATAAGCCATTCTACTTGGTCCG
ATATTATGTGGCAACTCAAAGGATTTCTCTTAATCCAGTCCATTCCTTTG
CCGTTAATAAAAATTCGTCATAGGCTAATGAAAGAATCGATCGAAGAGGA
ATTGTCAATGGATGAAGAGTACAAAATAATACTTCACCATAAGATTTCCA
TATATCTAGAAAGACTATATGATAACGCGGGAGACACATTTCTTTCCGAT
TACATGTATCACCTTGTGAAATCAAATGCGCGAAATCGAATGATAGATTT
TATGAGAAGCAGGAAATCTTGGAAAGTTTTAAAACAGCCTTTTGTACGCT
CAAGAATCATGCTGAGTACGCGATGCATCAACCCGAAATTGACAGACAAA
CAAAACGCTTTGATGATGTGCATTCGATGCGCTAACCAATCCGGTGATTT
ATCAATTTATTCAATCAATAGAAACAGTTGTTTCTTTTGTGGAAATCTCG
TTCCAGCTAGCATCAACGATGAGAATAAACTGTTTCCATGCCAATTTCAT
AAAAATCCCAATCCGCAGATGGGGAAATGCAGCCTATGCAACTCGATTGT
ACCGGCGAAACAAGGGGAACCGGTAAAAGCGTGTCAAATGTGCAGTTTAT
CAAACCCGAGAAACTGTGGAATGATAATCAATGAAAAGGACATTTTATAT
CGCCAACAGCTGGGATTCAGCAGGGCGGTTTACAGAATTGAATCGATAAT
ATAAATAATAACGAGCACAATGATTTAAAACAACATTTTGTACACATTTA
TTGATCTAAATAAA
back to top

protein sequence of SMED30010633-orf-1

>SMED30010633-orf-1 ID=SMED30010633-orf-1|Name=SMED30010633-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=835bp
MYRKHVSSIDHYEQTTTGLIKLSLWDQIEFEYSKALMNNRYRDSSVDKDL
KVIRIFISSTFKDFYNERDVLVKNVFPKLRKWCEEQGLFLVECDLRWGVP
VDATNLEAVSYCLDEIEKSREETNNHNFFLCLIGERFGWVPSEETLMEKL
KLKYDFIKDSSVTLMEIVHGVLRSGTENSLFMIRSKNILENMPKSHLKYF
EESDELLKFNVNEQKKFIKNHFSNSGSVKDYSIHYKSTVVDLISGKERIV
FSDFDEFSKIVEDYFKSQILDFKNKHELSVAMDDQNEDMIHKSHLISINK
SSLKRTSYIELLSNQIKNASSENEKNPVIIITGEAGSGKSTIIAHIIEHY
SKLENENVFYHFCGASNTSHSQLSILKRLENYLKLVFNLNVSISNEENPN
LSKSLENLSGPKLKIVIDALDEIWDLDIVSQFPKFTSKNIQLIISCLYDT
SIDSFYSKFTTQEIEYIQLPIEKLDKIQLIDITNKYLYNFGKKLDSTQLE
KLLSFDNSHNPLWLLSACEELRMHGDYSSLTKLINSLPPSIIDLNRMIIK
RLSDQDVTNVLKTVLELLVISRAGIWESLIKEILAEILNFPEPISHSTWS
DIMWQLKGFLLIQSIPLPLIKIRHRLMKESIEEELSMDEEYKIILHHKIS
IYLERLYDNAGDTFLSDYMYHLVKSNARNRMIDFMRSRKSWKVLKQPFVR
SRIMLSTRCINPKLTDKQNALMMCIRCANQSGDLSIYSINRNSCFFCGNL
VPASINDENKLFPCQFHKNPNPQMGKCSLCNSIVPAKQGEPVKACQMCSL
SNPRNCGMIINEKDILYRQQLGFSRAVYRIESII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: molecular function
TermDefinition
GO:0008536Ran GTPase binding
GO:0043531ADP binding
GO:0003723RNA binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002182NB-ARC
IPR025139DUF4062
IPR027417P-loop_NTPase
IPR007111NACHT_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 304..467
e-value: 3.4E-10
score: 41.9
NoneNo IPR availablePANTHERPTHR19860:SF22coord: 47..685
NoneNo IPR availablePANTHERPTHR19860FAMILY NOT NAMEDcoord: 47..685
NoneNo IPR availableCDDcd17933DEXSc_RecD-likecoord: 325..352
e-value: 0.00367661
score: 36.7636
IPR025139Domain of unknown function DUF4062PFAMPF13271DUF4062coord: 54..145
e-value: 4.1E-12
score: 46.3
IPR002182NB-ARCPFAMPF00931NB-ARCcoord: 315..426
e-value: 1.8E-5
score: 24.0
IPR007111NACHT nucleoside triphosphatasePROSITEPS50837NACHTcoord: 327..423
score: 10.606
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 288..562