E3 ubiquitin-protein ligase RGLG4

Overview
NameE3 ubiquitin-protein ligase RGLG4
Smed IDSMED30010632
Length (bp)1172
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase RGLG4 (SMED30010632) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RGLG4 (SMED30010632) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase RGLG4 (SMED30010632) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RGLG4 (SMED30010632) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30010632SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30010632SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30010632SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30010632SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010632SMESG000076482.1 SMESG000076409.1 SMESG000076405.1 SMESG000076390.1 SMESG000076375.1 SMESG000076364.1 SMESG000076223.1 SMESG000040665.1 SMESG000019753.1 dd_Smed_v4_1097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010632SMESG000043477.1 SMESG000019753.1 dd_Smed_v4_4342_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 105.916 bits (263), Expect = 1.631e-24
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  188 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ-----------HNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 375          

HSP 2 Score: 90.5077 bits (223), Expect = 3.009e-19
Identity = 44/153 (28.76%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  218 GFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 82.4185 bits (202), Expect = 1.519e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 403          

HSP 4 Score: 76.2554 bits (186), Expect = 1.643e-14
Identity = 58/254 (22.83%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFINRNDEIAFDKI---------WKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
             +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+       V+    F   +    +  I           + DF   N  + LHV       N   +VK +LD+
Sbjct:   27 SYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN---MVKLLLDR 273          

HSP 5 Score: 60.077 bits (144), Expect = 3.332e-9
Identity = 28/97 (28.87%), Postives = 51/97 (52.58%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC-----NIEC 474
            ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+         N+ C
Sbjct:  353 ALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVSC 449          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 102.834 bits (255), Expect = 5.554e-23
Identity = 58/206 (28.16%), Postives = 104/206 (50.49%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++    N + ++  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ ++KLLL+R   I+ +   G+ P+HCA+  GH Q+++LLL+R   +  +     S L +A Q   ++CV+ L+  +         D++  D +            + LHV   A  C   R+ K +LDK
Sbjct:  158 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV------DDVTLDYL------------TALHV---AAHCGHYRVTKLLLDK 342          

HSP 2 Score: 99.3673 bits (246), Expect = 7.231e-22
Identity = 47/140 (33.57%), Postives = 80/140 (57.14%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G V VA ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH ++++LLLER   +      G+ P+H A+ G H++ +K LLQ K  +D
Sbjct:  175 LQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 314          

HSP 3 Score: 92.4337 bits (228), Expect = 1.412e-19
Identity = 55/203 (27.09%), Postives = 91/203 (44.83%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H+A   G   + ++++D G  I+ +T  G+ P+H A+  G  +++ LLLER   +   T +G+ P+H A+ G                                 GH  + KLLL++  N       G+ PIH A+  GHL I+ LLLQ     D  N   E+ L +A ++ Q++ V+ L+    L D   R ++   
Sbjct:  221 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPL 423          

HSP 4 Score: 88.1965 bits (217), Expect = 3.514e-18
Identity = 45/159 (28.30%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            + + +G  ++H+A   G VEV R ++  G+ ++        P+H AS  G  EI+ LLL+     +  T +G  P+H ++  G  ++  +LLE          +G  P+H A+  G L + KLLLQR+   D       + L +A +  QM     L++
Sbjct:  381 VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLN 539          

HSP 5 Score: 83.5741 bits (205), Expect = 1.151e-16
Identity = 47/183 (25.68%), Postives = 79/183 (43.17%), Query Frame = 1
Query:   97 QCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            Q  LQH+   +A                   G+  +HI+   G V+VA ++++ G+     T  G  P+H A+  G L++  LLL+R    +    +G  P+H A+     +I   LL           +G+ P+H AS  GH  ++ LLL +   I        + L LA Q  +++   +L
Sbjct:  436 QLLLQHMAHPDA---------------ATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 603          

HSP 6 Score: 79.7221 bits (195), Expect = 2.405e-15
Identity = 62/248 (25.00%), Postives = 104/248 (41.94%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFI---------NRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            + GN D V +YLK        +  G  ++H+A   G V + + ++  GS+++  T  G   +H AS  G  E++ +L++   +I  ++ +G  P++ A+   H +++K LLE   N       G  P+  A   GH Q + +LL+     D K  +    L +A +        LL+       VQ    F          N N          + DF   N  + LHV       N   +VK +LD+
Sbjct:    3 RAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTN---MVKLLLDR 243          

HSP 7 Score: 78.9518 bits (193), Expect = 3.979e-15
Identity = 41/149 (27.52%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G  E+ ++++   ++ +  TT G  P+H ++  G +++ ++LLE        T  G  P+H A+  G  ++ KLLL+R    +     G  P+H A+    +QI   LL      +       + L LA Q    D V LL+
Sbjct:  423 LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLL 571          

HSP 8 Score: 75.485 bits (184), Expect = 5.318e-14
Identity = 39/177 (22.03%), Postives = 83/177 (46.89%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +EG  D     L++   +++   +G   +H+A   G ++VA++++   +  +     G  P+H A+ +  ++I + LL    +    T  G+ P+H AS  GH++++ LLL++  NI      G+  +H A+    + +  +L +     D    +  + L +A     +  V  L+
Sbjct:  461 REGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLL 637          

HSP 9 Score: 75.0998 bits (183), Expect = 7.018e-14
Identity = 37/145 (25.52%), Postives = 70/145 (48.28%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELA 609
            IV  QG   +H+A   G  ++  +++D G+NI   T  G+  +H A+    + +  +L +   D +  T  G  P+  A   G+ +++  LL++  N+  +   G  P+H A+  GH  I+ +LLQ   + +       + L +A
Sbjct:  546 IVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 690          

HSP 10 Score: 73.559 bits (179), Expect = 2.070e-13
Identity = 39/150 (26.00%), Postives = 70/150 (46.67%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G   V ++++D  +N       G+ PIH A+  G L I+ LLL+     +     G   +H A+  G  E+++ LL     ++        P+H AS  G  +I++LLLQ     D       + L ++ +  Q+D   +L+
Sbjct:  323 ALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 472          

HSP 11 Score: 68.5514 bits (166), Expect = 9.771e-12
Identity = 39/153 (25.49%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  VE  + ++   + ++  T   +  +H A+  G   +  LLL++  +      SG+ PIH A+  GH  I+ LLL+   + +  + RG   +H A+  G +++++ LL+    +D +    ++ L +A +  + + VQLL+
Sbjct:  287 GLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL 439          

HSP 12 Score: 67.0106 bits (162), Expect = 2.457e-11
Identity = 36/165 (21.82%), Postives = 74/165 (44.85%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G   IH+A   G + +  +++  G++ +     G   +H A+  G +E++  LL     ++        P+H AS  G +EI++LLL+   + +     G  P+H ++  G + +  +LL+             + L +A +   +D  +LL+  +   D   +N
Sbjct:  353 GLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 517          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 102.834 bits (255), Expect = 7.149e-23
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  199 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 386          

HSP 2 Score: 88.9669 bits (219), Expect = 2.504e-18
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  216 LQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 381          

HSP 3 Score: 81.6481 bits (200), Expect = 5.208e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  266 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 414          

HSP 4 Score: 79.337 bits (194), Expect = 3.538e-15
Identity = 43/163 (26.38%), Postives = 85/163 (52.15%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  351 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 513          

HSP 5 Score: 76.6406 bits (187), Expect = 2.411e-14
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  625 GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 777          

HSP 6 Score: 76.6406 bits (187), Expect = 2.432e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  592 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 744          

HSP 7 Score: 76.2554 bits (186), Expect = 3.181e-14
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H ++  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  459 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 612          

HSP 8 Score: 76.2554 bits (186), Expect = 3.542e-14
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G AD V + L+           G+  +H++   G  +VA  ++D G+++   T  G  P+H A+  G LE+  LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+
Sbjct:  504 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLL 678          

HSP 9 Score: 72.4034 bits (176), Expect = 5.633e-13
Identity = 44/182 (24.18%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   39 YLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 216          

HSP 10 Score: 70.8626 bits (172), Expect = 1.922e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  271 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 480          

HSP 11 Score: 70.4774 bits (171), Expect = 2.196e-12
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  654 VTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 778          

HSP 12 Score: 65.855 bits (159), Expect = 7.650e-11
Identity = 31/116 (26.72%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G  P+H A+  GH+ I+ +LL+ N +
Sbjct:  667 QEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 782          

HSP 13 Score: 65.4698 bits (158), Expect = 1.060e-10
Identity = 38/156 (24.36%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G++    TT G  P+H ++  G  ++   LL+    +   T  G  P+H A+  G  E+  LLL+++ + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  492 DDQT--PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL 645          

HSP 14 Score: 64.3142 bits (155), Expect = 2.407e-10
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L L+ +    D    L+
Sbjct:  394 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 546          

HSP 15 Score: 57.3806 bits (137), Expect = 3.608e-8
Identity = 32/157 (20.38%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H ++  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  423 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLL 579          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 102.834 bits (255), Expect = 7.153e-23
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  188 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 375          

HSP 2 Score: 88.9669 bits (219), Expect = 2.505e-18
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 81.6481 bits (200), Expect = 5.212e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 403          

HSP 4 Score: 79.337 bits (194), Expect = 3.540e-15
Identity = 43/163 (26.38%), Postives = 85/163 (52.15%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 5 Score: 76.6406 bits (187), Expect = 2.412e-14
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 766          

HSP 6 Score: 76.6406 bits (187), Expect = 2.434e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 7 Score: 76.2554 bits (186), Expect = 3.183e-14
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H ++  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 8 Score: 76.2554 bits (186), Expect = 3.544e-14
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G AD V + L+           G+  +H++   G  +VA  ++D G+++   T  G  P+H A+  G LE+  LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLL 667          

HSP 9 Score: 72.4034 bits (176), Expect = 5.636e-13
Identity = 44/182 (24.18%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 10 Score: 70.8626 bits (172), Expect = 1.923e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 469          

HSP 11 Score: 70.4774 bits (171), Expect = 2.197e-12
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  643 VTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          

HSP 12 Score: 65.855 bits (159), Expect = 7.654e-11
Identity = 31/116 (26.72%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G  P+H A+  GH+ I+ +LL+ N +
Sbjct:  656 QEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 771          

HSP 13 Score: 65.4698 bits (158), Expect = 1.061e-10
Identity = 38/156 (24.36%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G++    TT G  P+H ++  G  ++   LL+    +   T  G  P+H A+  G  E+  LLL+++ + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  481 DDQT--PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL 634          

HSP 14 Score: 64.3142 bits (155), Expect = 2.409e-10
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L L+ +    D    L+
Sbjct:  383 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 535          

HSP 15 Score: 57.3806 bits (137), Expect = 3.610e-8
Identity = 32/157 (20.38%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H ++  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLL 568          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 102.834 bits (255), Expect = 7.895e-23
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  205 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 392          

HSP 2 Score: 88.9669 bits (219), Expect = 2.750e-18
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  222 LQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 387          

HSP 3 Score: 81.6481 bits (200), Expect = 5.698e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  272 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 420          

HSP 4 Score: 79.337 bits (194), Expect = 3.865e-15
Identity = 43/163 (26.38%), Postives = 85/163 (52.15%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  357 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 519          

HSP 5 Score: 76.6406 bits (187), Expect = 2.628e-14
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  631 GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          

HSP 6 Score: 76.6406 bits (187), Expect = 2.652e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  598 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 750          

HSP 7 Score: 76.2554 bits (186), Expect = 3.467e-14
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H ++  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  465 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 618          

HSP 8 Score: 76.2554 bits (186), Expect = 3.860e-14
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G AD V + L+           G+  +H++   G  +VA  ++D G+++   T  G  P+H A+  G LE+  LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+
Sbjct:  510 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLL 684          

HSP 9 Score: 72.4034 bits (176), Expect = 6.121e-13
Identity = 44/182 (24.18%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 222          

HSP 10 Score: 70.8626 bits (172), Expect = 2.086e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  277 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 486          

HSP 11 Score: 70.4774 bits (171), Expect = 2.382e-12
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  660 VTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 784          

HSP 12 Score: 65.855 bits (159), Expect = 8.262e-11
Identity = 31/116 (26.72%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G  P+H A+  GH+ I+ +LL+ N +
Sbjct:  673 QEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 788          

HSP 13 Score: 65.4698 bits (158), Expect = 1.145e-10
Identity = 38/156 (24.36%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G++    TT G  P+H ++  G  ++   LL+    +   T  G  P+H A+  G  E+  LLL+++ + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  498 DDQT--PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL 651          

HSP 14 Score: 64.3142 bits (155), Expect = 2.596e-10
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L L+ +    D    L+
Sbjct:  400 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 552          

HSP 15 Score: 57.3806 bits (137), Expect = 3.860e-8
Identity = 32/157 (20.38%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H ++  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  429 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLL 585          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 5.767e-16
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L++   +       +  +HIA   G  EVA I++D  ++    T  G  P+H AS  G LE++ LLLER   ++ E  + + P+H A+   + ++  LLLE   + +     G  P+H A+    ++I   LLQ K   + K+    + L L+ Q    +   LLI
Sbjct:  502 GNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 2 Score: 78.5666 bits (192), Expect = 2.160e-15
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G V VA++++D  ++       G  P+H A  +  ++++ LLL+    IE  T SG+ P+H A+  G   I+  LL++  N + E  RG  P+H A+      ++++L++   ++D +    ++ L +A +    D V LL+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLL 511          

HSP 3 Score: 77.411 bits (189), Expect = 5.845e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      +V R++I  G+ ++ +      P+H AS  G  +I+ LLL+   +    T     P+H A+  G  E+  +LL+ N +      +G  P+H AS  G+L++++LLL+R   +D +     + L +A          LL+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 76.6406 bits (187), Expect = 9.565e-15
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  V+ AR ++   + ++  T   + P+H A+  G + +  LLL+R+ D      +G  P+H A      ++++LLL+    IE     G+ P+H A+  G + I+  LLQ+    D +    E+ L LA ++ Q D V++LI
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 5 Score: 75.485 bits (184), Expect = 2.010e-14
Identity = 41/162 (25.31%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  172 TIVDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T VD +G   +   H+A      +VA ++++ G++ +     G  P+H A+ +  +EI + LL+   D   ++ +G  P+H ++  GH EI  LL+E   ++  + N G+  +H  +   H+ + ++L      I+ K N   + L +A    Q++ V+ L+
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 6 Score: 75.0998 bits (183), Expect = 2.651e-14
Identity = 51/209 (24.40%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA        A +++    N +  +  G  P+H A+  G   +  LLLE+  ++  +    + P+H A+  G + +  LLL R   I+      + P+HCA+  GH Q++ LL+ +   I  K     + L +A Q   +D  + L+  +   D +             + D++     + LHV   A  C   R+ K +LD++ D
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-------------TVDYL-----TPLHV---AAHCGHVRVAKLLLDRSAD 384          

HSP 7 Score: 73.9442 bits (180), Expect = 7.809e-14
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++   + IE  T  G+ P+H A+  G + I+  LL++  + + ET  G  P+H A+    ++++++L+     ++ +      P+H AS  G+  I+ LLLQ     +     + S L +A +  Q +   +L+
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 8 Score: 73.559 bits (179), Expect = 8.387e-14
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   V +++++ G+N+  +    + P+H A+  G   +  LLL R   I+  T   + P+H A+  GH +++ LL+ +   I  +   G+ P+H A+ G H+   + LL  +  +D
Sbjct:  222 VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 9 Score: 73.559 bits (179), Expect = 9.251e-14
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  ++   ++   ++  G  P+H ++  G  EI  LL+E   D+  + N+G+  +H  +   H  + ++L      I  + N G  P+H A   G L ++K L++    +  K   S + L  A Q    +CV+ L+
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 10 Score: 73.559 bits (179), Expect = 9.417e-14
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            +HIA   G  ++  +++  G+N    T     P+H A+  G  E+  +LL+ N D    T  G  P+H AS  G+ E+++LLLER   ++ E    + P+H A+   + ++  LLL+             + L +A +  QM+    L+  +
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK 646          

HSP 11 Score: 72.4034 bits (176), Expect = 2.421e-13
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            KEG  +     L  +   T++  +G   +H+A   G +EV R++++ G+ ++ E    + P+H A+     ++  LLLE     +    +G  P+H A+     EI   LL+   +   +   G  P+H ++  GH +I  LL++    +  K N   + + L  Q   +   Q+L
Sbjct:  533 KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 12 Score: 69.3218 bits (168), Expect = 2.061e-12
Identity = 50/213 (23.47%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + G+ + V + L++       +  G  S+H+A   G  EV R +I   + ++  T  G   +H AS  G   I+T+L+E   ++  ++ +G  P++ A+   H E++K LL+   N       G  P+  A   GH +++ +LL+     D K  +    L +A +        LL+  +   D  +++    F  +  ++ +  EN+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKS---GFTPLHIAAHYGHENV 242          

HSP 13 Score: 61.2326 bits (147), Expect = 7.743e-10
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            + G  ++H+      V VA+I+ + G+ I  +T  G  P+H A   G L ++  L+E   D+  +T +   P+H A+  GH+  ++ LLE   +   +   G  P+  A   G++ +++ L
Sbjct:  687 NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 14 Score: 58.5362 bits (140), Expect = 5.763e-9
Identity = 32/152 (21.05%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            G   +H++   G  E++ ++I+ GS++  +   G+  +H  +    + +  +L     +I  +TN+G  P+H A   G   ++K L+E   ++  +      P+H A+  GH   ++ LL+     + +    ++ L +A +   +  V+ L
Sbjct:  656 GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 5.767e-16
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L++   +       +  +HIA   G  EVA I++D  ++    T  G  P+H AS  G LE++ LLLER   ++ E  + + P+H A+   + ++  LLLE   + +     G  P+H A+    ++I   LLQ K   + K+    + L L+ Q    +   LLI
Sbjct:  502 GNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 2 Score: 78.5666 bits (192), Expect = 2.160e-15
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G V VA++++D  ++       G  P+H A  +  ++++ LLL+    IE  T SG+ P+H A+  G   I+  LL++  N + E  RG  P+H A+      ++++L++   ++D +    ++ L +A +    D V LL+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLL 511          

HSP 3 Score: 77.411 bits (189), Expect = 5.845e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      +V R++I  G+ ++ +      P+H AS  G  +I+ LLL+   +    T     P+H A+  G  E+  +LL+ N +      +G  P+H AS  G+L++++LLL+R   +D +     + L +A          LL+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 76.6406 bits (187), Expect = 9.565e-15
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  V+ AR ++   + ++  T   + P+H A+  G + +  LLL+R+ D      +G  P+H A      ++++LLL+    IE     G+ P+H A+  G + I+  LLQ+    D +    E+ L LA ++ Q D V++LI
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 5 Score: 75.485 bits (184), Expect = 2.010e-14
Identity = 41/162 (25.31%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  172 TIVDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T VD +G   +   H+A      +VA ++++ G++ +     G  P+H A+ +  +EI + LL+   D   ++ +G  P+H ++  GH EI  LL+E   ++  + N G+  +H  +   H+ + ++L      I+ K N   + L +A    Q++ V+ L+
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 6 Score: 75.0998 bits (183), Expect = 2.651e-14
Identity = 51/209 (24.40%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA        A +++    N +  +  G  P+H A+  G   +  LLLE+  ++  +    + P+H A+  G + +  LLL R   I+      + P+HCA+  GH Q++ LL+ +   I  K     + L +A Q   +D  + L+  +   D +             + D++     + LHV   A  C   R+ K +LD++ D
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-------------TVDYL-----TPLHV---AAHCGHVRVAKLLLDRSAD 384          

HSP 7 Score: 73.9442 bits (180), Expect = 7.809e-14
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++   + IE  T  G+ P+H A+  G + I+  LL++  + + ET  G  P+H A+    ++++++L+     ++ +      P+H AS  G+  I+ LLLQ     +     + S L +A +  Q +   +L+
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 8 Score: 73.559 bits (179), Expect = 8.387e-14
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   V +++++ G+N+  +    + P+H A+  G   +  LLL R   I+  T   + P+H A+  GH +++ LL+ +   I  +   G+ P+H A+ G H+   + LL  +  +D
Sbjct:  222 VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 9 Score: 73.559 bits (179), Expect = 9.251e-14
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  ++   ++   ++  G  P+H ++  G  EI  LL+E   D+  + N+G+  +H  +   H  + ++L      I  + N G  P+H A   G L ++K L++    +  K   S + L  A Q    +CV+ L+
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 10 Score: 73.559 bits (179), Expect = 9.417e-14
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            +HIA   G  ++  +++  G+N    T     P+H A+  G  E+  +LL+ N D    T  G  P+H AS  G+ E+++LLLER   ++ E    + P+H A+   + ++  LLL+             + L +A +  QM+    L+  +
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK 646          

HSP 11 Score: 72.4034 bits (176), Expect = 2.421e-13
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            KEG  +     L  +   T++  +G   +H+A   G +EV R++++ G+ ++ E    + P+H A+     ++  LLLE     +    +G  P+H A+     EI   LL+   +   +   G  P+H ++  GH +I  LL++    +  K N   + + L  Q   +   Q+L
Sbjct:  533 KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 12 Score: 69.3218 bits (168), Expect = 2.061e-12
Identity = 50/213 (23.47%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + G+ + V + L++       +  G  S+H+A   G  EV R +I   + ++  T  G   +H AS  G   I+T+L+E   ++  ++ +G  P++ A+   H E++K LL+   N       G  P+  A   GH +++ +LL+     D K  +    L +A +        LL+  +   D  +++    F  +  ++ +  EN+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKS---GFTPLHIAAHYGHENV 242          

HSP 13 Score: 61.2326 bits (147), Expect = 7.743e-10
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            + G  ++H+      V VA+I+ + G+ I  +T  G  P+H A   G L ++  L+E   D+  +T +   P+H A+  GH+  ++ LLE   +   +   G  P+  A   G++ +++ L
Sbjct:  687 NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 14 Score: 58.5362 bits (140), Expect = 5.763e-9
Identity = 32/152 (21.05%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            G   +H++   G  E++ ++I+ GS++  +   G+  +H  +    + +  +L     +I  +TN+G  P+H A   G   ++K L+E   ++  +      P+H A+  GH   ++ LL+     + +    ++ L +A +   +  V+ L
Sbjct:  656 GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 5.781e-16
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L++   +       +  +HIA   G  EVA I++D  ++    T  G  P+H AS  G LE++ LLLER   ++ E  + + P+H A+   + ++  LLLE   + +     G  P+H A+    ++I   LLQ K   + K+    + L L+ Q    +   LLI
Sbjct:  502 GNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 2 Score: 78.5666 bits (192), Expect = 2.165e-15
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G V VA++++D  ++       G  P+H A  +  ++++ LLL+    IE  T SG+ P+H A+  G   I+  LL++  N + E  RG  P+H A+      ++++L++   ++D +    ++ L +A +    D V LL+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLL 511          

HSP 3 Score: 77.411 bits (189), Expect = 5.858e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      +V R++I  G+ ++ +      P+H AS  G  +I+ LLL+   +    T     P+H A+  G  E+  +LL+ N +      +G  P+H AS  G+L++++LLL+R   +D +     + L +A          LL+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 76.6406 bits (187), Expect = 9.586e-15
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  V+ AR ++   + ++  T   + P+H A+  G + +  LLL+R+ D      +G  P+H A      ++++LLL+    IE     G+ P+H A+  G + I+  LLQ+    D +    E+ L LA ++ Q D V++LI
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 5 Score: 75.485 bits (184), Expect = 2.014e-14
Identity = 41/162 (25.31%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  172 TIVDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T VD +G   +   H+A      +VA ++++ G++ +     G  P+H A+ +  +EI + LL+   D   ++ +G  P+H ++  GH EI  LL+E   ++  + N G+  +H  +   H+ + ++L      I+ K N   + L +A    Q++ V+ L+
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 6 Score: 75.0998 bits (183), Expect = 2.657e-14
Identity = 51/209 (24.40%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA        A +++    N +  +  G  P+H A+  G   +  LLLE+  ++  +    + P+H A+  G + +  LLL R   I+      + P+HCA+  GH Q++ LL+ +   I  K     + L +A Q   +D  + L+  +   D +             + D++     + LHV   A  C   R+ K +LD++ D
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-------------TVDYL-----TPLHV---AAHCGHVRVAKLLLDRSAD 384          

HSP 7 Score: 73.9442 bits (180), Expect = 7.826e-14
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++   + IE  T  G+ P+H A+  G + I+  LL++  + + ET  G  P+H A+    ++++++L+     ++ +      P+H AS  G+  I+ LLLQ     +     + S L +A +  Q +   +L+
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 8 Score: 73.559 bits (179), Expect = 8.405e-14
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   V +++++ G+N+  +    + P+H A+  G   +  LLL R   I+  T   + P+H A+  GH +++ LL+ +   I  +   G+ P+H A+ G H+   + LL  +  +D
Sbjct:  222 VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 9 Score: 73.559 bits (179), Expect = 9.271e-14
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  ++   ++   ++  G  P+H ++  G  EI  LL+E   D+  + N+G+  +H  +   H  + ++L      I  + N G  P+H A   G L ++K L++    +  K   S + L  A Q    +CV+ L+
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 10 Score: 73.559 bits (179), Expect = 9.438e-14
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            +HIA   G  ++  +++  G+N    T     P+H A+  G  E+  +LL+ N D    T  G  P+H AS  G+ E+++LLLER   ++ E    + P+H A+   + ++  LLL+             + L +A +  QM+    L+  +
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK 646          

HSP 11 Score: 72.4034 bits (176), Expect = 2.427e-13
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            KEG  +     L  +   T++  +G   +H+A   G +EV R++++ G+ ++ E    + P+H A+     ++  LLLE     +    +G  P+H A+     EI   LL+   +   +   G  P+H ++  GH +I  LL++    +  K N   + + L  Q   +   Q+L
Sbjct:  533 KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 12 Score: 69.3218 bits (168), Expect = 2.065e-12
Identity = 50/213 (23.47%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + G+ + V + L++       +  G  S+H+A   G  EV R +I   + ++  T  G   +H AS  G   I+T+L+E   ++  ++ +G  P++ A+   H E++K LL+   N       G  P+  A   GH +++ +LL+     D K  +    L +A +        LL+  +   D  +++    F  +  ++ +  EN+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKS---GFTPLHIAAHYGHENV 242          

HSP 13 Score: 61.2326 bits (147), Expect = 7.758e-10
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            + G  ++H+      V VA+I+ + G+ I  +T  G  P+H A   G L ++  L+E   D+  +T +   P+H A+  GH+  ++ LLE   +   +   G  P+  A   G++ +++ L
Sbjct:  687 NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 14 Score: 58.5362 bits (140), Expect = 5.774e-9
Identity = 32/152 (21.05%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            G   +H++   G  E++ ++I+ GS++  +   G+  +H  +    + +  +L     +I  +TN+G  P+H A   G   ++K L+E   ++  +      P+H A+  GH   ++ LL+     + +    ++ L +A +   +  V+ L
Sbjct:  656 GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 5.781e-16
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L++   +       +  +HIA   G  EVA I++D  ++    T  G  P+H AS  G LE++ LLLER   ++ E  + + P+H A+   + ++  LLLE   + +     G  P+H A+    ++I   LLQ K   + K+    + L L+ Q    +   LLI
Sbjct:  502 GNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 2 Score: 78.5666 bits (192), Expect = 2.165e-15
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G V VA++++D  ++       G  P+H A  +  ++++ LLL+    IE  T SG+ P+H A+  G   I+  LL++  N + E  RG  P+H A+      ++++L++   ++D +    ++ L +A +    D V LL+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLL 511          

HSP 3 Score: 77.411 bits (189), Expect = 5.858e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      +V R++I  G+ ++ +      P+H AS  G  +I+ LLL+   +    T     P+H A+  G  E+  +LL+ N +      +G  P+H AS  G+L++++LLL+R   +D +     + L +A          LL+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 76.6406 bits (187), Expect = 9.586e-15
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  V+ AR ++   + ++  T   + P+H A+  G + +  LLL+R+ D      +G  P+H A      ++++LLL+    IE     G+ P+H A+  G + I+  LLQ+    D +    E+ L LA ++ Q D V++LI
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 5 Score: 75.485 bits (184), Expect = 2.014e-14
Identity = 41/162 (25.31%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  172 TIVDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T VD +G   +   H+A      +VA ++++ G++ +     G  P+H A+ +  +EI + LL+   D   ++ +G  P+H ++  GH EI  LL+E   ++  + N G+  +H  +   H+ + ++L      I+ K N   + L +A    Q++ V+ L+
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 6 Score: 75.0998 bits (183), Expect = 2.657e-14
Identity = 51/209 (24.40%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA        A +++    N +  +  G  P+H A+  G   +  LLLE+  ++  +    + P+H A+  G + +  LLL R   I+      + P+HCA+  GH Q++ LL+ +   I  K     + L +A Q   +D  + L+  +   D +             + D++     + LHV   A  C   R+ K +LD++ D
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-------------TVDYL-----TPLHV---AAHCGHVRVAKLLLDRSAD 384          

HSP 7 Score: 73.9442 bits (180), Expect = 7.826e-14
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++   + IE  T  G+ P+H A+  G + I+  LL++  + + ET  G  P+H A+    ++++++L+     ++ +      P+H AS  G+  I+ LLLQ     +     + S L +A +  Q +   +L+
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 8 Score: 73.559 bits (179), Expect = 8.405e-14
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   V +++++ G+N+  +    + P+H A+  G   +  LLL R   I+  T   + P+H A+  GH +++ LL+ +   I  +   G+ P+H A+ G H+   + LL  +  +D
Sbjct:  222 VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 9 Score: 73.559 bits (179), Expect = 9.271e-14
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  ++   ++   ++  G  P+H ++  G  EI  LL+E   D+  + N+G+  +H  +   H  + ++L      I  + N G  P+H A   G L ++K L++    +  K   S + L  A Q    +CV+ L+
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 10 Score: 73.559 bits (179), Expect = 9.438e-14
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            +HIA   G  ++  +++  G+N    T     P+H A+  G  E+  +LL+ N D    T  G  P+H AS  G+ E+++LLLER   ++ E    + P+H A+   + ++  LLL+             + L +A +  QM+    L+  +
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK 646          

HSP 11 Score: 72.4034 bits (176), Expect = 2.427e-13
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            KEG  +     L  +   T++  +G   +H+A   G +EV R++++ G+ ++ E    + P+H A+     ++  LLLE     +    +G  P+H A+     EI   LL+   +   +   G  P+H ++  GH +I  LL++    +  K N   + + L  Q   +   Q+L
Sbjct:  533 KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 12 Score: 69.3218 bits (168), Expect = 2.065e-12
Identity = 50/213 (23.47%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + G+ + V + L++       +  G  S+H+A   G  EV R +I   + ++  T  G   +H AS  G   I+T+L+E   ++  ++ +G  P++ A+   H E++K LL+   N       G  P+  A   GH +++ +LL+     D K  +    L +A +        LL+  +   D  +++    F  +  ++ +  EN+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKS---GFTPLHIAAHYGHENV 242          

HSP 13 Score: 61.2326 bits (147), Expect = 7.758e-10
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            + G  ++H+      V VA+I+ + G+ I  +T  G  P+H A   G L ++  L+E   D+  +T +   P+H A+  GH+  ++ LLE   +   +   G  P+  A   G++ +++ L
Sbjct:  687 NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 14 Score: 58.5362 bits (140), Expect = 5.774e-9
Identity = 32/152 (21.05%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            G   +H++   G  E++ ++I+ GS++  +   G+  +H  +    + +  +L     +I  +TN+G  P+H A   G   ++K L+E   ++  +      P+H A+  GH   ++ LL+     + +    ++ L +A +   +  V+ L
Sbjct:  656 GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 80.4925 bits (197), Expect = 5.794e-16
Identity = 52/175 (29.71%), Postives = 84/175 (48.00%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L++   +       +  +HIA   G  EVA I++D  ++    T  G  P+H AS  G LE++ LLLER   ++ E  + + P+H A+   + ++  LLLE   + +     G  P+H A+    ++I   LLQ K   + K+    + L L+ Q    +   LLI
Sbjct:  502 GNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLI 676          

HSP 2 Score: 78.5666 bits (192), Expect = 2.170e-15
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G V VA++++D  ++       G  P+H A  +  ++++ LLL+    IE  T SG+ P+H A+  G   I+  LL++  N + E  RG  P+H A+      ++++L++   ++D +    ++ L +A +    D V LL+
Sbjct:  363 LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLL 511          

HSP 3 Score: 77.411 bits (189), Expect = 5.871e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      +V R++I  G+ ++ +      P+H AS  G  +I+ LLL+   +    T     P+H A+  G  E+  +LL+ N +      +G  P+H AS  G+L++++LLL+R   +D +     + L +A          LL+
Sbjct:  457 RGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLL 610          

HSP 4 Score: 76.6406 bits (187), Expect = 9.608e-15
Identity = 45/153 (29.41%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  V+ AR ++   + ++  T   + P+H A+  G + +  LLL+R+ D      +G  P+H A      ++++LLL+    IE     G+ P+H A+  G + I+  LLQ+    D +    E+ L LA ++ Q D V++LI
Sbjct:  326 GLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLI 478          

HSP 5 Score: 75.485 bits (184), Expect = 2.019e-14
Identity = 41/162 (25.31%), Postives = 82/162 (50.62%), Query Frame = 1
Query:  172 TIVDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T VD +G   +   H+A      +VA ++++ G++ +     G  P+H A+ +  +EI + LL+   D   ++ +G  P+H ++  GH EI  LL+E   ++  + N G+  +H  +   H+ + ++L      I+ K N   + L +A    Q++ V+ L+
Sbjct:  581 TPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV 742          

HSP 6 Score: 75.0998 bits (183), Expect = 2.663e-14
Identity = 51/209 (24.40%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA        A +++    N +  +  G  P+H A+  G   +  LLLE+  ++  +    + P+H A+  G + +  LLL R   I+      + P+HCA+  GH Q++ LL+ +   I  K     + L +A Q   +D  + L+  +   D +             + D++     + LHV   A  C   R+ K +LD++ D
Sbjct:  197 ALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDV-------------TVDYL-----TPLHV---AAHCGHVRVAKLLLDRSAD 384          

HSP 7 Score: 73.9442 bits (180), Expect = 7.843e-14
Identity = 39/153 (25.49%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++   + IE  T  G+ P+H A+  G + I+  LL++  + + ET  G  P+H A+    ++++++L+     ++ +      P+H AS  G+  I+ LLLQ     +     + S L +A +  Q +   +L+
Sbjct:  392 GFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILL 544          

HSP 8 Score: 73.559 bits (179), Expect = 8.423e-14
Identity = 35/132 (26.52%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   V +++++ G+N+  +    + P+H A+  G   +  LLL R   I+  T   + P+H A+  GH +++ LL+ +   I  +   G+ P+H A+ G H+   + LL  +  +D
Sbjct:  222 VTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVD 353          

HSP 9 Score: 73.559 bits (179), Expect = 9.291e-14
Identity = 39/153 (25.49%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  ++   ++   ++  G  P+H ++  G  EI  LL+E   D+  + N+G+  +H  +   H  + ++L      I  + N G  P+H A   G L ++K L++    +  K   S + L  A Q    +CV+ L+
Sbjct:  623 GYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLL 775          

HSP 10 Score: 73.559 bits (179), Expect = 9.458e-14
Identity = 41/152 (26.97%), Postives = 73/152 (48.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            +HIA   G  ++  +++  G+N    T     P+H A+  G  E+  +LL+ N D    T  G  P+H AS  G+ E+++LLLER   ++ E    + P+H A+   + ++  LLL+             + L +A +  QM+    L+  +
Sbjct:  495 LHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK 646          

HSP 11 Score: 72.4034 bits (176), Expect = 2.432e-13
Identity = 43/176 (24.43%), Postives = 81/176 (46.02%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            KEG  +     L  +   T++  +G   +H+A   G +EV R++++ G+ ++ E    + P+H A+     ++  LLLE     +    +G  P+H A+     EI   LL+   +   +   G  P+H ++  GH +I  LL++    +  K N   + + L  Q   +   Q+L
Sbjct:  533 KEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQIL 708          

HSP 12 Score: 69.3218 bits (168), Expect = 2.069e-12
Identity = 50/213 (23.47%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + G+ + V + L++       +  G  S+H+A   G  EV R +I   + ++  T  G   +H AS  G   I+T+L+E   ++  ++ +G  P++ A+   H E++K LL+   N       G  P+  A   GH +++ +LL+     D K  +    L +A +        LL+  +   D  +++    F  +  ++ +  EN+
Sbjct:   37 FLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN----DSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKS---GFTPLHIAAHYGHENV 242          

HSP 13 Score: 61.2326 bits (147), Expect = 7.772e-10
Identity = 32/121 (26.45%), Postives = 61/121 (50.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            + G  ++H+      V VA+I+ + G+ I  +T  G  P+H A   G L ++  L+E   D+  +T +   P+H A+  GH+  ++ LLE   +   +   G  P+  A   G++ +++ L
Sbjct:  687 NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          

HSP 14 Score: 58.5362 bits (140), Expect = 5.784e-9
Identity = 32/152 (21.05%), Postives = 72/152 (47.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            G   +H++   G  E++ ++I+ GS++  +   G+  +H  +    + +  +L     +I  +TN+G  P+H A   G   ++K L+E   ++  +      P+H A+  GH   ++ LL+     + +    ++ L +A +   +  V+ L
Sbjct:  656 GFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL 807          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303120)

HSP 1 Score: 105.145 bits (261), Expect = 3.514e-24
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA     V+ A +++D   N +  +  G  P+H AS  G   I  LL+++  D+       + P+H A+  G + ++ LLLE+  NIE +   G+ P+HCA+  GH Q++ +LL+R   I  K     + L +A Q + +D  ++L+  +         DE+  D +            + LHV   A  C   R+ K +LD+  D
Sbjct:  325 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV------DEVTVDYL------------TALHV---AAHCGHVRVAKLLLDRNAD 512          

HSP 2 Score: 90.1225 bits (222), Expect = 4.020e-19
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L +D    +    G   +HIA   G   +A ++I  G+++       + P+H A+  G   +++LLLE+  +IE +T  G+ P+H A+  GH +++ +LLER   I  +   G+ P+H A+ G H+   ++LL  +  +D
Sbjct:  342 LDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 481          

HSP 3 Score: 83.1889 bits (204), Expect = 7.272e-17
Identity = 46/163 (28.22%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFIN 678
            G   +HIAC    ++V  +++  G++I   T  G+ P+H A+  GC+ I+  LL+ +   +  T  G  P+H A+    ++I+++LL     ++        P+H AS  G++ I+ LLLQ   ++D       + L +A +  Q D V+ LI+ +++ D I+
Sbjct:  520 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ-DEVKDLIA-KKITDHID 680          

HSP 4 Score: 80.4925 bits (197), Expect = 5.510e-16
Identity = 41/150 (27.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G V VA++++D  ++       G  P+H A  +  L+++ LLL     I   T SG+ P+H A+  G   I+  LL+ + + +    RG  P+H A+      I+++LL+   ++D +    ++ L +A +   +D V LL+
Sbjct:  490 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 639          

HSP 5 Score: 78.5666 bits (192), Expect = 2.190e-15
Identity = 50/214 (23.36%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
             FL+  + GN + V ++LK++      +  G  ++H+A   G + V   ++  G+ ++  T  G   +H AS  G  E++ LLLE N  +  ++ +G  P++ A+   H  +++LLL    N       G  P+  A   GH +++ +LL+     D +  +    L +A +   +    LL+      D  +++    F  +  +S +  +NI
Sbjct:  164 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS---GFTPLHIASHYGNQNI 370          

HSP 6 Score: 77.411 bits (189), Expect = 5.435e-15
Identity = 53/215 (24.65%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNC-------------NIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +  ++++ G NIE +T  G+ P+H A+  G  +++ +LLER   I  +T +G+ P+H A+ G                                 GH  + KLLL+RN              +I C+ NR                    G+ P+H A+  G + I+  LLQ     D      E+ L LA ++ Q D +++L+
Sbjct:  392 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 606          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 104.375 bits (259), Expect = 5.052e-24
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA     V+ A +++D   N +  +  G  P+H AS  G   I  LL+++  D+       + P+H A+  G + ++ LLLE+  NIE +   G+ P+HCA+  GH Q++ +LL+R   I  K     + L +A Q + +D  ++L+  +         DE+  D +            + LHV   A  C   R+ K +LD+  D
Sbjct:  175 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV------DEVTVDYL------------TALHV---AAHCGHVRVAKLLLDRNAD 362          

HSP 2 Score: 90.5077 bits (223), Expect = 2.409e-19
Identity = 39/132 (29.55%), Postives = 72/132 (54.55%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G   +A ++I  G+++       + P+H A+  G   +++LLLE+  +IE +T  G+ P+H A+  GH +++ +LLER   I  +   G+ P+H A+ G H+   ++LL  +  +D
Sbjct:  200 VTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 3 Score: 84.3445 bits (207), Expect = 2.121e-17
Identity = 46/163 (28.22%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFIN 678
            G   +HIAC    ++V  +++  G++I   T  G+ P+H A+  GC+ I+  LL+ +   +  T  G  P+H A+    ++I+++LL     ++        P+H AS  G++ I+ LLLQ   ++D       + L +A +  Q D V+ LI+ +++ D I+
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQ-DEVKDLIA-KKITDHID 530          

HSP 4 Score: 81.2629 bits (199), Expect = 2.112e-16
Identity = 41/150 (27.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G V VA++++D  ++       G  P+H A  +  L+++ LLL     I   T SG+ P+H A+  G   I+  LL+ + + +    RG  P+H A+      I+++LL+   ++D +    ++ L +A +   +D V LL+
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 489          

HSP 5 Score: 79.337 bits (194), Expect = 9.502e-16
Identity = 50/214 (23.36%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
             FL+  + GN + V ++LK++      +  G  ++H+A   G + V   ++  G+ ++  T  G   +H AS  G  E++ LLLE N  +  ++ +G  P++ A+   H  +++LLL    N       G  P+  A   GH +++ +LL+     D +  +    L +A +   +    LL+      D  +++    F  +  +S +  +NI
Sbjct:   14 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS---GFTPLHIASHYGNQNI 220          

HSP 6 Score: 77.411 bits (189), Expect = 3.857e-15
Identity = 53/215 (24.65%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNC-------------NIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +  ++++ G NIE +T  G+ P+H A+  G  +++ +LLER   I  +T +G+ P+H A+ G                                 GH  + KLLL+RN              +I C+ NR                    G+ P+H A+  G + I+  LLQ     D      E+ L LA ++ Q D +++L+
Sbjct:  242 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 456          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 104.375 bits (259), Expect = 9.283e-24
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA     V+ A +++D   N +  +  G  P+H AS  G   I  LL+++  D+       + P+H A+  G + ++ LLLE+  NIE +   G+ P+HCA+  GH Q++ +LL+R   I  K     + L +A Q + +D  ++L+  +         DE+  D +            + LHV   A  C   R+ K +LD+  D
Sbjct:  175 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV------DEVTVDYL------------TALHV---AAHCGHVRVAKLLLDRNAD 362          

HSP 2 Score: 90.5077 bits (223), Expect = 3.743e-19
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L +D    +    G   +HIA   G   +A ++I  G+++       + P+H A+  G   +++LLLE+  +IE +T  G+ P+H A+  GH +++ +LLER   I  +   G+ P+H A+ G H+   ++LL  +  +D
Sbjct:  192 LDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 3 Score: 85.8853 bits (211), Expect = 1.078e-17
Identity = 42/153 (27.45%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I   T  G+ P+H A+  GC+ I+  LL+ +   +  T  G  P+H A+    ++I+++LL     ++        P+H AS  G++ I+ LLLQ   ++D       + L +A +  Q +   +LI
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI 522          

HSP 4 Score: 80.8777 bits (198), Expect = 5.014e-16
Identity = 41/150 (27.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G V VA++++D  ++       G  P+H A  +  L+++ LLL     I   T SG+ P+H A+  G   I+  LL+ + + +    RG  P+H A+      I+++LL+   ++D +    ++ L +A +   +D V LL+
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 489          

HSP 5 Score: 79.337 bits (194), Expect = 1.437e-15
Identity = 50/214 (23.36%), Postives = 99/214 (46.26%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENI 741
             FL+  + GN + V ++LK++      +  G  ++H+A   G + V   ++  G+ ++  T  G   +H AS  G  E++ LLLE N  +  ++ +G  P++ A+   H  +++LLL    N       G  P+  A   GH +++ +LL+     D +  +    L +A +   +    LL+      D  +++    F  +  +S +  +NI
Sbjct:   14 SFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKS---GFTPLHIASHYGNQNI 220          

HSP 6 Score: 78.5666 bits (192), Expect = 2.273e-15
Identity = 39/170 (22.94%), Postives = 79/170 (46.47%), Query Frame = 1
Query:  139 VWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V   L+ D    +   +G   +H+A      ++ RI++  G+ ++        P+H AS  G ++I+ LLL+    ++  T      +H A+  G  E+  +L+E    ++    +G  P+H  +  GH+++ +LLLQ++  +D +     + L +A          LL+
Sbjct:  419 VIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLL 588          

HSP 7 Score: 78.5666 bits (192), Expect = 2.820e-15
Identity = 45/187 (24.06%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            GN D V   L+            + ++HIA   G  EVA ++I+ G+ ++  T  G  P+H  +  G +++  LLL++  D++ +  +G+ P+H A    + ++  LLLE+  +       G  P+H A+    + I   LL+     + ++    + L L+ Q    +   LLI  +   +   +N
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKN 666          

HSP 8 Score: 77.0258 bits (188), Expect = 7.171e-15
Identity = 53/215 (24.65%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNC-------------NIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +  ++++ G NIE +T  G+ P+H A+  G  +++ +LLER   I  +T +G+ P+H A+ G                                 GH  + KLLL+RN              +I C+ NR                    G+ P+H A+  G + I+  LLQ     D      E+ L LA ++ Q D +++L+
Sbjct:  242 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 456          

HSP 9 Score: 77.0258 bits (188), Expect = 8.973e-15
Identity = 39/153 (25.49%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GH  +HIA     +++A  +++ G+    E+  G  P+H +S  G  EI  LL+E    +     +G+ P+H  +   +  + ++L +   NI+     G  P+H AS  G   +++ LLQ    +D   ++  + L    Q      V LL+
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL 753          

HSP 10 Score: 76.6406 bits (187), Expect = 1.143e-14
Identity = 41/173 (23.70%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSS 720
            +HIA   G V++  +++  G+ ++  T      +H A+  G  E+  +L+E    ++  T  G  P+H  +  GH ++ +LLL++  +++ +   G+ P+H A    + Q+  LLL++            + L +A +  QMD    L+   E     N   +  F  +  SS
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL---EYGALANAESKAGFTPLHLSS 642          

HSP 11 Score: 76.2554 bits (186), Expect = 1.355e-14
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  178 VDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            VD QG   +   H+AC     +VA ++++ G++       G  P+H A+ +  ++I T LLE       E+ +G  P+H +S  GH+EI  LL+E    +      G+ P+H  +   ++ + ++L +    ID       + L +A    Q + V+ L+
Sbjct:  561 VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 12 Score: 70.8626 bits (172), Expect = 8.090e-13
Identity = 36/116 (31.03%), Postives = 57/116 (49.14%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQIL 537
            G   +H+      V VA I+   G+NI+  T  G  P+H AS  G   ++  LL+   +++  T+ G  P+H  +  GH  I+ LLLE   N   +   G  P+H A   G++ +L
Sbjct:  667 GLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVL 782          

HSP 13 Score: 58.151 bits (139), Expect = 9.805e-9
Identity = 33/167 (19.76%), Postives = 71/167 (42.51%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            + G   +H+A   G + +   ++   ++ +  T  G  P+H A+     +I+ +LL     ++        P+H AS  G+ +I+ LLL+    ++         +H A+  G  ++  +L++    +D       + L L  +   +   QLL+  +   D   +N
Sbjct:  401 ESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKN 567          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334061)

HSP 1 Score: 100.523 bits (249), Expect = 1.703e-22
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA     V+ A +++D   N +  +  G  P+H AS  G   I  LL+++  D+       + P+H A+  G + ++ LLLE+  NIE +   G+ P+HCA+  GH Q++ +LL+R   I  K     + L +A Q + +D  ++L+  +         DE+  D +            + LHV   A  C   R+ K +LD+  D
Sbjct:  325 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV------DEVTVDYL------------TALHV---AAHCGHVRVAKLLLDRNAD 512          

HSP 2 Score: 87.0409 bits (214), Expect = 4.078e-18
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L +D    +    G   +HIA   G   +A ++I  G+++       + P+H A+  G   +++LLLE+  +IE +T  G+ P+H A+  GH +++ +LLER   I  +   G+ P+H A+ G H+   ++LL  +  +D
Sbjct:  342 LDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 481          

HSP 3 Score: 83.5741 bits (205), Expect = 5.946e-17
Identity = 42/153 (27.45%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I   T  G+ P+H A+  GC+ I+  LL+ +   +  T  G  P+H A+    ++I+++LL     ++        P+H AS  G++ I+ LLLQ   ++D       + L +A +  Q +   +LI
Sbjct:  520 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI 672          

HSP 4 Score: 79.337 bits (194), Expect = 1.344e-15
Identity = 41/150 (27.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G V VA++++D  ++       G  P+H A  +  L+++ LLL     I   T SG+ P+H A+  G   I+  LL+ + + +    RG  P+H A+      I+++LL+   ++D +    ++ L +A +   +D V LL+
Sbjct:  490 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 639          

HSP 5 Score: 75.485 bits (184), Expect = 2.480e-14
Identity = 36/154 (23.38%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      ++ RI++  G+ ++        P+H AS  G ++I+ LLL+    ++  T      +H A+  G  E+  +L+E    ++    +G  P+H  +  GH+++ +LLLQ++  +D +     + L +A          LL+
Sbjct:  585 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLL 738          

HSP 6 Score: 75.0998 bits (183), Expect = 3.185e-14
Identity = 41/154 (26.62%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCR 564
            FL+  + GN + V ++LK++      +  G  ++H+A   G + V   ++  G+ ++  T  G   +H AS  G  E++ LLLE N  +  ++ +G  P++ A+   H  +++LLL    N       G  P+  A   GH +++ +LL+   R
Sbjct:  165 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR 318          

HSP 7 Score: 74.7146 bits (182), Expect = 4.679e-14
Identity = 53/215 (24.65%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +  ++++ G NIE +T  G+ P+H A+  G  +++ +LLER   I  +T +G+ P+H A+ G                                 GH  + KLLL+RN +             I C+ NR                    G+ P+H A+  G + I+  LLQ     D      E+ L LA ++ Q D +++L+
Sbjct:  392 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 606          

HSP 8 Score: 73.559 bits (179), Expect = 1.009e-13
Identity = 39/153 (25.49%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GH  +HIA     +++A  +++ G+    E+  G  P+H +S  G  EI  LL+E    +     +G+ P+H  +   +  + ++L +   NI+     G  P+H AS  G   +++ LLQ    +D   ++  + L    Q      V LL+
Sbjct:  751 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL 903          

HSP 9 Score: 73.1738 bits (178), Expect = 1.677e-13
Identity = 44/175 (25.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L+            + ++HIA   G  EVA ++I+ G+ ++  T  G  P+H  +  G +++  LLL++  D++ +  +G+ P+H A    + ++  LLLE+  +       G  P+H A+    + I   LL+     + ++    + L L+ Q    +   LLI
Sbjct:  630 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 804          

HSP 10 Score: 72.7886 bits (177), Expect = 1.952e-13
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  178 VDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            VD QG   +   H+AC     +VA ++++ G++       G  P+H A+ +  ++I T LLE       E+ +G  P+H +S  GH+EI  LL+E    +      G+ P+H  +   ++ + ++L +    ID       + L +A    Q + V+ L+
Sbjct:  711 VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 870          

HSP 11 Score: 71.2478 bits (173), Expect = 6.730e-13
Identity = 36/149 (24.16%), Postives = 73/149 (48.99%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G V++  +++  G+ ++  T      +H A+  G  E+  +L+E    ++  T  G  P+H  +  GH ++ +LLL++  +++ +   G+ P+H A    + Q+  LLL++            + L +A +  QMD    L+
Sbjct:  623 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 771          

HSP 12 Score: 70.0922 bits (170), Expect = 1.254e-12
Identity = 38/169 (22.49%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIA 696
            G   +H++   G  E++ ++I+  + +      G+ P+H  +    + +  +L +   +I+  T +G  P+H AS  G + +++ LL+   N++   + G  P+H  +  GH  I+ LLL+ K   + +    ++ L +A   +++  + +L S++     I + DE A
Sbjct:  784 GFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA---RKLGYISVLDSLKT----ITKEDETA 945          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303118)

HSP 1 Score: 100.523 bits (249), Expect = 1.918e-22
Identity = 59/209 (28.23%), Postives = 101/209 (48.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA     V+ A +++D   N +  +  G  P+H AS  G   I  LL+++  D+       + P+H A+  G + ++ LLLE+  NIE +   G+ P+HCA+  GH Q++ +LL+R   I  K     + L +A Q + +D  ++L+  +         DE+  D +            + LHV   A  C   R+ K +LD+  D
Sbjct:  175 ALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV------DEVTVDYL------------TALHV---AAHCGHVRVAKLLLDRNAD 362          

HSP 2 Score: 87.0409 bits (214), Expect = 4.559e-18
Identity = 41/140 (29.29%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L +D    +    G   +HIA   G   +A ++I  G+++       + P+H A+  G   +++LLLE+  +IE +T  G+ P+H A+  GH +++ +LLER   I  +   G+ P+H A+ G H+   ++LL  +  +D
Sbjct:  192 LDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVD 331          

HSP 3 Score: 83.5741 bits (205), Expect = 6.632e-17
Identity = 42/153 (27.45%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I   T  G+ P+H A+  GC+ I+  LL+ +   +  T  G  P+H A+    ++I+++LL     ++        P+H AS  G++ I+ LLLQ   ++D       + L +A +  Q +   +LI
Sbjct:  370 GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI 522          

HSP 4 Score: 79.337 bits (194), Expect = 1.494e-15
Identity = 41/150 (27.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G V VA++++D  ++       G  P+H A  +  L+++ LLL     I   T SG+ P+H A+  G   I+  LL+ + + +    RG  P+H A+      I+++LL+   ++D +    ++ L +A +   +D V LL+
Sbjct:  340 ALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 489          

HSP 5 Score: 75.485 bits (184), Expect = 2.747e-14
Identity = 36/154 (23.38%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G   +H+A      ++ RI++  G+ ++        P+H AS  G ++I+ LLL+    ++  T      +H A+  G  E+  +L+E    ++    +G  P+H  +  GH+++ +LLLQ++  +D +     + L +A          LL+
Sbjct:  435 RGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLL 588          

HSP 6 Score: 75.0998 bits (183), Expect = 3.527e-14
Identity = 41/154 (26.62%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCR 564
            FL+  + GN + V ++LK++      +  G  ++H+A   G + V   ++  G+ ++  T  G   +H AS  G  E++ LLLE N  +  ++ +G  P++ A+   H  +++LLL    N       G  P+  A   GH +++ +LL+   R
Sbjct:   15 FLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR 168          

HSP 7 Score: 74.7146 bits (182), Expect = 5.178e-14
Identity = 53/215 (24.65%), Postives = 89/215 (41.40%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +  ++++ G NIE +T  G+ P+H A+  G  +++ +LLER   I  +T +G+ P+H A+ G                                 GH  + KLLL+RN +             I C+ NR                    G+ P+H A+  G + I+  LLQ     D      E+ L LA ++ Q D +++L+
Sbjct:  242 LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL 456          

HSP 8 Score: 73.559 bits (179), Expect = 1.115e-13
Identity = 39/153 (25.49%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GH  +HIA     +++A  +++ G+    E+  G  P+H +S  G  EI  LL+E    +     +G+ P+H  +   +  + ++L +   NI+     G  P+H AS  G   +++ LLQ    +D   ++  + L    Q      V LL+
Sbjct:  601 GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL 753          

HSP 9 Score: 73.1738 bits (178), Expect = 1.853e-13
Identity = 44/175 (25.14%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN D V   L+            + ++HIA   G  EVA ++I+ G+ ++  T  G  P+H  +  G +++  LLL++  D++ +  +G+ P+H A    + ++  LLLE+  +       G  P+H A+    + I   LL+     + ++    + L L+ Q    +   LLI
Sbjct:  480 GNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLI 654          

HSP 10 Score: 72.7886 bits (177), Expect = 2.156e-13
Identity = 42/160 (26.25%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  178 VDDQGHYSI---HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            VD QG   +   H+AC     +VA ++++ G++       G  P+H A+ +  ++I T LLE       E+ +G  P+H +S  GH+EI  LL+E    +      G+ P+H  +   ++ + ++L +    ID       + L +A    Q + V+ L+
Sbjct:  561 VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLL 720          

HSP 11 Score: 71.2478 bits (173), Expect = 7.421e-13
Identity = 36/149 (24.16%), Postives = 73/149 (48.99%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G V++  +++  G+ ++  T      +H A+  G  E+  +L+E    ++  T  G  P+H  +  GH ++ +LLL++  +++ +   G+ P+H A    + Q+  LLL++            + L +A +  QMD    L+
Sbjct:  473 LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLL 621          

HSP 12 Score: 70.0922 bits (170), Expect = 1.382e-12
Identity = 38/169 (22.49%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIA 696
            G   +H++   G  E++ ++I+  + +      G+ P+H  +    + +  +L +   +I+  T +G  P+H AS  G + +++ LL+   N++   + G  P+H  +  GH  I+ LLL+ K   + +    ++ L +A   +++  + +L S++     I + DE A
Sbjct:  634 GFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIA---RKLGYISVLDSLKT----ITKEDETA 795          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 107.457 bits (267), Expect = 5.051e-25
Identity = 60/206 (29.13%), Postives = 106/206 (51.46%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++ +  + + P+H AS  G++ +++LLLER   I+     G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLLI           + E+  D +  ++D++     + LHV   A  C   ++ K ++DK
Sbjct:  176 ALHIAARKDDTKAAALLLQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLI-----------HHEVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLVDK 360          

HSP 2 Score: 93.2041 bits (230), Expect = 3.106e-20
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    I    G   +HIA   G + VA ++++ G+ ++ +    + P+H AS RG   ++ LLLER   I+  T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LL+  +  +D   N   + L +A         ++L+
Sbjct:  193 LQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLV 358          

HSP 3 Score: 81.2629 bits (199), Expect = 2.641e-16
Identity = 42/157 (26.75%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD 669
            ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G   ++K L+     +D K    ++ L ++ +  + D VQ L+    L D
Sbjct:  341 ALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPD 497          

HSP 4 Score: 76.6406 bits (187), Expect = 9.684e-15
Identity = 45/183 (24.59%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             +L+  + GN +    Y+K+     I +  G  ++H+A   G VEV   +I  G+ ++  T  G   +H AS  G  +++  L+    +I  ++ +G  P++ A+   H +++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   15 SYLRAARAGNIEKALDYIKTGVDINICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 193          

HSP 5 Score: 75.0998 bits (183), Expect = 3.016e-14
Identity = 36/149 (24.16%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + R++++ G+ I+  T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LL+     ++   N  +  +H A+  GH ++ K+L+ ++   + K     + L +A +  ++  ++LL+
Sbjct:  243 LHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLL 391          

HSP 6 Score: 68.5514 bits (166), Expect = 3.942e-12
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G   I+T L             G   +H A+  G + ++K L+    +++ +      P+H +S  G   I++ LLQ     D       + L LA +    D   +L+
Sbjct:  371 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILL 523          

HSP 7 Score: 55.4546 bits (132), Expect = 7.059e-8
Identity = 28/124 (22.58%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLL 549
            V + G   IH+A   G   +   + + G++       G   +H A+  G   ++  L+    D++ +      P+H +S  G  +I++ LL+     +     G  P+H A+  GH  +  +LL
Sbjct:  400 VTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILL 523          

HSP 8 Score: 54.299 bits (129), Expect = 1.404e-7
Identity = 23/94 (24.47%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNI 468
            +G  ++H+A   G   V + ++  G++++ +      P+H +S  G  +I+  LL+     +  T SG  P+H A+  GH ++  +LL+   ++
Sbjct:  436 RGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASL 529          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 107.842 bits (268), Expect = 5.264e-25
Identity = 60/206 (29.13%), Postives = 106/206 (51.46%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++ +  + + P+H AS  G++ +++LLLER   I+     G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLLI           + E+  D +  ++D++     + LHV   A  C   ++ K ++DK
Sbjct:  204 ALHIAARKDDTKAAALLLQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLI-----------HHEVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLVDK 388          

HSP 2 Score: 93.2041 bits (230), Expect = 3.388e-20
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    I    G   +HIA   G + VA ++++ G+ ++ +    + P+H AS RG   ++ LLLER   I+  T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LL+  +  +D   N   + L +A         ++L+
Sbjct:  221 LQNDHNADIESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLV 386          

HSP 3 Score: 81.6481 bits (200), Expect = 2.534e-16
Identity = 42/157 (26.75%), Postives = 78/157 (49.68%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD 669
            ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G   ++K L+     +D K    ++ L ++ +  + D VQ L+    L D
Sbjct:  369 ALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPD 525          

HSP 4 Score: 76.6406 bits (187), Expect = 9.766e-15
Identity = 45/183 (24.59%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             +L+  + GN +    Y+K+     I +  G  ++H+A   G VEV   +I  G+ ++  T  G   +H AS  G  +++  L+    +I  ++ +G  P++ A+   H +++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   43 SYLRAARAGNIEKALDYIKTGVDINICNQNGLNALHLASKEGHVEVVTELIKLGATVDAATKKGNTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 221          

HSP 5 Score: 75.0998 bits (183), Expect = 2.878e-14
Identity = 36/149 (24.16%), Postives = 81/149 (54.36%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + R++++ G+ I+  T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LL+     ++   N  +  +H A+  GH ++ K+L+ ++   + K     + L +A +  ++  ++LL+
Sbjct:  271 LHVASKRGNANMVRLLLERGARIDARTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLIHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVLVDKRANPNAKALNGFTPLHIACKKNRIKVMELLL 419          

HSP 6 Score: 68.5514 bits (166), Expect = 3.746e-12
Identity = 38/153 (24.84%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G   I+T L             G   +H A+  G + ++K L+    +++ +      P+H +S  G   I++ LLQ     D       + L LA +    D   +L+
Sbjct:  399 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILL 551          

HSP 7 Score: 55.4546 bits (132), Expect = 6.142e-8
Identity = 28/124 (22.58%), Postives = 54/124 (43.55%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLL 549
            V + G   IH+A   G   +   + + G++       G   +H A+  G   ++  L+    D++ +      P+H +S  G  +I++ LL+     +     G  P+H A+  GH  +  +LL
Sbjct:  428 VTESGLTPIHVAAFMGHENIVTQLTNHGASPNTMNVRGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILL 551          

HSP 8 Score: 54.6842 bits (130), Expect = 1.148e-7
Identity = 23/94 (24.47%), Postives = 49/94 (52.13%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNI 468
            +G  ++H+A   G   V + ++  G++++ +      P+H +S  G  +I+  LL+     +  T SG  P+H A+  GH ++  +LL+   ++
Sbjct:  464 RGETALHMAARAGQANVVKFLVANGADVDAKAKDDQTPLHISSRLGKPDIVQQLLQHGALPDSTTTSGYTPLHLAARDGHKDVASILLDNGASL 557          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 101.679 bits (252), Expect = 1.031e-22
Identity = 60/209 (28.71%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G+  ++KLLL+R   IE +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+      D +             ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  206 ALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDV-------------TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 393          

HSP 2 Score: 92.0485 bits (227), Expect = 1.609e-19
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   IE +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  223 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIV 388          

HSP 3 Score: 85.5001 bits (210), Expect = 1.843e-17
Identity = 46/163 (28.22%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G + +++ LLQ   ++D K    ++ L +A +  +++ VQ L+
Sbjct:  358 NAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLL 520          

HSP 4 Score: 83.1889 bits (204), Expect = 1.055e-16
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G ++V R ++  G+ ++ +       +H AS  G LEI+  LL++       T SG  P+H ++  GH EI  LLLE+  ++     +G  P+H A+  G L++  LLLQ+K   D       + L +A          LL+
Sbjct:  466 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLL 619          

HSP 5 Score: 82.4185 bits (202), Expect = 2.397e-16
Identity = 50/187 (26.74%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G  + V + L+   L       G+  +H++   G  E+A ++++ GS++   T  G  P+H A+  G LE+  LLL++    +    SG+ P+H A+   +  +  LLL++  +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++ Q   +  N+N
Sbjct:  511 GKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKN 697          

HSP 6 Score: 81.6481 bits (200), Expect = 4.006e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS IE +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  273 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 421          

HSP 7 Score: 80.8777 bits (198), Expect = 7.256e-16
Identity = 48/182 (26.37%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN + V  YLK+     I +  G  ++H+A   G VEV   ++  G+N++  T  G   +H AS  G  E++  L+    ++  ++ +G  P++ A+   H ++++ LLE N +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 223          

HSP 8 Score: 73.559 bits (179), Expect = 1.395e-13
Identity = 50/203 (24.63%), Postives = 89/203 (43.84%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q+D V+ L+      D   ++D+ A 
Sbjct:  302 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTAL 504          

HSP 9 Score: 73.559 bits (179), Expect = 1.667e-13
Identity = 34/153 (22.22%), Postives = 76/153 (49.67%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +  ++     +G+ P+H A+    + + ++LL     I+ +   G  P+H A   G++++   LL+ + + + K     + L  A Q      + +L+
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLL 784          

HSP 10 Score: 70.8626 bits (172), Expect = 1.110e-12
Identity = 41/156 (26.28%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +  N+   +  G+ P+H A+      + ++LL     ID +     + L +A     M     L+  Q
Sbjct:  599 GLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQ 754          

HSP 11 Score: 67.781 bits (164), Expect = 1.066e-11
Identity = 35/125 (28.00%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+      +  +LL    +I+ +T SG  P+H A   G+ ++   LLE       +   G  P+H A+  GH  I+ +LLQ
Sbjct:  661 VTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          

HSP 12 Score: 59.3066 bits (142), Expect = 5.337e-9
Identity = 49/236 (20.76%), Postives = 94/236 (39.83%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNE 876
            V + G   IH+A   G   + + +   G++       G   +H A+  G ++++  LL+    ++ +       +H AS  G  EI++ LL++          G  P+H ++  GH +I  LLL++   +        + L +A +  Q++   LL+  +   D   +                     SGL  L +A   +  R+   +LD+      P     T  H  ++KN+
Sbjct:  430 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---------------------SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQ 644          

HSP 13 Score: 59.3066 bits (142), Expect = 5.527e-9
Identity = 36/153 (23.53%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G  ++++ LL+    ++ +       +H AS  G L+I++ LLQ+    +       + L L+ +    +   LL+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLL 553          

HSP 14 Score: 56.6102 bits (135), Expect = 4.354e-8
Identity = 30/112 (26.79%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A       V  ++++ G+ I+ +T  G  P+H A   G +++   LLE       +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  674 QEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 101.679 bits (252), Expect = 1.031e-22
Identity = 60/209 (28.71%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G+  ++KLLL+R   IE +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+      D +             ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  206 ALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDV-------------TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 393          

HSP 2 Score: 92.0485 bits (227), Expect = 1.609e-19
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   IE +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  223 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIV 388          

HSP 3 Score: 85.5001 bits (210), Expect = 1.843e-17
Identity = 46/163 (28.22%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G + +++ LLQ   ++D K    ++ L +A +  +++ VQ L+
Sbjct:  358 NAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLL 520          

HSP 4 Score: 83.1889 bits (204), Expect = 1.055e-16
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G ++V R ++  G+ ++ +       +H AS  G LEI+  LL++       T SG  P+H ++  GH EI  LLLE+  ++     +G  P+H A+  G L++  LLLQ+K   D       + L +A          LL+
Sbjct:  466 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLL 619          

HSP 5 Score: 82.4185 bits (202), Expect = 2.397e-16
Identity = 50/187 (26.74%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G  + V + L+   L       G+  +H++   G  E+A ++++ GS++   T  G  P+H A+  G LE+  LLL++    +    SG+ P+H A+   +  +  LLL++  +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++ Q   +  N+N
Sbjct:  511 GKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKN 697          

HSP 6 Score: 81.6481 bits (200), Expect = 4.006e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS IE +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  273 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 421          

HSP 7 Score: 80.8777 bits (198), Expect = 7.256e-16
Identity = 48/182 (26.37%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN + V  YLK+     I +  G  ++H+A   G VEV   ++  G+N++  T  G   +H AS  G  E++  L+    ++  ++ +G  P++ A+   H ++++ LLE N +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 223          

HSP 8 Score: 73.559 bits (179), Expect = 1.395e-13
Identity = 50/203 (24.63%), Postives = 89/203 (43.84%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q+D V+ L+      D   ++D+ A 
Sbjct:  302 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTAL 504          

HSP 9 Score: 73.559 bits (179), Expect = 1.667e-13
Identity = 34/153 (22.22%), Postives = 76/153 (49.67%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +  ++     +G+ P+H A+    + + ++LL     I+ +   G  P+H A   G++++   LL+ + + + K     + L  A Q      + +L+
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLL 784          

HSP 10 Score: 70.8626 bits (172), Expect = 1.110e-12
Identity = 41/156 (26.28%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +  N+   +  G+ P+H A+      + ++LL     ID +     + L +A     M     L+  Q
Sbjct:  599 GLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQ 754          

HSP 11 Score: 67.781 bits (164), Expect = 1.066e-11
Identity = 35/125 (28.00%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+      +  +LL    +I+ +T SG  P+H A   G+ ++   LLE       +   G  P+H A+  GH  I+ +LLQ
Sbjct:  661 VTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          

HSP 12 Score: 59.3066 bits (142), Expect = 5.337e-9
Identity = 49/236 (20.76%), Postives = 94/236 (39.83%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNE 876
            V + G   IH+A   G   + + +   G++       G   +H A+  G ++++  LL+    ++ +       +H AS  G  EI++ LL++          G  P+H ++  GH +I  LLL++   +        + L +A +  Q++   LL+  +   D   +                     SGL  L +A   +  R+   +LD+      P     T  H  ++KN+
Sbjct:  430 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---------------------SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQ 644          

HSP 13 Score: 59.3066 bits (142), Expect = 5.527e-9
Identity = 36/153 (23.53%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G  ++++ LL+    ++ +       +H AS  G L+I++ LLQ+    +       + L L+ +    +   LL+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLL 553          

HSP 14 Score: 56.6102 bits (135), Expect = 4.354e-8
Identity = 30/112 (26.79%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A       V  ++++ G+ I+ +T  G  P+H A   G +++   LLE       +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  674 QEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQ 785          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 101.679 bits (252), Expect = 1.032e-22
Identity = 60/209 (28.71%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G+  ++KLLL+R   IE +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+      D +             ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  206 ALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDV-------------TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 393          

HSP 2 Score: 92.0485 bits (227), Expect = 1.610e-19
Identity = 47/166 (28.31%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   IE +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  223 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIV 388          

HSP 3 Score: 85.5001 bits (210), Expect = 1.844e-17
Identity = 46/163 (28.22%), Postives = 86/163 (52.76%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G + +++ LLQ   ++D K    ++ L +A +  +++ VQ L+
Sbjct:  358 NAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLL 520          

HSP 4 Score: 83.1889 bits (204), Expect = 1.055e-16
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G ++V R ++  G+ ++ +       +H AS  G LEI+  LL++       T SG  P+H ++  GH EI  LLLE+  ++     +G  P+H A+  G L++  LLLQ+K   D       + L +A          LL+
Sbjct:  466 RGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLL 619          

HSP 5 Score: 82.4185 bits (202), Expect = 2.398e-16
Identity = 50/187 (26.74%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G  + V + L+   L       G+  +H++   G  E+A ++++ GS++   T  G  P+H A+  G LE+  LLL++    +    SG+ P+H A+   +  +  LLL++  +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++ Q   +  N+N
Sbjct:  511 GKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKN 697          

HSP 6 Score: 81.6481 bits (200), Expect = 4.008e-16
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS IE +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  273 LHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 421          

HSP 7 Score: 80.8777 bits (198), Expect = 7.261e-16
Identity = 48/182 (26.37%), Postives = 87/182 (47.80%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN + V  YLK+     I +  G  ++H+A   G VEV   ++  G+N++  T  G   +H AS  G  E++  L+    ++  ++ +G  P++ A+   H ++++ LLE N +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   46 YLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 223          

HSP 8 Score: 73.559 bits (179), Expect = 1.396e-13
Identity = 50/203 (24.63%), Postives = 89/203 (43.84%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q+D V+ L+      D   ++D+ A 
Sbjct:  302 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTAL 504          

HSP 9 Score: 70.8626 bits (172), Expect = 1.111e-12
Identity = 41/156 (26.28%), Postives = 71/156 (45.51%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +  N+   +  G+ P+H A+      + ++LL     ID +     + L +A     M     L+  Q
Sbjct:  599 GLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQ 754          

HSP 10 Score: 69.707 bits (169), Expect = 2.470e-12
Identity = 30/132 (22.73%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNM 585
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +  ++     +G+ P+H A+    + + ++LL     I+ +   G  P+H A   G++++   LL+ + + + K  +
Sbjct:  632 GYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKV 763          

HSP 11 Score: 59.3066 bits (142), Expect = 5.339e-9
Identity = 49/236 (20.76%), Postives = 94/236 (39.83%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNE 876
            V + G   IH+A   G   + + +   G++       G   +H A+  G ++++  LL+    ++ +       +H AS  G  EI++ LL++          G  P+H ++  GH +I  LLL++   +        + L +A +  Q++   LL+  +   D   +                     SGL  L +A   +  R+   +LD+      P     T  H  ++KN+
Sbjct:  430 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGK---------------------SGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQ 644          

HSP 12 Score: 59.3066 bits (142), Expect = 5.530e-9
Identity = 36/153 (23.53%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G  ++++ LL+    ++ +       +H AS  G L+I++ LLQ+    +       + L L+ +    +   LL+
Sbjct:  401 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLL 553          

HSP 13 Score: 50.0618 bits (118), Expect = 4.835e-6
Identity = 32/130 (24.62%), Postives = 59/130 (45.38%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRP-----IHCASSGGHLQILKLLLQ 552
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+      +  +LL    +I+ +T SG  P+H A   G+ ++   LLE       +    +       I  ++  GH  I+ +LLQ
Sbjct:  661 VTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQ 790          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 100.908 bits (250), Expect = 2.309e-22
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++ +LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  188 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 375          

HSP 2 Score: 91.2781 bits (225), Expect = 4.000e-19
Identity = 47/166 (28.31%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++ +LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 83.5741 bits (205), Expect = 1.325e-16
Identity = 41/149 (27.52%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLL 403          

HSP 4 Score: 80.1073 bits (196), Expect = 1.666e-15
Identity = 45/163 (27.61%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  L+++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G  ++++ LLQ   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 5 Score: 78.1814 bits (191), Expect = 7.737e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++    +  T SG  P+H +S  GH ++  +LLE   +      +G  P+H A+  G ++++KLLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.7962 bits (190), Expect = 8.387e-15
Identity = 46/182 (25.27%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VE+   +I  G++++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 7 Score: 76.2554 bits (186), Expect = 2.736e-14
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G AD V + LK           G+  +H++   G  +VA ++++ G++    T  G  P+H A+  G +E++ LLL++N   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL++
Sbjct:  493 GKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLT 668          

HSP 8 Score: 74.3294 bits (181), Expect = 1.185e-13
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+ P+H A+  GH +++ LLL R+ N+   +  G+ P+H A+    + + ++L  +   ID    M  + L +A     +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLL 733          

HSP 9 Score: 72.7886 bits (177), Expect = 4.512e-13
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+ P+H A+  G +++++LLL R+ ++     SG+ P+H A+      + ++L  +   I+        P+H AS  G+++++  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLL 766          

HSP 10 Score: 70.0922 bits (170), Expect = 2.532e-12
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G+  +  TT G  P+H +S  G  ++ ++LLE        T  G  P+H A+  G  E++KLLL++N + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  481 DDQT--PLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLL 634          

HSP 11 Score: 68.5514 bits (166), Expect = 8.843e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L       +  N   E+ L +A ++ Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLL 469          

HSP 12 Score: 67.3958 bits (163), Expect = 1.979e-11
Identity = 64/282 (22.70%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRND------EIAFDKIWKSSDFIRENIY------SGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY-------------PVDIAFQCGHL 951
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L             G   +H A+  G SE+++ LL+    +E +      P+H ++  G   I++ LL++    D       + L L+ +    D   +L+     F  + +           + KI      +++N        SGL  L +A   +  ++   +LDK            T  H  ++KN+ D    I    LEY             PV +A Q GH+
Sbjct:  383 GFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD----IATTLLEYGADANAITKQGIAPVHLAAQEGHV 660          

HSP 13 Score: 63.5438 bits (153), Expect = 3.483e-10
Identity = 31/125 (24.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            +  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +L  +   I+  T     P+H AS  G+ +++  LL+    +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  643 ITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          

HSP 14 Score: 59.3066 bits (142), Expect = 8.145e-9
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A     V VA ++ + G+ I+  T     P+H AS  G ++++T LL+    +  +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  656 QEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 100.908 bits (250), Expect = 2.315e-22
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++ +LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 366          

HSP 2 Score: 91.2781 bits (225), Expect = 4.011e-19
Identity = 47/166 (28.31%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++ +LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  196 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 361          

HSP 3 Score: 83.5741 bits (205), Expect = 1.329e-16
Identity = 41/149 (27.52%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLL 394          

HSP 4 Score: 80.1073 bits (196), Expect = 1.670e-15
Identity = 45/163 (27.61%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  L+++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G  ++++ LLQ   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  331 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLL 493          

HSP 5 Score: 78.1814 bits (191), Expect = 7.755e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++    +  T SG  P+H +S  GH ++  +LLE   +      +G  P+H A+  G ++++KLLLQ+    D       + L +A          LL+
Sbjct:  439 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLL 592          

HSP 6 Score: 77.7962 bits (190), Expect = 8.407e-15
Identity = 46/182 (25.27%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VE+   +I  G++++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   19 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 196          

HSP 7 Score: 76.2554 bits (186), Expect = 2.742e-14
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G AD V + LK           G+  +H++   G  +VA ++++ G++    T  G  P+H A+  G +E++ LLL++N   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL++
Sbjct:  484 GKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLT 659          

HSP 8 Score: 74.3294 bits (181), Expect = 1.188e-13
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+ P+H A+  GH +++ LLL R+ N+   +  G+ P+H A+    + + ++L  +   ID    M  + L +A     +  V  L+
Sbjct:  572 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLL 724          

HSP 9 Score: 72.7886 bits (177), Expect = 4.523e-13
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+ P+H A+  G +++++LLL R+ ++     SG+ P+H A+      + ++L  +   I+        P+H AS  G+++++  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  605 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLL 757          

HSP 10 Score: 70.0922 bits (170), Expect = 2.538e-12
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G+  +  TT G  P+H +S  G  ++ ++LLE        T  G  P+H A+  G  E++KLLL++N + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  472 DDQT--PLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLL 625          

HSP 11 Score: 68.5514 bits (166), Expect = 8.862e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L       +  N   E+ L +A ++ Q + V+ L+
Sbjct:  251 KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLL 460          

HSP 12 Score: 67.3958 bits (163), Expect = 1.983e-11
Identity = 64/282 (22.70%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRND------EIAFDKIWKSSDFIRENIY------SGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY-------------PVDIAFQCGHL 951
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L             G   +H A+  G SE+++ LL+    +E +      P+H ++  G   I++ LL++    D       + L L+ +    D   +L+     F  + +           + KI      +++N        SGL  L +A   +  ++   +LDK            T  H  ++KN+ D    I    LEY             PV +A Q GH+
Sbjct:  374 GFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD----IATTLLEYGADANAITKQGIAPVHLAAQEGHV 651          

HSP 13 Score: 63.5438 bits (153), Expect = 3.490e-10
Identity = 31/125 (24.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            +  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +L  +   I+  T     P+H AS  G+ +++  LL+    +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  634 ITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 14 Score: 59.3066 bits (142), Expect = 8.160e-9
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A     V VA ++ + G+ I+  T     P+H AS  G ++++T LL+    +  +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  647 QEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 100.908 bits (250), Expect = 2.319e-22
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++ +LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 366          

HSP 2 Score: 91.2781 bits (225), Expect = 4.017e-19
Identity = 47/166 (28.31%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++ +LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  196 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 361          

HSP 3 Score: 83.5741 bits (205), Expect = 1.331e-16
Identity = 41/149 (27.52%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLL 394          

HSP 4 Score: 80.1073 bits (196), Expect = 1.673e-15
Identity = 45/163 (27.61%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  L+++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G  ++++ LLQ   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  331 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLL 493          

HSP 5 Score: 78.1814 bits (191), Expect = 7.767e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++    +  T SG  P+H +S  GH ++  +LLE   +      +G  P+H A+  G ++++KLLLQ+    D       + L +A          LL+
Sbjct:  439 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLL 592          

HSP 6 Score: 77.7962 bits (190), Expect = 8.419e-15
Identity = 46/182 (25.27%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VE+   +I  G++++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   19 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 196          

HSP 7 Score: 76.2554 bits (186), Expect = 2.746e-14
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G AD V + LK           G+  +H++   G  +VA ++++ G++    T  G  P+H A+  G +E++ LLL++N   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL++
Sbjct:  484 GKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLT 659          

HSP 8 Score: 74.3294 bits (181), Expect = 1.189e-13
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+ P+H A+  GH +++ LLL R+ N+   +  G+ P+H A+    + + ++L  +   ID    M  + L +A     +  V  L+
Sbjct:  572 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLL 724          

HSP 9 Score: 72.7886 bits (177), Expect = 4.529e-13
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+ P+H A+  G +++++LLL R+ ++     SG+ P+H A+      + ++L  +   I+        P+H AS  G+++++  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  605 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLL 757          

HSP 10 Score: 70.0922 bits (170), Expect = 2.542e-12
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G+  +  TT G  P+H +S  G  ++ ++LLE        T  G  P+H A+  G  E++KLLL++N + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  472 DDQT--PLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLL 625          

HSP 11 Score: 68.5514 bits (166), Expect = 8.874e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L       +  N   E+ L +A ++ Q + V+ L+
Sbjct:  251 KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLL 460          

HSP 12 Score: 67.3958 bits (163), Expect = 1.986e-11
Identity = 64/282 (22.70%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRND------EIAFDKIWKSSDFIRENIY------SGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY-------------PVDIAFQCGHL 951
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L             G   +H A+  G SE+++ LL+    +E +      P+H ++  G   I++ LL++    D       + L L+ +    D   +L+     F  + +           + KI      +++N        SGL  L +A   +  ++   +LDK            T  H  ++KN+ D    I    LEY             PV +A Q GH+
Sbjct:  374 GFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD----IATTLLEYGADANAITKQGIAPVHLAAQEGHV 651          

HSP 13 Score: 63.5438 bits (153), Expect = 3.495e-10
Identity = 31/125 (24.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            +  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +L  +   I+  T     P+H AS  G+ +++  LL+    +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  634 ITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 14 Score: 59.3066 bits (142), Expect = 8.170e-9
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A     V VA ++ + G+ I+  T     P+H AS  G ++++T LL+    +  +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  647 QEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 100.908 bits (250), Expect = 2.319e-22
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++ +LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  188 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 375          

HSP 2 Score: 91.2781 bits (225), Expect = 4.018e-19
Identity = 47/166 (28.31%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++ +LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 83.5741 bits (205), Expect = 1.331e-16
Identity = 41/149 (27.52%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLL 403          

HSP 4 Score: 80.1073 bits (196), Expect = 1.673e-15
Identity = 45/163 (27.61%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  L+++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G  ++++ LLQ   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 5 Score: 78.1814 bits (191), Expect = 7.768e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++    +  T SG  P+H +S  GH ++  +LLE   +      +G  P+H A+  G ++++KLLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.7962 bits (190), Expect = 8.421e-15
Identity = 46/182 (25.27%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VE+   +I  G++++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 7 Score: 76.2554 bits (186), Expect = 2.747e-14
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G AD V + LK           G+  +H++   G  +VA ++++ G++    T  G  P+H A+  G +E++ LLL++N   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL++
Sbjct:  493 GKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLT 668          

HSP 8 Score: 74.3294 bits (181), Expect = 1.189e-13
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+ P+H A+  GH +++ LLL R+ N+   +  G+ P+H A+    + + ++L  +   ID    M  + L +A     +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLL 733          

HSP 9 Score: 72.7886 bits (177), Expect = 4.530e-13
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+ P+H A+  G +++++LLL R+ ++     SG+ P+H A+      + ++L  +   I+        P+H AS  G+++++  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLL 766          

HSP 10 Score: 70.0922 bits (170), Expect = 2.542e-12
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G+  +  TT G  P+H +S  G  ++ ++LLE        T  G  P+H A+  G  E++KLLL++N + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  481 DDQT--PLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLL 634          

HSP 11 Score: 68.5514 bits (166), Expect = 8.875e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L       +  N   E+ L +A ++ Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLL 469          

HSP 12 Score: 67.3958 bits (163), Expect = 1.986e-11
Identity = 64/282 (22.70%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRND------EIAFDKIWKSSDFIRENIY------SGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY-------------PVDIAFQCGHL 951
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L             G   +H A+  G SE+++ LL+    +E +      P+H ++  G   I++ LL++    D       + L L+ +    D   +L+     F  + +           + KI      +++N        SGL  L +A   +  ++   +LDK            T  H  ++KN+ D    I    LEY             PV +A Q GH+
Sbjct:  383 GFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD----IATTLLEYGADANAITKQGIAPVHLAAQEGHV 660          

HSP 13 Score: 63.5438 bits (153), Expect = 3.495e-10
Identity = 31/125 (24.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            +  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +L  +   I+  T     P+H AS  G+ +++  LL+    +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  643 ITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          

HSP 14 Score: 59.3066 bits (142), Expect = 8.171e-9
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A     V VA ++ + G+ I+  T     P+H AS  G ++++T LL+    +  +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  656 QEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 767          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 100.908 bits (250), Expect = 2.328e-22
Identity = 59/209 (28.23%), Postives = 104/209 (49.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++ +LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  179 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 366          

HSP 2 Score: 91.2781 bits (225), Expect = 4.032e-19
Identity = 47/166 (28.31%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++ +LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  196 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 361          

HSP 3 Score: 83.5741 bits (205), Expect = 1.335e-16
Identity = 41/149 (27.52%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D GS I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  246 LHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLL 394          

HSP 4 Score: 80.1073 bits (196), Expect = 1.678e-15
Identity = 45/163 (27.61%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  L+++ LLL+    I+  T SG+ PIH A+  GH  I+  L     +    + RG   +H A+  G  ++++ LLQ   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  331 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLL 493          

HSP 5 Score: 78.1814 bits (191), Expect = 7.793e-15
Identity = 41/154 (26.62%), Postives = 75/154 (48.70%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++    +  T SG  P+H +S  GH ++  +LLE   +      +G  P+H A+  G ++++KLLLQ+    D       + L +A          LL+
Sbjct:  439 RGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLL 592          

HSP 6 Score: 77.7962 bits (190), Expect = 8.448e-15
Identity = 46/182 (25.27%), Postives = 86/182 (47.25%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VE+   +I  G++++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   19 YLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 196          

HSP 7 Score: 76.2554 bits (186), Expect = 2.755e-14
Identity = 45/176 (25.57%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G AD V + LK           G+  +H++   G  +VA ++++ G++    T  G  P+H A+  G +E++ LLL++N   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL++
Sbjct:  484 GKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLT 659          

HSP 8 Score: 74.3294 bits (181), Expect = 1.193e-13
Identity = 41/153 (26.80%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+ P+H A+  GH +++ LLL R+ N+   +  G+ P+H A+    + + ++L  +   ID    M  + L +A     +  V  L+
Sbjct:  572 GLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLL 724          

HSP 9 Score: 72.7886 bits (177), Expect = 4.543e-13
Identity = 36/153 (23.53%), Postives = 78/153 (50.98%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+ P+H A+  G +++++LLL R+ ++     SG+ P+H A+      + ++L  +   I+        P+H AS  G+++++  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  605 GYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLL 757          

HSP 10 Score: 70.0922 bits (170), Expect = 2.549e-12
Identity = 42/156 (26.92%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G+  +  TT G  P+H +S  G  ++ ++LLE        T  G  P+H A+  G  E++KLLL++N + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  472 DDQT--PLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLL 625          

HSP 11 Score: 68.5514 bits (166), Expect = 8.901e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L       +  N   E+ L +A ++ Q + V+ L+
Sbjct:  251 KRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLL 460          

HSP 12 Score: 67.3958 bits (163), Expect = 1.992e-11
Identity = 64/282 (22.70%), Postives = 114/282 (40.43%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRND------EIAFDKIWKSSDFIRENIY------SGLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY-------------PVDIAFQCGHL 951
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L             G   +H A+  G SE+++ LL+    +E +      P+H ++  G   I++ LL++    D       + L L+ +    D   +L+     F  + +           + KI      +++N        SGL  L +A   +  ++   +LDK            T  H  ++KN+ D    I    LEY             PV +A Q GH+
Sbjct:  374 GFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMD----IATTLLEYGADANAITKQGIAPVHLAAQEGHV 651          

HSP 13 Score: 63.5438 bits (153), Expect = 3.504e-10
Identity = 31/125 (24.80%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            +  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +L  +   I+  T     P+H AS  G+ +++  LL+    +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  634 ITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          

HSP 14 Score: 59.3066 bits (142), Expect = 8.192e-9
Identity = 32/112 (28.57%), Postives = 58/112 (51.79%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EG+ D V   L       + +  G   +H+A     V VA ++ + G+ I+  T     P+H AS  G ++++T LL+    +  +T +G  P+H A+  GH+ I+ +LL+
Sbjct:  647 QEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 758          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Match: Ank2 (ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025])

HSP 1 Score: 105.916 bits (263), Expect = 1.556e-24
Identity = 59/209 (28.23%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + ++  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ ++KLLL+R   I+ +   G+ P+HCA+  GH Q+++LLL+RK  +  +     S L +A Q   ++C      V+ L  +    D++  D +            + LHV   A  C   R+ K +LDK  +
Sbjct:  207 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVEC------VKHLLQYKAPVDDVTLDYL------------TALHV---AAHCGHYRVTKLLLDKRAN 394          

HSP 2 Score: 98.9821 bits (245), Expect = 3.201e-22
Identity = 47/140 (33.57%), Postives = 80/140 (57.14%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G V VA ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH ++++LLLER   +      G+ P+H A+ G H++ +K LLQ K  +D
Sbjct:  224 LQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 363          

HSP 3 Score: 83.1889 bits (204), Expect = 6.885e-17
Identity = 64/254 (25.20%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFI---------NRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
             FL+  + GN D V +YLK        +  G  ++H+A   G V + + ++  GS+++  T  G   +H AS  G  E++ +L++   +I  ++ +G  P++ A+   H +++K LLE   N       G  P+  A   GH Q + +LL+     D K  +    L +A +        LL+       VQ    F          N N          + DF   N  + LHV       N   +VK +LD+
Sbjct:   46 SFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTN---MVKLLLDR 292          

HSP 4 Score: 78.5666 bits (192), Expect = 2.340e-15
Identity = 41/153 (26.80%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A   G   + ++++D G  I+ +T  G+ P+H A+  G  +++ LLLER   +   T +G+ P+H A+ G H E +K LL+    ++      +  +H A+  GH ++ KLLL ++   + +     + L +A +  ++  ++LL+
Sbjct:  270 GITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLV 422          

HSP 5 Score: 55.8398 bits (133), Expect = 4.310e-8
Identity = 26/94 (27.66%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECED 480
            ++H+A   G   V ++++D  +N       G  P+H A  +  ++++ LL++    I+  T SG+ PIH A+  GH  I+ LLL+   + +  +
Sbjct:  372 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTN 465          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 103.219 bits (256), Expect = 3.603e-23
Identity = 59/206 (28.64%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDK 372          

HSP 2 Score: 90.1225 bits (222), Expect = 6.530e-19
Identity = 46/166 (27.71%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R+  I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 82.0333 bits (201), Expect = 2.670e-16
Identity = 40/149 (26.85%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R+  I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 78.9518 bits (193), Expect = 2.696e-15
Identity = 48/187 (25.67%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H+A   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 679          

HSP 5 Score: 77.411 bits (189), Expect = 9.050e-15
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H A+  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.411 bits (189), Expect = 9.381e-15
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 7 Score: 77.0258 bits (188), Expect = 1.307e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 8 Score: 76.6406 bits (187), Expect = 1.535e-14
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  ++   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 9 Score: 71.633 bits (174), Expect = 7.190e-13
Identity = 43/182 (23.63%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 10 Score: 68.5514 bits (166), Expect = 7.165e-12
Identity = 52/210 (24.76%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  +             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 469          

HSP 11 Score: 67.781 bits (164), Expect = 1.343e-11
Identity = 31/125 (24.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G   +H A+  GH  I+ +LLQ
Sbjct:  643 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 12 Score: 65.0846 bits (157), Expect = 9.058e-11
Identity = 36/153 (23.53%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L LA +    D    L+
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 535          

HSP 13 Score: 62.7734 bits (151), Expect = 4.269e-10
Identity = 30/116 (25.86%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G   +H A+  GH+ I+ +LL+ N +
Sbjct:  656 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNAS 771          

HSP 14 Score: 58.5362 bits (140), Expect = 1.078e-8
Identity = 33/157 (21.02%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H A+  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 568          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 103.219 bits (256), Expect = 3.616e-23
Identity = 59/206 (28.64%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK
Sbjct:  199 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDK 383          

HSP 2 Score: 90.1225 bits (222), Expect = 6.552e-19
Identity = 46/166 (27.71%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R+  I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  216 LQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 381          

HSP 3 Score: 82.0333 bits (201), Expect = 2.678e-16
Identity = 40/149 (26.85%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R+  I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  266 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 414          

HSP 4 Score: 78.9518 bits (193), Expect = 2.704e-15
Identity = 48/187 (25.67%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H+A   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  504 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 690          

HSP 5 Score: 77.411 bits (189), Expect = 9.079e-15
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H A+  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  459 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 612          

HSP 6 Score: 77.411 bits (189), Expect = 9.410e-15
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  625 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 777          

HSP 7 Score: 77.0258 bits (188), Expect = 1.311e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  592 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 744          

HSP 8 Score: 76.6406 bits (187), Expect = 1.540e-14
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  ++   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  351 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 513          

HSP 9 Score: 71.633 bits (174), Expect = 7.211e-13
Identity = 43/182 (23.63%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   39 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 216          

HSP 10 Score: 68.5514 bits (166), Expect = 7.185e-12
Identity = 52/210 (24.76%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  +             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  271 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 480          

HSP 11 Score: 67.781 bits (164), Expect = 1.347e-11
Identity = 31/125 (24.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G   +H A+  GH  I+ +LLQ
Sbjct:  654 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 778          

HSP 12 Score: 65.0846 bits (157), Expect = 9.082e-11
Identity = 36/153 (23.53%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L LA +    D    L+
Sbjct:  394 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 546          

HSP 13 Score: 62.7734 bits (151), Expect = 4.280e-10
Identity = 30/116 (25.86%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G   +H A+  GH+ I+ +LL+ N +
Sbjct:  667 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNAS 782          

HSP 14 Score: 58.5362 bits (140), Expect = 1.081e-8
Identity = 33/157 (21.02%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H A+  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  423 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 579          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 103.219 bits (256), Expect = 3.636e-23
Identity = 59/206 (28.64%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDK 372          

HSP 2 Score: 90.1225 bits (222), Expect = 6.585e-19
Identity = 46/166 (27.71%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R+  I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 82.0333 bits (201), Expect = 2.691e-16
Identity = 40/149 (26.85%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R+  I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 78.9518 bits (193), Expect = 2.717e-15
Identity = 48/187 (25.67%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H+A   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 679          

HSP 5 Score: 77.411 bits (189), Expect = 9.120e-15
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H A+  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.411 bits (189), Expect = 9.453e-15
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 7 Score: 77.0258 bits (188), Expect = 1.317e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 8 Score: 76.6406 bits (187), Expect = 1.547e-14
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  ++   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 9 Score: 71.633 bits (174), Expect = 7.242e-13
Identity = 43/182 (23.63%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 10 Score: 68.5514 bits (166), Expect = 7.215e-12
Identity = 52/210 (24.76%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  +             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 469          

HSP 11 Score: 67.781 bits (164), Expect = 1.353e-11
Identity = 31/125 (24.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G   +H A+  GH  I+ +LLQ
Sbjct:  643 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 12 Score: 65.0846 bits (157), Expect = 9.118e-11
Identity = 36/153 (23.53%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L LA +    D    L+
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 535          

HSP 13 Score: 62.7734 bits (151), Expect = 4.297e-10
Identity = 30/116 (25.86%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G   +H A+  GH+ I+ +LL+ N +
Sbjct:  656 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNAS 771          

HSP 14 Score: 58.5362 bits (140), Expect = 1.085e-8
Identity = 33/157 (21.02%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H A+  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 568          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 103.219 bits (256), Expect = 3.677e-23
Identity = 59/206 (28.64%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDK 372          

HSP 2 Score: 90.1225 bits (222), Expect = 6.655e-19
Identity = 46/166 (27.71%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R+  I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 82.0333 bits (201), Expect = 2.718e-16
Identity = 40/149 (26.85%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R+  I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 78.9518 bits (193), Expect = 2.744e-15
Identity = 48/187 (25.67%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H+A   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 679          

HSP 5 Score: 77.411 bits (189), Expect = 9.210e-15
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H A+  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.411 bits (189), Expect = 9.546e-15
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 7 Score: 77.0258 bits (188), Expect = 1.330e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 8 Score: 76.6406 bits (187), Expect = 1.562e-14
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  ++   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 9 Score: 71.633 bits (174), Expect = 7.309e-13
Identity = 43/182 (23.63%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 10 Score: 68.5514 bits (166), Expect = 7.279e-12
Identity = 52/210 (24.76%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  +             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 469          

HSP 11 Score: 67.781 bits (164), Expect = 1.365e-11
Identity = 31/125 (24.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G   +H A+  GH  I+ +LLQ
Sbjct:  643 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 12 Score: 65.0846 bits (157), Expect = 9.196e-11
Identity = 36/153 (23.53%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L LA +    D    L+
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 535          

HSP 13 Score: 62.7734 bits (151), Expect = 4.332e-10
Identity = 30/116 (25.86%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G   +H A+  GH+ I+ +LL+ N +
Sbjct:  656 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNAS 771          

HSP 14 Score: 58.5362 bits (140), Expect = 1.093e-8
Identity = 33/157 (21.02%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H A+  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 568          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.581e-22
Identity = 59/206 (28.64%), Postives = 105/206 (50.97%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK
Sbjct:  188 ALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDK 372          

HSP 2 Score: 90.1225 bits (222), Expect = 4.671e-18
Identity = 46/166 (27.71%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R+  I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  205 LQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 370          

HSP 3 Score: 82.0333 bits (201), Expect = 1.907e-15
Identity = 40/149 (26.85%), Postives = 85/149 (57.05%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R+  I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  255 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 78.9518 bits (193), Expect = 1.925e-14
Identity = 48/187 (25.67%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H+A   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  493 GKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 679          

HSP 5 Score: 77.411 bits (189), Expect = 6.462e-14
Identity = 40/154 (25.97%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H A+  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  448 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 601          

HSP 6 Score: 77.411 bits (189), Expect = 6.697e-14
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  614 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLL 766          

HSP 7 Score: 77.0258 bits (188), Expect = 9.329e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  581 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 733          

HSP 8 Score: 76.6406 bits (187), Expect = 1.096e-13
Identity = 42/163 (25.77%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  ++   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  340 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 502          

HSP 9 Score: 71.633 bits (174), Expect = 5.127e-12
Identity = 43/182 (23.63%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   28 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 205          

HSP 10 Score: 68.5514 bits (166), Expect = 5.106e-11
Identity = 52/210 (24.76%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  +             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  260 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 469          

HSP 11 Score: 67.781 bits (164), Expect = 9.572e-11
Identity = 31/125 (24.80%), Postives = 63/125 (50.40%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G   +H A+  GH  I+ +LLQ
Sbjct:  643 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQ 767          

HSP 12 Score: 65.0846 bits (157), Expect = 6.450e-10
Identity = 36/153 (23.53%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L LA +    D    L+
Sbjct:  383 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLL 535          

HSP 13 Score: 62.7734 bits (151), Expect = 3.038e-9
Identity = 30/116 (25.86%), Postives = 62/116 (53.45%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G   +H A+  GH+ I+ +LL+ N +
Sbjct:  656 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNAS 771          

HSP 14 Score: 58.5362 bits (140), Expect = 7.664e-8
Identity = 33/157 (21.02%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H A+  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  412 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 568          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 102.834 bits (255), Expect = 3.791e-22
Identity = 59/209 (28.23%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  205 ALHIAARKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 392          

HSP 2 Score: 88.9669 bits (219), Expect = 1.321e-17
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  222 LQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 387          

HSP 3 Score: 81.6481 bits (200), Expect = 2.736e-15
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  272 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 420          

HSP 4 Score: 79.337 bits (194), Expect = 1.856e-14
Identity = 43/163 (26.38%), Postives = 85/163 (52.15%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  357 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 519          

HSP 5 Score: 76.6406 bits (187), Expect = 1.262e-13
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  631 GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 783          

HSP 6 Score: 76.6406 bits (187), Expect = 1.273e-13
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  598 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 750          

HSP 7 Score: 76.2554 bits (186), Expect = 1.665e-13
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H ++  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  465 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 618          

HSP 8 Score: 76.2554 bits (186), Expect = 1.854e-13
Identity = 45/175 (25.71%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G AD V + L+           G+  +H++   G  +VA  ++D G+++   T  G  P+H A+  G LE+  LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+
Sbjct:  510 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLL 684          

HSP 9 Score: 72.4034 bits (176), Expect = 2.940e-12
Identity = 44/182 (24.18%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E++K LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 222          

HSP 10 Score: 70.8626 bits (172), Expect = 1.002e-11
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  277 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 486          

HSP 11 Score: 70.4774 bits (171), Expect = 1.144e-11
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  660 VTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 784          

HSP 12 Score: 65.855 bits (159), Expect = 3.967e-10
Identity = 31/116 (26.72%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G  P+H A+  GH+ I+ +LL+ N +
Sbjct:  673 QEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 788          

HSP 13 Score: 65.4698 bits (158), Expect = 5.497e-10
Identity = 38/156 (24.36%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  ++ + ++  G++    TT G  P+H ++  G  ++   LL+    +   T  G  P+H A+  G  E+  LLL+++ + +     G+ P+H A+   + ++  LLL +            + L +A +  QMD    L+
Sbjct:  498 DDQT--PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLL 651          

HSP 14 Score: 64.3142 bits (155), Expect = 1.246e-9
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L L+ +    D    L+
Sbjct:  400 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 552          

HSP 15 Score: 57.3806 bits (137), Expect = 1.854e-7
Identity = 32/157 (20.38%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H ++  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  429 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLL 585          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Match: sp|Q54KA7|SECG_DICDI (Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.129e-20
Identity = 51/179 (28.49%), Postives = 90/179 (50.28%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIW 711
            I D++G   +H A   G    A++++D G+ I    + G  P+H A+  G  + L  L+    ++E + + G  P+H A+  GHS+  ++LL++  N+   D     P+H AS+ G    + +L+Q K RID KN   ++ L  AI+    D  ++LI      D ++    + F K +
Sbjct:  363 IKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKNFAGKTPLVYAIKKNHSDVARVLIRAGADLDQVSLRSSVDFTKTF 541          

HSP 2 Score: 77.411 bits (189), Expect = 5.661e-14
Identity = 44/166 (26.51%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFIN 678
            D +   S+H+A   G +++  ++I   + I  +   G  P+H AS  G      LL+++   I    + G  P+H A+  G S+ L  L+     +E +D++G  P+H A+  GH    ++LL++   ++  +  S + L LA  +   D V +LI  +   D  N
Sbjct:  332 DSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILLKKGANVNAVDTHSSTPLHLASAAGARDTVDVLIQFKARIDAKN 497          

HSP 3 Score: 75.8702 bits (185), Expect = 1.737e-13
Identity = 44/159 (27.67%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGS-NIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            I D  G+  +  A   G +E  +++++ G  ++  +      P+H AS     E +  LL    D    T +G  P+H+AS+GG+ + ++LL++ +  +   DN  + P+H AS  GH   + LLL++  ++D ++    S L  A  +  +DCV+ L+
Sbjct:   97 IKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLV 255          

HSP 4 Score: 71.633 bits (174), Expect = 4.336e-12
Identity = 43/159 (27.04%), Postives = 77/159 (48.43%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSN-IECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +VD+ G   +H A   G  EV   ++      I+C  +     +H A+  G L+++ LL+     I  +   G  P+H AS  GHS   KLL+++   I   D++G  P+H A+  G  + L  L++    ++ K++   + L  A  +   DC ++L+
Sbjct:  296 MVDEMGETPLHKAAFNGHKEVCEYLLYLDPTMIDCRDSRQSTSLHLAAFNGLLDMVDLLIRYKAQINIKDEEGATPLHKASFNGHSSCAKLLVDKGAPICIVDSQGATPLHKAAFNGRSKCLATLIRSGAELEVKDSQGGTPLHNAAYNGHSDCCRILL 454          

HSP 5 Score: 70.0922 bits (170), Expect = 1.456e-11
Identity = 36/131 (27.48%), Postives = 70/131 (53.44%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDC 573
            DD+    +H A +    E    +++  ++    TT G  P+H+AS+ G  + + LL++ +  +    N  + P+H AS  GHS  + LLL++   ++  D  G+ P+H A+S G++  ++ L++    I+C
Sbjct:  133 DDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINC 263          

HSP 6 Score: 68.9366 bits (167), Expect = 3.478e-11
Identity = 40/144 (27.78%), Postives = 71/144 (49.31%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELA 609
            V   G   +H A  GG  +   ++I   S +       + P+H AS  G    ++LLL++   ++     G+ P+H A+S G+ + ++ L+    NI C D  G+ P+H     G+LQ+ K L++   +I+  + M E+ L  A
Sbjct:  165 VTTNGETPLHHASAGGNPQCVELLIKADSKVNAVDNDCITPLHQASFSGHSSCVSLLLKKGAKVDPRDIHGISPLHNAASAGYVDCVEQLVRNGENINCVDIEGVTPLHHTCFNGNLQLTKRLIELGAKINMVDEMGETPLHKA 308          

HSP 7 Score: 57.7658 bits (138), Expect = 1.006e-7
Identity = 38/152 (25.00%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  199 SIHIACMGGFVE-VARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLER-NCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            S+H     G +E ++ ++ +  ++ +   +    P+H+A+  G    +  LL++  +   + ++G  P+ +ASS GH E +KLL+E+   ++  +D++   P+H AS     + +  LL  K          E+ L  A       CV+LLI
Sbjct:   38 SVHYYSSTGDIEKLSNLLNNSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLNGKADPRAVTTNGETPLHHASAGGNPQCVELLI 189          

HSP 8 Score: 56.9954 bits (136), Expect = 1.779e-7
Identity = 38/122 (31.15%), Postives = 67/122 (54.92%), Query Frame = 1
Query:  295 RP-IHYASSRGCLEILTLLLERNCDIECETNSGMR-PIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQR-KCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            RP +HY SS G +E L+ LL  +       +S  R P+H+A+  G +  +  LL++  N   +D+ G  P+  ASS GHL+ +KLL+++    ++ K++ + + L  A      +CV  L++
Sbjct:   36 RPSVHYYSSTGDIEKLSNLLNNSATSPDTPDSEKRTPLHHAAFCGSAACVNFLLDKKANANIKDSAGNTPLQWASSRGHLECIKLLVEKGGVDVNTKDDKNGTPLHKASLFASAECVLYLLN 157          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 96.6709 bits (239), Expect = 3.306e-20
Identity = 60/217 (27.65%), Postives = 106/217 (48.85%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECE--------TTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++   +N + E        T  G  P+H A+  G + + TLLL R   ++    + + P+H AS  G++ ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+              +  D +  ++D++     + LHV   A  C   ++ K +LDK  +
Sbjct:  205 ALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHNVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVLLDKKAN 400          

HSP 2 Score: 88.9669 bits (219), Expect = 1.321e-17
Identity = 44/155 (28.39%), Postives = 82/155 (52.90%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + G   +HIA   G + VA ++++  + ++      + P+H AS RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++L+
Sbjct:  241 ESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLL 395          

HSP 3 Score: 81.6481 bits (200), Expect = 3.464e-15
Identity = 40/149 (26.85%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ N  ++   N  +  +H A+  GH ++ K+LL +K   + K     + L +A +  ++  ++LL+
Sbjct:  280 LHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLL 428          

HSP 4 Score: 78.9518 bits (193), Expect = 2.349e-14
Identity = 43/163 (26.38%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  169 NTIVDDQGH---YSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N  VDD  +    ++H+A   G  +VA++++D  +N   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  ++++ L+Q   +++ K    ++ L ++ +  + D VQ L+
Sbjct:  365 NVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLL 527          

HSP 5 Score: 77.7962 bits (190), Expect = 4.813e-14
Identity = 47/187 (25.13%), Postives = 88/187 (47.06%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G AD V + L+           G+  +H++   G  +VA  ++D G+++   T  G  P+H A+  G LE+ +LLL+++   +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    + I   LL+     +       + + LA Q   +D V LL+S     +  N++
Sbjct:  518 GKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKS 704          

HSP 6 Score: 77.0258 bits (188), Expect = 9.677e-14
Identity = 39/153 (25.49%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T LLE   D    T  G+  +H A+  GH +++ LLL RN N+   +  G+ P+H A+    + + ++L+ +   +D +  M  + L +      +  V  L+
Sbjct:  606 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL 758          

HSP 7 Score: 77.0258 bits (188), Expect = 1.087e-13
Identity = 35/153 (22.88%), Postives = 79/153 (51.63%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A  +++ G++    T  G+  +H A+  G +++++LLL RN ++     SG+ P+H A+      + ++L+ +  +++ +   G  P+H     G+++I+  LLQ   +++ K     + L  A Q      + +L+
Sbjct:  639 GYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLL 791          

HSP 8 Score: 76.2554 bits (186), Expect = 1.612e-13
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV R ++  G+ +E +      P+H ++  G  +I+  LL++       T SG  P+H ++  GH ++   LL+   ++     +G  P+H A+  G L++  LLLQ+    D       + L +A          LL+
Sbjct:  473 RGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLL 626          

HSP 9 Score: 72.4034 bits (176), Expect = 3.198e-12
Identity = 59/261 (22.61%), Postives = 109/261 (41.76%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDF-----INRNDEIAFDKIWKSS------------------DFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            +L+  + G+ +    Y+K+     I +  G  ++H+A   G VEV   ++   +N++  T  G   +H AS  G  E++ +L+    ++  ++ +G  P++ A+   H E+++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+      D      +NR  E  F  +  ++                  DF   N  + LHV       N   +VK +LD+
Sbjct:   45 YLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNAN---MVKLLLDR 298          

HSP 10 Score: 70.8626 bits (172), Expect = 7.919e-12
Identity = 32/125 (25.60%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            V  QG  S+H+A   G V++  +++   +N+      G+ P+H A+    + +  +L+ +   ++ +T  G  P+H     G+ +I+  LL+ +  +  +   G  P+H A+  GH  I+ +LLQ
Sbjct:  668 VTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQ 792          

HSP 11 Score: 70.8626 bits (172), Expect = 9.627e-12
Identity = 53/210 (25.24%), Postives = 89/210 (42.38%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            K GNA+ V   L            G   +H     G  +V  +++D  + I  +T  G+ P+H A+    L  + LLL+ N  ++  TN  +  +H A+  GH ++ K+LL++  N             I C+ NR                    G+ PIH A+  GH+ I+  L+      +  N   E+ L +A +S Q + V+ L+
Sbjct:  285 KRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLV 494          

HSP 12 Score: 66.2402 bits (160), Expect = 2.547e-10
Identity = 31/116 (26.72%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G++++ +T  G  P+H     G ++I+  LL+ +  +  +T +G  P+H A+  GH+ I+ +LL+ N +
Sbjct:  681 QEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNAS 796          

HSP 13 Score: 63.929 bits (154), Expect = 1.579e-9
Identity = 35/153 (22.88%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++I+  T  G+ PIH A+  G + I++ L+            G   +H A+  G +E+++ L++    +E +      P+H ++  G   I++ LLQ+    +       + L L+ +    D    L+
Sbjct:  408 GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLL 560          

HSP 14 Score: 57.3806 bits (137), Expect = 1.858e-7
Identity = 32/157 (20.38%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G V +   ++  G++       G   +H A+  G  E++  L++    +E +      P+H ++  G ++I++ LL++  +       G  P+H ++  GH  +   LL     +        + L +A +  +++   LL+
Sbjct:  437 VTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLL 593          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 96.2857 bits (238), Expect = 4.480e-20
Identity = 60/214 (28.04%), Postives = 105/214 (49.07%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECE--------TTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++    N + +        T  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ ++KLLL+R   I+ +   G+ P+HCA+  GH Q+++LLL+RK  +  +     S L +A Q   ++CV+ L+  +         D++  D +            + LHV   A  C   R+ K +LDK
Sbjct:  195 ALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPV------DDVTLDYL------------TALHV---AAHCGHYRVTKLLLDK 387          

HSP 2 Score: 95.9005 bits (237), Expect = 7.341e-20
Identity = 49/148 (33.11%), Postives = 83/148 (56.08%), Query Frame = 1
Query:  127 NADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            NAD     ++S  +     + G   +HIA   G V VA ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH ++++LLLER   +      G+ P+H A+ G H++ +K LLQ K  +D
Sbjct:  217 NAD-----VQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVD 359          

HSP 3 Score: 79.7221 bits (195), Expect = 1.252e-14
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDE 690
            +H+A   G   + ++++D G  I+ +T  G+ P+H A+  G  +++ LLLER   +   T +G+ P+H A+ G                                 GH  + KLLL++  N             I C+ NR                    G+ PIH A+  GHL I+ LLLQ     D  N   E+ L +A ++ Q++ V+ L+    L D   R ++
Sbjct:  270 LHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQ 498          

HSP 4 Score: 79.337 bits (194), Expect = 1.539e-14
Identity = 40/150 (26.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G   V ++++D  +N       G  P+H A  +  ++++ LL++    I+  T SG+ PIH A+  GH  I+ LLL+   + +  + RG   +H A+  G +++++ LL+    +D +    ++ L +A +  + + VQLL+
Sbjct:  368 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLL 517          

HSP 5 Score: 78.5666 bits (192), Expect = 3.359e-14
Identity = 54/218 (24.77%), Postives = 98/218 (44.95%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD-----FINRNDEIAFDKIWKSSDFIRENI 741
            FL+  + GN D V +YLK        +  G  ++H+A   G V + + ++  GS+++  T  G   +H AS  G  E++ +L++   +I  ++ +G  P++ A+   H +++K LLE   N       G  P+  A   GH Q + +LL+     D K  +    L +A +        LL+      D      +NR  E  F  +  ++ +   N+
Sbjct:   35 FLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNV 248          

HSP 6 Score: 77.411 bits (189), Expect = 7.455e-14
Identity = 43/153 (28.10%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HI+   G V+VA ++++ G+     T  G  P+H A+  G L++  LLL+R    +    +G+ P+H A+   + ++  LLLE+  +       G  P+H A+    +QI   LL      +       + L LA Q    D V LL+
Sbjct:  530 GYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLL 682          

HSP 7 Score: 76.6406 bits (187), Expect = 1.177e-13
Identity = 44/158 (27.85%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + + +G  ++H+A   G VEV R ++  G+ ++        P+H AS  G  EI+ LLL+     +  T +G  P+H ++  G  ++  +LLE          +G  P+H A+  G L + KLLLQR+   D       + L +A          LL+
Sbjct:  459 VTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLL 616          

HSP 8 Score: 76.2554 bits (186), Expect = 1.807e-13
Identity = 42/153 (27.45%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G L I+ LLL+     +     G   +H A+  G  E+++ LL     ++        P+H AS  G  +I++LLLQ     D       + L ++ +  Q+D   +L+
Sbjct:  398 GFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLL 550          

HSP 9 Score: 69.3218 bits (168), Expect = 3.320e-11
Identity = 41/176 (23.30%), Postives = 79/176 (44.89%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            +EG  D     L++   +++   +G   +H+A   G ++VA++++   +  +     G+ P+H A+     ++  LLLE+         +G  P+H A+     +I   LL           +G+ P+H AS  GH  ++ LLL +   I        + L LA Q  +++   +L
Sbjct:  539 REGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADIL 714          

HSP 10 Score: 68.5514 bits (166), Expect = 5.902e-11
Identity = 36/144 (25.00%), Postives = 69/144 (47.92%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELA 609
            V  QG   +H+A   G  ++  +++D G+NI   T  G+  +H A+    + +  +L +   D +  T  G  P+  A   G+ +++  LL++  N+  +   G  P+H A+  GH  I+ +LLQ   + +       + L +A
Sbjct:  658 VTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIA 801          

HSP 11 Score: 66.2402 bits (160), Expect = 2.627e-10
Identity = 37/150 (24.67%), Postives = 73/150 (48.67%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +HIA   G  E+ ++++   ++ +  TT G  P+H ++  G +++ ++LLE        T  G  P+H A+  G  ++ KLLL+R    +     G+ P+H A+   + ++  LLL++            + L +A +  QM     L++
Sbjct:  501 LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLN 650          

HSP 12 Score: 62.003 bits (149), Expect = 5.662e-9
Identity = 36/169 (21.30%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            + + G   IH+A   G + +  +++  G++ +     G   +H A+  G +E++  LL     ++        P+H AS  G +EI++LLL+   + +     G  P+H ++  G + +  +LL+             + L +A +   +D  +LL+  +   D   +N
Sbjct:  427 ITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKN 595          

HSP 13 Score: 62.003 bits (149), Expect = 6.928e-9
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA ++++ G++       G  P+H A+ +  ++I + LL    +    T  G+ P+H AS  GH++++ LLL++  NI      G+  +H A+    + +  +L +     D    +  + L +A     +  V  L+
Sbjct:  596 GLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLL 748          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Match: J9HSB7 (AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AaeL_AAEL017480 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.467e-31
Identity = 57/155 (36.77%), Postives = 94/155 (60.65%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV + +ID G+N++     G  P+HYAS  G LE++  L++   +++   N G  P+HYAS  GH E++KLL++   N++  DN G  P+H AS  GHL+++KLL+     +D KN    + L +A Q+ +++ V+LLI
Sbjct:  139 NEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLI 293          

HSP 2 Score: 122.865 bits (307), Expect = 3.798e-28
Identity = 75/286 (26.22%), Postives = 134/286 (46.85%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD-----------FINRNDEIAFDKIW----KSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVC 996
            ++G   +H A + G +EV +++ID G+N++     G  P+H+AS  G LE++ LL++   +++   N    P+HYAS  G  E++K L++   N++  DN G  P+H AS  GHL+++KLL+     +D   N   + L  A ++ +++ V+ +I      D           + +RN  +   K       + D  +   ++ LH    A       +VK +    +DDE   DT D++      D  L G   +     V +    G  + T  + R +S H+ 
Sbjct:    7 NEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLH---YASRNGHLEVVKLL----IDDEANVDTTDNEGWTPLHDASLIGHLEV-----VKLLIDNGANVDTKNTRRPTSLHIA 280          

HSP 3 Score: 121.709 bits (304), Expect = 9.989e-28
Identity = 52/157 (33.12%), Postives = 90/157 (57.32%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             D++G   +H A   G +EV +++ID G+N++     G  P+HYAS  G LE++  +++   +++   N G  P+HYAS  G  E++K L++   N++   N G  P+H AS  GHL+++KLL+  +  +D  +N   + L  A     ++ V+LLI
Sbjct:  104 TDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLI 260          

HSP 4 Score: 118.627 bits (296), Expect = 1.413e-26
Identity = 53/157 (33.76%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             D++G   +H A   G +EV + +ID G+N++     G  P+HYAS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL++   N++ ++ R    +H AS  G L+++KLL+     +D KN    + L +A ++  ++ V+LLI
Sbjct:  170 TDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLI 326          

HSP 5 Score: 99.3673 bits (246), Expect = 1.251e-19
Identity = 42/128 (32.81%), Postives = 73/128 (57.03%), Query Frame = 1
Query:  265 NIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            N++     G  P+HYAS  G LE++ LL++   +++   N G  P+H+AS  GH E++KLL++   N++   N    P+H AS  G L+++K L+     +D  +N   + L  A ++  ++ V+LLI
Sbjct:    1 NVDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLI 128          

HSP 6 Score: 71.633 bits (174), Expect = 5.061e-10
Identity = 31/98 (31.63%), Postives = 59/98 (60.20%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIE 471
             D++G   +H A + G +EV +++ID G+N++ + T     +H AS  G LE++ LL++   +++ +   G   +H AS  GH E++KLL++   N++
Sbjct:  236 TDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLIDNGANVD 333          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 5.217e-30
Identity = 54/157 (34.39%), Postives = 97/157 (61.78%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             D++G   +H+A   G +EV +++I+  +N++     G+ P+H+AS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL+E   N++   N+G+ P+H AS  GHL+++KLL+  +  +D   N   + L +A Q+  ++ V+LLI
Sbjct:  587 TDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLI 743          

HSP 2 Score: 132.109 bits (331), Expect = 8.762e-30
Identity = 65/203 (32.02%), Postives = 112/203 (55.17%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINR-NDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNAD 789
            D+G   +H+A   G +EV +++ID  +N++ +   G  P+H AS  G LE++ LL+E   +++ + N G  P+H+AS  GH E++K L++   N++   + G  P+H AS  GHL+++KLL++ +  +D K N   + L  A Q+  ++ V+ LI         NR N +   D+ W       EN +  L V+ + IE  A+
Sbjct:   83 DEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLID--------NRANVDTTQDEGWTPLHLAAENGH--LEVVKLLIENRAN 275          

HSP 3 Score: 130.183 bits (326), Expect = 4.817e-29
Identity = 53/155 (34.19%), Postives = 95/155 (61.29%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            D+G   +H+A   G++EV +++ID G+N++     G  P+H A+  G LE++ LL++   +++ + N G  P+H AS  GH E++KLL+E   N++ + N G  P+H AS  GHL+++K L+  +  +D   +   + L +A Q+  ++ V+LLI
Sbjct:   50 DEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLI 204          

HSP 4 Score: 128.257 bits (321), Expect = 1.830e-28
Identity = 53/155 (34.19%), Postives = 94/155 (60.65%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +++A   G +EV +++ID  +N++     G  P+H AS  G LE++ LL+E   +++   N G+ P+H+AS  GH E++KLL++   N++   N G  P+H AS  GHL+++KLL++ +  +D   N   + L  A Q+  ++ V+LLI
Sbjct:  556 NKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLI 710          

HSP 5 Score: 127.872 bits (320), Expect = 2.591e-28
Identity = 53/155 (34.19%), Postives = 95/155 (61.29%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H+A   G +EV +++ID  +N++     G+ P++ AS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL+E   N++   N+G+ P+H AS  GHL+++KLL+  +  +D   N   + L +A Q+  ++ V+LLI
Sbjct:  523 NEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLI 677          

HSP 6 Score: 127.487 bits (319), Expect = 3.772e-28
Identity = 51/156 (32.69%), Postives = 95/156 (60.90%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++ G   +H+A   G ++V +++ID G+N++ E   G  P+H A+  G LE++ LL++   +++   + G  P+H A+  GH E++KLL++   N++ + N G  P+H AS  GHL+++KLL++ +  +D K N   + L  A Q+  ++ V+ LI
Sbjct:   16 NNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLI 171          

HSP 7 Score: 126.331 bits (316), Expect = 9.028e-28
Identity = 52/155 (33.55%), Postives = 94/155 (60.65%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +++A   G +EV +++ID  +N++     G  P+H AS  G LE++ LL++   +++   N G+ P++ AS  GH E++KLL++   N++  DN G  P+H AS  GHL+++KLL++ +  +D   N   + L  A Q+  ++ V+LLI
Sbjct:  490 NEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLI 644          

HSP 8 Score: 125.561 bits (314), Expect = 1.615e-27
Identity = 51/155 (32.90%), Postives = 92/155 (59.35%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV + +ID  +N++     G  P+H AS  G LE++ LL+E   +++ + N G  P+H+AS  GH E++K L++   N++   + G  P+H A+  GHL+++KLL++ +  +D K N   + L +A Q+  ++ V+ LI
Sbjct:  149 NEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLI 303          

HSP 9 Score: 124.79 bits (312), Expect = 2.914e-27
Identity = 53/155 (34.19%), Postives = 92/155 (59.35%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV +++ID  +N++     G  P+H AS  G LE++ LL+E   +++   N G+ P+H+AS  GH E++KLL++   N++   N G  P+H AS  GHL+++KLL+  +  +D   N   + L +A  +  ++ V+LLI
Sbjct:  622 NKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLI 776          

HSP 10 Score: 122.094 bits (305), Expect = 2.285e-26
Identity = 52/155 (33.55%), Postives = 88/155 (56.77%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV + +ID  +N++     G  P+H A+  G LE++ LL+E   +++ + N G  P+H AS  GH E++K L++   N++     G  P+H AS  GHL+++KLL+  K  +D   N   + L  A Q+  ++ V+LLI
Sbjct:  215 NEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLI 369          

HSP 11 Score: 121.709 bits (304), Expect = 3.229e-26
Identity = 54/166 (32.53%), Postives = 95/166 (57.23%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLL-----------ERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +G   +H+A   G +EV +++ID  +N++     G+ P+H+AS  G LE++ LL+           E   +++   N G+ P+H+AS  GH E++KLL+E   N+    N G  P+H AS  GHL+++KLL++ +  +D   N   + L +A  +  ++ V+LLI+
Sbjct:  315 EGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLIN 480          

HSP 12 Score: 121.709 bits (304), Expect = 3.290e-26
Identity = 50/155 (32.26%), Postives = 96/155 (61.94%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +++A + G +EV +++I+  +N++     G  P++ AS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL++   N++   N+G+ P++ AS  GHL+++KLL+  K  +D  +N   + L +A Q+  ++ V+LLI
Sbjct:  457 NEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLI 611          

HSP 13 Score: 121.709 bits (304), Expect = 3.613e-26
Identity = 49/155 (31.61%), Postives = 92/155 (59.35%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            D+G   +H+A   G +EV +++I+  +N++ +   G  P+H+AS  G LE++  L++   +++   + G  P+H A+  GH E++KLL+E   N++ + N G  P+H AS  GHL+++K L+  +  +D       + L +A Q+  ++ V+LLI
Sbjct:  182 DEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLI 336          

HSP 14 Score: 119.783 bits (299), Expect = 1.495e-25
Identity = 52/155 (33.55%), Postives = 90/155 (58.06%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV +++I+  +N+      G  P+H+AS  G LE++ LL+E   +++   N G  P++ AS  GH E++KLL+    N++   N G  P++ AS  GHL+++KLL+  K  +D   N   + L +A Q+  ++ V+LLI
Sbjct:  391 NKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLI 545          

HSP 15 Score: 117.857 bits (294), Expect = 7.367e-25
Identity = 55/166 (33.13%), Postives = 95/166 (57.23%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNI---------ECETTW--GMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV +++ID  +N+           +TT   G+ P+H+AS  G LE++ LL+E   ++    N G  P+H+AS  GH E++KLL+E   N++   N G  P++ AS  GHL+++KLL+  +  +D   N   + L +A ++  ++ V+LLI
Sbjct:  347 NKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLI 512          

HSP 16 Score: 116.316 bits (290), Expect = 2.428e-24
Identity = 51/166 (30.72%), Postives = 93/166 (56.02%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQ-----------ILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            D+G   +H+A   G +EV +++I+  +N++ +   G  P+H AS  G LE++  L++   +++     G  P+H AS  GH E++KLL++   N++   N+G+ P+H AS  GHL+           ++KLL++ +  +D   N   + L  A Q+  ++ V+LLI
Sbjct:  248 DEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLI 413          

HSP 17 Score: 114.775 bits (286), Expect = 7.213e-24
Identity = 44/133 (33.08%), Postives = 83/133 (62.41%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNN 582
            ++G   +H+A   G +EV +++I+  +N++     G+ P+H+AS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL++   N++   N+G+ P++ AS  GHL+++KLL+  +  +D   N
Sbjct:  655 NEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQN 787          

HSP 18 Score: 114.775 bits (286), Expect = 7.486e-24
Identity = 49/155 (31.61%), Postives = 90/155 (58.06%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++G   +H A   G +EV +++I+  +N++     G  P++ AS  G LE++ LL+    +++   N G  P++ AS  GH E++KLL++   N++   N G  P+H AS  GHL+++KLL+  +  +D   N   + L +A ++  ++ V+LLI
Sbjct:  424 NEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLI 578          

HSP 19 Score: 107.071 bits (266), Expect = 2.732e-21
Identity = 44/138 (31.88%), Postives = 83/138 (60.14%), Query Frame = 1
Query:  235 VARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + + +ID  +NI+     G  P+H AS  G L+++ LL++   +++ E + G  P+H A+  G+ E++KLL++   N++   + G  P+H A+  GHL+++KLL+  +  +D K N   + L +A Q+  ++ V+LLI
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLI 138          

HSP 20 Score: 80.1073 bits (196), Expect = 2.077e-12
Identity = 33/102 (32.35%), Postives = 60/102 (58.82%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRG 489
            ++G   +H A   G +EV +++ID  +N++     G  P+H AS  G LE++ LL++   +++   N G+ P++ AS  GH E++KLL++   N++   N G
Sbjct:  688 NKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNEG 789          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Match: W4Z5P4 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 7.321e-29
Identity = 60/159 (37.74%), Postives = 88/159 (55.35%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELF 666
            G   IH A  GG +EV + ++  G+ +E     G  PIH AS  G L+++  L+ R   +E   N G  PIH ASSGGH  +++ L+ R   +E   N G  PIHCASSGGHL +++ L+ R  R++   N  ++ L  A ++  +D VQ L+S    F
Sbjct:   45 GQTPIHCASYGGHLEVVQYLVRRGARVEIGGIDGQAPIHCASRNGHLQVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVSRGARVEIGGNDGQTPLHCASRNGHLDVVQYLVSRGAHF 203          

HSP 2 Score: 103.605 bits (257), Expect = 2.784e-22
Identity = 50/150 (33.33%), Postives = 82/150 (54.67%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +++A + G ++V + ++  G+ +E     G  PIH AS  G LE++  L+ R   +E     G  PIH AS  GH ++++ L+ R   +E   N G  PIHCASSGGHL +++ L+ R  R++   N  ++ +  A     +  VQ L+S
Sbjct:   16 LNMAALNGHLDVVQYLVSRGAQVEKGGNDGQTPIHCASYGGHLEVVQYLVRRGARVEIGGIDGQAPIHCASRNGHLQVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVS 165          

HSP 3 Score: 87.8113 bits (216), Expect = 1.892e-16
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 1
Query:  298 PIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            P++ A+  G L+++  L+ R   +E   N G  PIH AS GGH E+++ L+ R   +E     G  PIHCAS  GHLQ+++ L+ R  R++   N  ++ +  A     +  VQ L+S
Sbjct:   15 PLNMAALNGHLDVVQYLVSRGAQVEKGGNDGQTPIHCASYGGHLEVVQYLVRRGARVEIGGIDGQAPIHCASRNGHLQVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVS 132          

HSP 4 Score: 63.929 bits (154), Expect = 4.503e-8
Identity = 36/111 (32.43%), Postives = 55/111 (49.55%), Query Frame = 1
Query:  139 VWKYLKSDFLNT-IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNI 468
            V +YL S      I  + G   IH A  GG + V + ++  G+ +E     G  PIH ASS G L ++  L+ R   +E   N G  P+H AS  GH ++++ L+ R  + 
Sbjct:   93 VVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVSRGARVEIGGNDGQTPIHCASSGGHLHVVQYLVSRGARVEIGGNDGQTPLHCASRNGHLDVVQYLVSRGAHF 203          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Match: Q16FJ0 (AAEL014741-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014741 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 5.789e-28
Identity = 53/156 (33.97%), Postives = 88/156 (56.41%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DD G   +H A   G +EV +++ID  +N++     G  P+H AS  G LE++ LL++   ++    N G  P+H AS  GH E++K L++   N++   N+G  P+H AS  GHL+++KLL+     +    N   + L +A Q+  ++ V+LLI
Sbjct:   42 DDNGWTPLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTPLHVASQNGHLEVVKLLI 197          

HSP 2 Score: 116.701 bits (291), Expect = 4.270e-27
Identity = 49/149 (32.89%), Postives = 87/149 (58.39%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +++    G++E+ + +ID  +NI+ +   G  P+H AS  G LE++ LL++   +++   N G  P+H AS  GH E++KLL++   N+    N G  P+H AS  GHL+++K L+  +  +D   N   + L +A Q+  ++ V+LLI
Sbjct:   16 VYLTADNGYIEMVKFLIDHNANIDTKDDNGWTPLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLI 164          

HSP 3 Score: 114.775 bits (286), Expect = 2.472e-26
Identity = 46/131 (35.11%), Postives = 78/131 (59.54%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCK 576
            ++G   +H+A   G +EV +++ID G+N+      G  P+H AS  G LE++  L++   +++   N G  P+H AS  GH E++KLL++   N+   +N G  P+H AS  GHL+++KLL+  +  +D K
Sbjct:   76 NKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTPLHVASQNGHLEVVKLLIDNRANVDAK 206          

HSP 4 Score: 87.0409 bits (214), Expect = 3.982e-16
Identity = 36/119 (30.25%), Postives = 70/119 (58.82%), Query Frame = 1
Query:  292 MRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            M+ ++  +  G +E++  L++ N +I+ + ++G  P+H AS  GH E++KLL++   N++   N+G  P+H AS  GHL+++KLL+     +    N   + L +A  +  ++ V+ LI
Sbjct:   13 MQLVYLTADNGYIEMVKFLIDHNANIDTKDDNGWTPLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLI 131          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Match: A0A4Q2V509 (ANK_REP_REGION domain-containing protein (Fragment) OS=Fusarium oxysporum f. sp. narcissi OX=451672 GN=BFJ63_vAg14992 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 2.108e-26
Identity = 54/159 (33.96%), Postives = 92/159 (57.86%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T+ D+ G   ++ A   G ++V +++++ G+NI      G+ P++ AS  G +E++ LLLE   DI    N G  P++ AS  GH E++KLLLE   NI   DN G+ P++ AS  GH++++KLLL+ +  I   +N   + +  A     ++ V+LL+
Sbjct:   23 TVADNDGWTPVYAASFDGHIDVVKLLLENGANITIVDNEGVTPVNAASLNGHVEVVKLLLENGADITVADNDGWTPVYAASFNGHVEVVKLLLENGANITVVDNEGVTPVNAASLNGHVEVVKLLLENEADITVGDNDGWTPVYAASDRGHVEVVKLLL 181          

HSP 2 Score: 114.775 bits (286), Expect = 8.575e-26
Identity = 55/159 (34.59%), Postives = 90/159 (56.60%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            T+ D+ G   ++ A   G VEV +++++ G+NI      G+ P++ AS  G +E++ LLLE   DI    N G  P++ AS  GH E++KLLLE   +I   DN G+ P++ AS  GH++++KLLL+    I   +N   + +  A  +   D  +LL+
Sbjct:   89 TVADNDGWTPVYAASFNGHVEVVKLLLENGANITVVDNEGVTPVNAASLNGHVEVVKLLLENEADITVGDNDGWTPVYAASDRGHVEVVKLLLENGADITVADNEGVMPVNAASFNGHVEVVKLLLENGADIMVGDNDGWTPVYAASFNGHADVAKLLL 247          

HSP 3 Score: 114.005 bits (284), Expect = 1.828e-25
Identity = 55/159 (34.59%), Postives = 93/159 (58.49%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            TIVD++G   ++ A + G VEV +++++ G++I      G  P++ AS  G +E++ LLLE   +I    N G+ P++ AS  GH E++KLLLE   +I   DN G  P++ AS  GH++++KLLL+    I   +N     +  A  +  ++ V+LL+
Sbjct:   56 TIVDNEGVTPVNAASLNGHVEVVKLLLENGADITVADNDGWTPVYAASFNGHVEVVKLLLENGANITVVDNEGVTPVNAASLNGHVEVVKLLLENEADITVGDNDGWTPVYAASDRGHVEVVKLLLENGADITVADNEGVMPVNAASFNGHVEVVKLLL 214          

HSP 4 Score: 108.997 bits (271), Expect = 1.280e-23
Identity = 51/137 (37.23%), Postives = 80/137 (58.39%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNN 582
            T+VD++G   ++ A + G VEV +++++  ++I      G  P++ AS RG +E++ LLLE   DI    N G+ P++ AS  GH E++KLLLE   +I   DN G  P++ AS  GH  + KLLL+    I   +N
Sbjct:  122 TVVDNEGVTPVNAASLNGHVEVVKLLLENEADITVGDNDGWTPVYAASDRGHVEVVKLLLENGADITVADNEGVMPVNAASFNGHVEVVKLLLENGADIMVGDNDGWTPVYAASFNGHADVAKLLLENGADITVADN 258          

HSP 5 Score: 102.449 bits (254), Expect = 2.945e-21
Identity = 47/148 (31.76%), Postives = 85/148 (57.43%), Query Frame = 1
Query:  205 HIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + A   G ++V +++++ G++I      G  P++ AS  G ++++ LLLE   +I    N G+ P++ AS  GH E++KLLLE   +I   DN G  P++ AS  GH++++KLLL+    I   +N   + +  A  +  ++ V+LL+
Sbjct:    1 YAASFNGHIDVVKLLLENGADITVADNDGWTPVYAASFDGHIDVVKLLLENGANITIVDNEGVTPVNAASLNGHVEVVKLLLENGADITVADNDGWTPVYAASFNGHVEVVKLLLENGANITVVDNEGVTPVNAASLNGHVEVVKLLL 148          

HSP 6 Score: 79.7221 bits (195), Expect = 3.703e-13
Identity = 38/106 (35.85%), Postives = 61/106 (57.55%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRG 489
            T+ D+ G   ++ A   G VEV +++++ G++I      G+ P++ AS  G +E++ LLLE   DI    N G  P++ AS  GH+++ KLLLE   +I   DN G
Sbjct:  155 TVGDNDGWTPVYAASDRGHVEVVKLLLENGADITVADNEGVMPVNAASFNGHVEVVKLLLENGADIMVGDNDGWTPVYAASFNGHADVAKLLLENGADITVADNNG 260          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 107.842 bits (268), Expect = 8.508e-25
Identity = 62/209 (29.67%), Postives = 108/209 (51.67%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++ +  + + P+H AS  G+S ++KLLLER   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+           + E+  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  152 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------HHEVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 339          

HSP 2 Score: 91.6633 bits (226), Expect = 1.707e-19
Identity = 46/166 (27.71%), Postives = 88/166 (53.01%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++ +    + P+H AS RG   ++ LLLER   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLL  +  +D   N   + L +A         ++++
Sbjct:  169 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIV 334          

HSP 3 Score: 80.8777 bits (198), Expect = 5.705e-16
Identity = 40/150 (26.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +    + RG   +H A+  G  +++K L+Q    +D K+   ++ L ++ +  + + +Q L+
Sbjct:  317 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLL 466          

HSP 4 Score: 78.5666 bits (192), Expect = 3.261e-15
Identity = 44/165 (26.67%), Postives = 81/165 (49.09%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G+  +H+A   G  +VA I++D G+++   T  G  P+H A+  G +E+  LLL++    +    SG+ P+H A+   + ++  LLL++  +       G  P+H A+    ++I   LL+     +       S L LA Q   +D V LL++     +  N++
Sbjct:  479 GYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKS 643          

HSP 5 Score: 75.8702 bits (185), Expect = 2.084e-14
Identity = 34/135 (25.19%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSES 594
            G+  +HIA     +E+A  +++ G++    T  G+ P+H AS  G ++++TLL+ R+  I     SG+ P+H A+      + ++L+     ++ E   G  P+H A   G+++++  LL+ + +++ K  ++ +
Sbjct:  578 GYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAA 712          

HSP 6 Score: 75.8702 bits (185), Expect = 2.179e-14
Identity = 39/154 (25.32%), Postives = 76/154 (49.35%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  EV + ++  G+ ++ ++     P+H +S  G  EI+  LL+     +  T SG  P+H A+  GH ++  +LL++  ++     +G  P+H A+  G +++  LLLQ++   D       + L +A          LL+
Sbjct:  412 RGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLL 565          

HSP 7 Score: 74.7146 bits (182), Expect = 5.722e-14
Identity = 41/156 (26.28%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A      +VA +++D G++       G  P+H A+ +  +EI T LLE   D    T  G+ P+H AS  G+ +++ LL+ R+  I   +  G+ P+H A+    + + ++L+     +D +  M  + L +A     +  V  L+  Q
Sbjct:  545 GLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQ 700          

HSP 8 Score: 74.3294 bits (181), Expect = 6.963e-14
Identity = 36/149 (24.16%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + +++++ G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL     ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  219 LHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLL 367          

HSP 9 Score: 72.7886 bits (177), Expect = 2.181e-13
Identity = 45/178 (25.28%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +EG+ D     L       I   +G   +H+A   G +EVA +++   +  +     G+ P+H A+     ++  LLL++         +G  P+H A+     EI   LLE   +      +G+ P+H AS  G++ ++ LL+ R   I+  N    + L LA Q  Q++  ++L++
Sbjct:  488 REGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVN 665          

HSP 10 Score: 70.8626 bits (172), Expect = 1.082e-12
Identity = 47/206 (22.82%), Postives = 89/206 (43.20%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC-----------------------------NIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            KEG+ + V + +K          +G+ ++HIA + G  +V + ++  G+N+  ++  G  P++ A+    L+++  LL+        T  G  P+  A   GH +++ LLLE +                              N + E   G  P+H A+  G++ +  LLL R   +D K     + L +A +    + V+LL+
Sbjct:   30 KEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLL 235          

HSP 11 Score: 68.1662 bits (165), Expect = 6.845e-12
Identity = 39/153 (25.49%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I+  T  G+ PIH A+  G   I+T L+            G   +H A+  G +E++K L++    ++ +      P+H +S  G  +I++ LLQ     D       + L LA +    D   +L+
Sbjct:  347 GFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILL 499          

HSP 12 Score: 67.3958 bits (163), Expect = 1.228e-11
Identity = 42/167 (25.15%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  148 YLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            YLKS     I +  G  ++H+A   G VEV   +I  G+ ++  T  G   +H AS  G  +++  L+    ++  ++ +G  P++ A+   H ++++ LL+   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:    7 YLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 169          

HSP 13 Score: 66.6254 bits (161), Expect = 2.087e-11
Identity = 51/224 (22.77%), Postives = 94/224 (41.96%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDE 690
            K GN++ V   L+           G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL     ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+  L+      +  N   E+ L +A ++ Q + V+ L+      D  +++D+
Sbjct:  224 KRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQ 447          

HSP 14 Score: 63.5438 bits (153), Expect = 2.279e-10
Identity = 39/156 (25.00%), Postives = 74/156 (47.44%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +HI+   G  E+ + ++  G+  +  TT G  P+H A+  G  ++ ++LL++   +   T  G  P+H A+  G  E+  LLL++    +     G+ P+H A+   + ++  LLL +            + L +A +  QM+    L+
Sbjct:  445 DDQT--PLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLL 598          

HSP 15 Score: 56.6102 bits (135), Expect = 3.258e-8
Identity = 33/157 (21.02%), Postives = 70/157 (44.59%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G   +   +++ G++       G   +H A+  G  E++  L++    ++ ++     P+H +S  G  EI++ LL+     +     G  P+H A+  GH  +  +LL +   +        + L +A +  +++   LL+
Sbjct:  376 VTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLL 532          

HSP 16 Score: 51.9878 bits (123), Expect = 8.336e-7
Identity = 30/112 (26.79%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLE 453
            +EGN D V   +  D    + +  G   +H+A     V VA ++++ G+ ++ ET  G  P+H A   G ++++  LL+    +  +T         A+  GH+ I+ LLL+
Sbjct:  620 QEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVT------AAQQGHTHIINLLLQ 725          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.354e-22
Identity = 57/209 (27.27%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + ++  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ +++LLL+R   I+ +   G+ P+HCA+  GH   ++LLL+R   I  +     S L +A Q   ++CV+ L+  +         D++  D +            + LHV   A  C   R+ K +LDK  +
Sbjct:  179 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV------DDVTLDYL------------TALHV---AAHCGHYRVTKLLLDKRAN 366          

HSP 2 Score: 97.8265 bits (242), Expect = 4.751e-22
Identity = 48/140 (34.29%), Postives = 78/140 (55.71%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G V VA ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH   ++LLLER   I      G+ P+H A+ G H++ +K LLQ K  +D
Sbjct:  196 LQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 335          

HSP 3 Score: 85.8853 bits (211), Expect = 5.270e-18
Identity = 63/254 (24.80%), Postives = 111/254 (43.70%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFI---------NRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
             FL+  + GN D V +YLK        +  G  ++H+A   G +++ + +++ GS+++  T  G   +H AS  G  E++ +L+++  DI  ++ +G  P++ AS   H ++++ LLE   N       G  P+  A   GH Q++ +LL+     D K  +    L +A +        LL+       VQ    F          N N          + DF   N  + LHV       N   +V+ +LD+
Sbjct:   18 SFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTN---MVRLLLDR 264          

HSP 4 Score: 80.1073 bits (196), Expect = 4.275e-16
Identity = 44/153 (28.76%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A   G   + R+++D GS I+ +T  G+ P+H A+  G    + LLLER   I   T +G+ P+H A+ G H E +K LL+    ++      +  +H A+  GH ++ KLLL ++   + +     + L +A +  ++  ++LL+
Sbjct:  242 GITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV 394          

HSP 5 Score: 56.9954 bits (136), Expect = 1.546e-8
Identity = 27/95 (28.42%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDN 483
            ++H+A   G   V ++++D  +N       G  P+H A  +  ++++ LL++    I+  T SG+ PIH A+  GH  I+ LLL+   + +   N
Sbjct:  344 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTAN 438          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 100.138 bits (248), Expect = 3.009e-22
Identity = 58/209 (27.75%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H A+  G+  ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+             ++  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  207 ALHIAARKDDTKSAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHDVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 394          

HSP 2 Score: 89.3521 bits (220), Expect = 1.111e-18
Identity = 45/166 (27.11%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++ G+ ++      + P+H A+ RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  224 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIV 389          

HSP 3 Score: 85.5001 bits (210), Expect = 1.814e-17
Identity = 43/150 (28.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G   +++ LLQ   ++D K    ++ L +A +  + + VQLL+
Sbjct:  372 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL 521          

HSP 4 Score: 79.337 bits (194), Expect = 1.769e-15
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  +V R ++  G+ ++ +       +H AS  G  EI+ LLL++       T SG  P+H A   GH E   LLLE   ++     +G  P+H A+  G ++  KLLLQ++   D       + L +A          LL+
Sbjct:  467 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 620          

HSP 5 Score: 77.0258 bits (188), Expect = 8.974e-15
Identity = 37/149 (24.83%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ +  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  274 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 422          

HSP 6 Score: 77.0258 bits (188), Expect = 9.385e-15
Identity = 35/153 (22.88%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +N ++     +G+ P+H A+      + ++LL     ++     G  P+H A   G+++++  LL+ + +I+ K     + L  A Q      + +L+
Sbjct:  633 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLL 785          

HSP 7 Score: 74.7146 bits (182), Expect = 5.515e-14
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +N N+   +  G+ P+H A+    + + ++LL     +D       + L +A     M  V  L+  Q
Sbjct:  600 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQ 755          

HSP 8 Score: 74.7146 bits (182), Expect = 5.615e-14
Identity = 45/182 (24.73%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VEV   ++  G++++  T  G   +H AS  G  +++  L+    ++  ++ +G  P++ A+   H E+++ LLE   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   47 YLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 224          

HSP 9 Score: 73.9442 bits (180), Expect = 1.136e-13
Identity = 47/187 (25.13%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G A+ V   L+     +     G+  +H+A   G  E A ++++ G+++   T  G  P+H A+  G +E   LLL++    +    +G+ P+H A+   +  +  LLL+   +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++     +  N+N
Sbjct:  512 GKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 698          

HSP 10 Score: 71.2478 bits (173), Expect = 6.340e-13
Identity = 34/127 (26.77%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRK 558
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +LL    +++  T +G  P+H A   G+ +++  LLE    I  +   G  P+H A+  GH  I+ +LLQ +
Sbjct:  662 VTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 788          

HSP 11 Score: 70.8626 bits (172), Expect = 9.888e-13
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ +  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q D V+ L+      D   ++D+ A 
Sbjct:  303 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTAL 505          

HSP 12 Score: 68.1662 bits (165), Expect = 7.880e-12
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMD 630
            + G AD V   L++     I       ++HIA   G  E+ ++++  G+     TT G  P+H A   G  E  +LLLE    +   T  G  P+H A+  G  E  KLLL++    +     G+ P+H A+   + ++  LLL              + L +A +  Q++
Sbjct:  477 RAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLE 647          

HSP 13 Score: 64.6994 bits (156), Expect = 9.773e-11
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G+ ++  T  G  P+H A   G +++++ LLE    I  +T SG  P+H A+  GH+ I+ +LL+   +       G   +  A   G++ ++  L
Sbjct:  675 QEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 817          

HSP 14 Score: 63.929 bits (154), Expect = 1.479e-10
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G +++++ LL+    ++ +       +H AS  G  +I++LLLQ+            + L LA++    +   LL+
Sbjct:  402 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL 554          

HSP 15 Score: 62.7734 bits (151), Expect = 3.413e-10
Identity = 36/155 (23.23%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +G   +H+A   G +E A++++   +  +     G+ P+H A+      +  LLL+          +G  P+H A+     EI   LLE          +G+ P+H A+  G + ++ LLL +   ++  N    + L LA Q  ++   ++L++
Sbjct:  566 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN 720          

HSP 16 Score: 60.4622 bits (145), Expect = 2.276e-9
Identity = 36/157 (22.93%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G   + + +   G++       G   +H A+  G  +++  LL+    ++ +       +H AS  G +EI++LLL++          G  P+H A   GH +   LLL+    +        + L +A +  Q++  +LL+
Sbjct:  431 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLL 587          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 93.5893 bits (231), Expect = 4.016e-20
Identity = 59/217 (27.19%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECE--------TTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E        T  G  P+H A+  G + + TLLL R   ++    + + P+H A+  G+  ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+             ++  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  171 ALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHDVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 366          

HSP 2 Score: 87.8113 bits (216), Expect = 3.226e-18
Identity = 43/153 (28.10%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIA   G + VA ++++ G+ ++      + P+H A+ RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  209 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIV 361          

HSP 3 Score: 85.5001 bits (210), Expect = 1.837e-17
Identity = 43/150 (28.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G   +++ LLQ   ++D K    ++ L +A +  + + VQLL+
Sbjct:  344 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL 493          

HSP 4 Score: 79.337 bits (194), Expect = 1.791e-15
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  +V R ++  G+ ++ +       +H AS  G  EI+ LLL++       T SG  P+H A   GH E   LLLE   ++     +G  P+H A+  G ++  KLLLQ++   D       + L +A          LL+
Sbjct:  439 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 592          

HSP 5 Score: 77.0258 bits (188), Expect = 9.083e-15
Identity = 37/149 (24.83%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ +  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  246 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 394          

HSP 6 Score: 77.0258 bits (188), Expect = 9.499e-15
Identity = 35/153 (22.88%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +N ++     +G+ P+H A+      + ++LL     ++     G  P+H A   G+++++  LL+ + +I+ K     + L  A Q      + +L+
Sbjct:  605 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLL 757          

HSP 7 Score: 74.7146 bits (182), Expect = 5.581e-14
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +N N+   +  G+ P+H A+    + + ++LL     +D       + L +A     M  V  L+  Q
Sbjct:  572 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQ 727          

HSP 8 Score: 74.7146 bits (182), Expect = 5.681e-14
Identity = 45/182 (24.73%), Postives = 85/182 (46.70%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +L+  + GN +    YLK+     I +  G  ++H+A   G VEV   ++  G++++  T  G   +H AS  G  +++  L+    ++  ++ +G  P++ A+   H E+++ LLE   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   11 YLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 188          

HSP 9 Score: 73.9442 bits (180), Expect = 1.150e-13
Identity = 47/187 (25.13%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G A+ V   L+     +     G+  +H+A   G  E A ++++ G+++   T  G  P+H A+  G +E   LLL++    +    +G+ P+H A+   +  +  LLL+   +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++     +  N+N
Sbjct:  484 GKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 670          

HSP 10 Score: 71.2478 bits (173), Expect = 6.412e-13
Identity = 34/127 (26.77%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRK 558
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +LL    +++  T +G  P+H A   G+ +++  LLE    I  +   G  P+H A+  GH  I+ +LLQ +
Sbjct:  634 VTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 760          

HSP 11 Score: 70.8626 bits (172), Expect = 1.000e-12
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ +  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q D V+ L+      D   ++D+ A 
Sbjct:  275 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTAL 477          

HSP 12 Score: 68.1662 bits (165), Expect = 7.966e-12
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMD 630
            + G AD V   L++     I       ++HIA   G  E+ ++++  G+     TT G  P+H A   G  E  +LLLE    +   T  G  P+H A+  G  E  KLLL++    +     G+ P+H A+   + ++  LLL              + L +A +  Q++
Sbjct:  449 RAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLE 619          

HSP 13 Score: 64.6994 bits (156), Expect = 9.533e-11
Identity = 48/196 (24.49%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL-------------LQRKCRIDCKNNMSESILELAIQSKQMDCV-QLLISVQEL 663
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G+ ++  T  G  P+H A   G +++++ LLE    I  +T SG  P+H A+  GH+ I+ +LL+   +       G   +  A   G++ ++  L             +  K +++    M+E  L+++    Q D + Q L S Q L
Sbjct:  647 QEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLTDENLTATPPVSEKHKLNVPETMNE-FLDMSDDEVQPDLIGQDLCSAQPL 841          

HSP 14 Score: 63.929 bits (154), Expect = 1.494e-10
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G +++++ LL+    ++ +       +H AS  G  +I++LLLQ+            + L LA++    +   LL+
Sbjct:  374 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL 526          

HSP 15 Score: 62.7734 bits (151), Expect = 3.448e-10
Identity = 36/155 (23.23%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +G   +H+A   G +E A++++   +  +     G+ P+H A+      +  LLL+          +G  P+H A+     EI   LLE          +G+ P+H A+  G + ++ LLL +   ++  N    + L LA Q  ++   ++L++
Sbjct:  538 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN 692          

HSP 16 Score: 60.4622 bits (145), Expect = 2.298e-9
Identity = 36/157 (22.93%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G   + + +   G++       G   +H A+  G  +++  LL+    ++ +       +H AS  G +EI++LLL++          G  P+H A   GH +   LLL+    +        + L +A +  Q++  +LL+
Sbjct:  403 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLL 559          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 93.5893 bits (231), Expect = 4.398e-20
Identity = 59/217 (27.19%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECE--------TTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E        T  G  P+H A+  G + + TLLL R   ++    + + P+H A+  G+  ++KLLL+R   I+ +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+             ++  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  151 ALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------QHDVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 346          

HSP 2 Score: 87.8113 bits (216), Expect = 3.524e-18
Identity = 43/153 (28.10%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIA   G + VA ++++ G+ ++      + P+H A+ RG   ++ LLL+R   I+ +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         ++++
Sbjct:  189 GFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIV 341          

HSP 3 Score: 85.5001 bits (210), Expect = 2.005e-17
Identity = 43/150 (28.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  ++++ LLL+    ++  T SG+ PIH A+  GH  I+K L     +    + RG   +H A+  G   +++ LLQ   ++D K    ++ L +A +  + + VQLL+
Sbjct:  324 ALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLL 473          

HSP 4 Score: 79.337 bits (194), Expect = 1.947e-15
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  ++H+A   G  +V R ++  G+ ++ +       +H AS  G  EI+ LLL++       T SG  P+H A   GH E   LLLE   ++     +G  P+H A+  G ++  KLLLQ++   D       + L +A          LL+
Sbjct:  419 RGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLL 572          

HSP 5 Score: 77.0258 bits (188), Expect = 9.860e-15
Identity = 37/149 (24.83%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + ++++D G+ I+ +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ +  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  226 LHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 374          

HSP 6 Score: 77.0258 bits (188), Expect = 1.031e-14
Identity = 35/153 (22.88%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+   +++ G+     T  G+ P+H A+  G +++++LLL +N ++     +G+ P+H A+      + ++LL     ++     G  P+H A   G+++++  LL+ + +I+ K     + L  A Q      + +L+
Sbjct:  585 GYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLL 737          

HSP 7 Score: 74.7146 bits (182), Expect = 6.048e-14
Identity = 42/156 (26.92%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A       VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H A+  G  +++ LLL +N N+   +  G+ P+H A+    + + ++LL     +D       + L +A     M  V  L+  Q
Sbjct:  552 GLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQ 707          

HSP 8 Score: 73.9442 bits (180), Expect = 1.245e-13
Identity = 47/187 (25.13%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G A+ V   L+     +     G+  +H+A   G  E A ++++ G+++   T  G  P+H A+  G +E   LLL++    +    +G+ P+H A+   +  +  LLL+   +       G  P+H A+    L+I   LL+     +       S L LA Q   +D V LL++     +  N+N
Sbjct:  464 GKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKN 650          

HSP 9 Score: 71.2478 bits (173), Expect = 6.931e-13
Identity = 34/127 (26.77%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRK 558
            V  QG   +H+A   G V++  +++   +N+      G+ P+H A+    + +  +LL    +++  T +G  P+H A   G+ +++  LLE    I  +   G  P+H A+  GH  I+ +LLQ +
Sbjct:  614 VTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHR 740          

HSP 10 Score: 70.8626 bits (172), Expect = 1.080e-12
Identity = 49/203 (24.14%), Postives = 88/203 (43.35%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H     G  +V  +++D G+ I  +T  G+ P+H A+    L  + LLL+ +  ++  TN  +  +H A+  GH ++ K+++++  N             I C+ NR                    G+ PIH A+  GH  I+K L       +  N   E+ L +A ++ Q D V+ L+      D   ++D+ A 
Sbjct:  255 GLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTAL 457          

HSP 11 Score: 70.8626 bits (172), Expect = 1.191e-12
Identity = 51/201 (25.37%), Postives = 90/201 (44.78%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRG---MRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSE--------SILELAIQSKQMDCVQLLISVQELFDFINRND 687
            KEG+ + V + LK          +G+ ++HIA + G  +V R ++  G+N+  ++  G  P++ A+    LE++  LLE        T  G  P+  A   GH +++ LLLE        D +G   +  +H A+     +   LLLQ     D ++ +          + L +A     ++   LL++     DF+ RND
Sbjct:   29 KEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLE-------NDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARND 222          

HSP 12 Score: 69.3218 bits (168), Expect = 3.607e-12
Identity = 42/167 (25.15%), Postives = 78/167 (46.71%), Query Frame = 1
Query:  148 YLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            YLK+     I +  G  ++H+A   G VEV   ++  G++++  T  G   +H AS  G  +++  L+    ++  ++ +G  P++ A+   H E+++ LLE   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:    6 YLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKSAALLL 168          

HSP 13 Score: 68.1662 bits (165), Expect = 8.586e-12
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMD 630
            + G AD V   L++     I       ++HIA   G  E+ ++++  G+     TT G  P+H A   G  E  +LLLE    +   T  G  P+H A+  G  E  KLLL++    +     G+ P+H A+   + ++  LLL              + L +A +  Q++
Sbjct:  429 RAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLE 599          

HSP 14 Score: 64.6994 bits (156), Expect = 1.061e-10
Identity = 37/143 (25.87%), Postives = 70/143 (48.95%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL 546
            +EG+ D V   L  +    + +  G   +H+A     V VA ++++ G+ ++  T  G  P+H A   G +++++ LLE    I  +T SG  P+H A+  GH+ I+ +LL+   +       G   +  A   G++ ++  L
Sbjct:  627 QEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 769          

HSP 15 Score: 63.929 bits (154), Expect = 1.604e-10
Identity = 37/153 (24.18%), Postives = 70/153 (45.75%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++++  T  G+ PIH A+  G   I+  L             G   +H A+  G +++++ LL+    ++ +       +H AS  G  +I++LLLQ+            + L LA++    +   LL+
Sbjct:  354 GFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLL 506          

HSP 16 Score: 62.7734 bits (151), Expect = 3.698e-10
Identity = 36/155 (23.23%), Postives = 71/155 (45.81%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +G   +H+A   G +E A++++   +  +     G+ P+H A+      +  LLL+          +G  P+H A+     EI   LLE          +G+ P+H A+  G + ++ LLL +   ++  N    + L LA Q  ++   ++L++
Sbjct:  518 KGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLN 672          

HSP 17 Score: 60.4622 bits (145), Expect = 2.458e-9
Identity = 36/157 (22.93%), Postives = 69/157 (43.95%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   IH+A   G   + + +   G++       G   +H A+  G  +++  LL+    ++ +       +H AS  G +EI++LLL++          G  P+H A   GH +   LLL+    +        + L +A +  Q++  +LL+
Sbjct:  383 VTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLL 539          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 6.211e-24
Identity = 58/206 (28.16%), Postives = 102/206 (49.51%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA        A +++    N +  +  G  P+H A+  G + + TLLL     ++    +G+ P+H A+  G++ ++KLLL+R   I+ +   G+ P+HCA+  GH +++++LL+R   I  K     S L +A Q + + CVQLL+  Q         D++  D +            + LHV   A  C   R+ K +LD+
Sbjct:  175 ALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPV------DDVTLDYL------------TPLHV---AAHCGHYRVAKLLLDR 359          

HSP 2 Score: 98.2117 bits (243), Expect = 2.048e-22
Identity = 48/149 (32.21%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   VA++++D G         G  P+H A  +  ++++ LLL+    I   T SG+ PIH AS  GH  +++LLL+   +    + RG  P+H AS  G L+++K LLQ   R+  K    ++ L +A +  + + VQLL+
Sbjct:  341 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL 489          

HSP 3 Score: 97.8265 bits (242), Expect = 2.507e-22
Identity = 43/132 (32.58%), Postives = 78/132 (59.09%), Query Frame = 1
Query:  175 IVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            +    G   +HIA   G + VA ++++ G+ ++     G+ P+H A+ RG   ++ LLL+R   I+ +T  G+ P+H A+  GH +++++LLER+  I  +   G+ P+H A+ G HL  ++LLL R+  +D
Sbjct:  200 VTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD 331          

HSP 4 Score: 92.4337 bits (228), Expect = 1.358e-20
Identity = 47/151 (31.13%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCK 576
            G+ + V   L++   +   + +G   +H+A   G +EV + ++  G+ +  +      P+H AS  G  EI+ LLL+R  D    T SG  P+++AS  GH ++  LLLE   +I     +G  P+H AS  G L++  LLL++    D K
Sbjct:  414 GHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPK 564          

HSP 5 Score: 84.7297 bits (208), Expect = 5.658e-18
Identity = 46/153 (30.07%), Postives = 72/153 (47.06%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    ++V  +++  G++I   T  G+ PIH AS  G L ++ LLL+           G  P+H AS  G  E++K LL+    +  +      P+H AS  G  +I++LLLQR    +       + L  A +    D   LL+
Sbjct:  370 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLL 522          

HSP 6 Score: 82.0333 bits (201), Expect = 3.681e-17
Identity = 56/232 (24.14%), Postives = 97/232 (41.81%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERN-------------CNIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            +H+A   G   + ++++D G+ I+ +T  G+ P+H A+  G  +++ +LLER+  I  +T +G+ P+H A+ G                                 GH  + KLLL+R               +I C+ NR                    G+ PIH AS  GHL +++LLLQ     +  N   E+ L +A ++ Q++ V+ L+          R D+   
Sbjct:  242 LHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL 473          

HSP 7 Score: 79.337 bits (194), Expect = 2.853e-16
Identity = 64/266 (24.06%), Postives = 112/266 (42.11%), Query Frame = 1
Query:   79 FMMGDFQC-----FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD---------------FINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            F    FQ      FL+  + GN + +  +LK        +  G  ++H+A   G V+V   ++   + I+  T  G   +H A+  G  +I+ +L+E   +I  ++ +G  P++ A+   H EI+K LL+   N       G  P+  A   GH Q++ LLL+     D K  +    L +A +    +   LL+  +   D               + N N       +  + DF   N  + LHV   A +   + +VK +LD+
Sbjct:    2 FFALSFQSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHV---AAKRGNNNMVKLLLDR 260          

HSP 8 Score: 77.7962 bits (190), Expect = 1.024e-15
Identity = 42/155 (27.10%), Postives = 74/155 (47.74%), Query Frame = 1
Query:  184 DQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + G   IH+A   G + V ++++  G++       G  P+H AS  G LE++  LL+    +  +      P+H AS  G +EI++LLL+R  +       G  P++ AS  GH  +  LLL+    I        + L +A +  +++   LL+
Sbjct:  401 ESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLL 555          

HSP 9 Score: 76.2554 bits (186), Expect = 2.901e-15
Identity = 43/180 (23.89%), Postives = 85/180 (47.22%), Query Frame = 1
Query:  145 KYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            KY  +D    +    G   +H+A      +VA +++D G++       G  P+H A+ +  LE+  +LLE   +    T  G+ P+H A+  GH++++ LLL R+ +I      G+  +H A+    + + ++L + K  ++    +  + L +A     +  V  L+  + L +   RN
Sbjct:  557 KYASAD--PKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRN 734          

HSP 10 Score: 73.9442 bits (180), Expect = 1.665e-14
Identity = 44/178 (24.72%), Postives = 84/178 (47.19%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIID--CGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            +EG+ D     L++    + V  +G   +HIA   G +EVA ++++    ++ +     G+ P+H A+     ++  LLL++         +G  P+H A+     E+ K+LLE          +G+ P+H A+  GH  ++ LLL R   I        + + LA Q  +++  ++L
Sbjct:  511 REGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEIL 688          

HSP 11 Score: 72.7886 bits (177), Expect = 4.334e-14
Identity = 38/170 (22.35%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G+  +HIA     +EV +++++ G+     T  G+ P+H A+  G  +++ LLL R+  I   T  G+  +H A+      + ++L +   ++         P+H AS  G+++++  LL+ +  ++ K     + L  A Q      V  L+  +   + +  N   A 
Sbjct:  603 GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 772          

HSP 12 Score: 55.4546 bits (132), Expect = 1.362e-8
Identity = 30/116 (25.86%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+AD V   L      ++    G  ++H+A     V VA I+    +++   T     P+H AS  G ++++  LL     +  +T +G  P+H A+  GH+ ++  LL+   +
Sbjct:  645 QEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 760          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 5.533e-23
Identity = 53/156 (33.97%), Postives = 89/156 (57.05%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
             LQH  E NAD   K +    LN   +  G   +HIA   G + VA ++++ G+ ++     G+ P+H A+ RG   ++ LLL+R   I+ +T  G+ P+H A+  GH +++++LLER+  I  +   G+ P+H A+ G HL  ++LLL R+  +D
Sbjct:  190 LLQH--EHNADVTSKMM----LNQTTES-GFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVD 338          

HSP 2 Score: 97.8265 bits (242), Expect = 2.686e-22
Identity = 48/149 (32.21%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   VA++++D G         G  P+H A  +  ++++ LLL+    I   T SG+ PIH AS  GH  +++LLL+   +    + RG  P+H AS  G L+++K LLQ   R+  K    ++ L +A +  + + VQLL+
Sbjct:  348 LHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL 496          

HSP 3 Score: 96.6709 bits (239), Expect = 5.493e-22
Identity = 54/179 (30.17%), Postives = 90/179 (50.28%), Query Frame = 1
Query:  280 TTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            T  G  P+H A+  G + + TLLL     ++    +G+ P+H A+  G++ ++KLLL+R   I+ +   G+ P+HCA+  GH +++++LL+R   I  K     S L +A Q + + CVQLL+  Q         D++  D +              LHV   A  C   R+ K +LD+
Sbjct:  209 TESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPV------DDVTLDYLTP------------LHV---AAHCGHYRVAKLLLDR 366          

HSP 4 Score: 94.7449 bits (234), Expect = 2.936e-21
Identity = 53/183 (28.96%), Postives = 87/183 (47.54%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
             F+ HL     + V   L++   +   + +G   +H+A   G +EV + ++  G+ +  +      P+H AS  G  EI+ LLL+R  D    T SG  P+++AS  GH ++  LLLE   +I     +G  P+H AS  G L++  LLL++    D K     + L +A          LL+
Sbjct:  418 SFMGHL-----NVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLL 595          

HSP 5 Score: 85.1149 bits (209), Expect = 3.773e-18
Identity = 45/153 (29.41%), Postives = 77/153 (50.33%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   ++ A   G  +VA ++++ G++I   T  G  P+H AS  G LE+ TLLLE+    + +  +G+ P+H A+   H ++  LLL++  +       G  P+H A+    L++ K+LL+     +       + L LA Q    D V LL+
Sbjct:  509 GSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLL 661          

HSP 6 Score: 84.7297 bits (208), Expect = 5.275e-18
Identity = 66/280 (23.57%), Postives = 113/280 (40.36%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYS---------------GLHVLDMAIECNADRIVKCILDKTVDDEEPKD---TNDHKDSEKNEDDKLRGICNICLEY---------PVDIAFQCGH 948
            G   +HIAC    ++V  +++  G++I   T  G+ PIH AS  G L ++ LLL+           G  P+H AS  G  E++K LL+    +  +      P+H AS  G  +I++LLLQR    +       + L  A +    D   LL+        + +     F  +  +S + R  + +               GL  L +A   +  ++   +LDK            T  H  ++KN+ +  + +  +  E          P+ +A Q GH
Sbjct:  377 GFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKK---GFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGH 653          

HSP 7 Score: 82.0333 bits (201), Expect = 3.789e-17
Identity = 57/236 (24.15%), Postives = 98/236 (41.53%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERN-------------CNIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G   +H+A   G   + ++++D G+ I+ +T  G+ P+H A+  G  +++ +LLER+  I  +T +G+ P+H A+ G                                 GH  + KLLL+R               +I C+ NR                    G+ PIH AS  GHL +++LLLQ     +  N   E+ L +A ++ Q++ V+ L+          R D+   
Sbjct:  245 GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPL 480          

HSP 8 Score: 79.337 bits (194), Expect = 2.988e-16
Identity = 56/234 (23.93%), Postives = 105/234 (44.87%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFD-----FINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNA 786
             FL+  + GN + +  +LK        +  G  ++H+A   G V+V   ++   + I+  T  G   +H A+  G  +I+ +L+E   +I  ++ +G  P++ A+   H EI+K LL+   N       G  P+  A   GH Q++ LLL+     D K  +    L +A +    +   LL+  +   D      +N+  E  F  +  ++ +   N+ + L  L  A++  A
Sbjct:   13 SFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLES----DTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTA 242          

HSP 9 Score: 76.6406 bits (187), Expect = 2.101e-15
Identity = 44/176 (25.00%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLL 645
            +EG+ D     L++    + V  +G   +HIA   G +EVA ++++  ++ + +   G+ P+H A+     ++  LLL++         +G  P+H A+     E+ K+LLE          +G+ P+H A+  GH  ++ LLL R   I        + + LA Q  +++  ++L
Sbjct:  518 REGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEIL 693          

HSP 10 Score: 73.9442 bits (180), Expect = 1.536e-14
Identity = 40/165 (24.24%), Postives = 80/165 (48.48%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G   +H+A      +VA +++D G++       G  P+H A+ +  LE+  +LLE   +    T  G+ P+H A+  GH++++ LLL R+ +I      G+  +H A+    + + ++L + K  ++    +  + L +A     +  V  L+  + L +   RN
Sbjct:  575 GLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRN 739          

HSP 11 Score: 72.4034 bits (176), Expect = 5.319e-14
Identity = 38/170 (22.35%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAF 699
            G+  +HIA     +EV +++++ G+     T  G+ P+H A+  G  +++ LLL R+  I   T  G+  +H A+      + ++L +   ++         P+H AS  G+++++  LL+ +  ++ K     + L  A Q      V  L+  +   + +  N   A 
Sbjct:  608 GYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTAL 777          

HSP 12 Score: 55.0694 bits (131), Expect = 1.953e-8
Identity = 30/116 (25.86%), Postives = 56/116 (48.28%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            +EG+AD V   L      ++    G  ++H+A     V VA I+    +++   T     P+H AS  G ++++  LL     +  +T +G  P+H A+  GH+ ++  LL+   +
Sbjct:  650 QEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEAS 765          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 1.124e-20
Identity = 53/188 (28.19%), Postives = 104/188 (55.32%), Query Frame = 1
Query:   91 DFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWG-MRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNN-MSESILELAIQSKQMDCVQLLI 648
            D +   +   +G+ + V K L          ++G   + +AC  G+ E+A++++   +N+E     G + P+  A+S G ++I+ LLL    D+  ++++G   + YA +GG+ +++++LLE   N+E  +  G  P+  A+SGGH+++ +LLL+R   I+  +N   ES L LA     ++ V+ L+
Sbjct:  100 DNRSLAEACSDGDVNAVRKLLGEGRSVHETTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLL 287          

HSP 2 Score: 79.7221 bits (195), Expect = 2.847e-16
Identity = 45/165 (27.27%), Postives = 85/165 (51.52%), Query Frame = 1
Query:  166 LNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIE--CETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID-CKNNMSESILELAIQSKQMDCVQLLIS 651
            +N   ++    ++ +AC GGF+EVA  +I  G+++E  C T     P+  A+  G LE++  LL    ++   T +G   + YA   GH+++  LLL+   ++E E   G  P+  A+  GH+  ++ L+ +   ++    N   ++L LA     +  V+LL++
Sbjct:  392 INAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCST-----PLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLA 551          

HSP 3 Score: 78.9518 bits (193), Expect = 4.752e-16
Identity = 47/155 (30.32%), Postives = 85/155 (54.84%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETN-SGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCK--NNMSESILELAIQSKQMDCVQLLISV 654
            ++ +AC GG  ++  ++I  G+NIE     G  P+  A++ G + ++ LLL+   DIE ++  +   P+  A SGG  E+++LL+ R  N E  +     P+  A+SGG++ I+K+LL     I+ +  + +  S L LA  +     V+LL+ +
Sbjct:  936 ALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDM 1090          

HSP 4 Score: 77.0258 bits (188), Expect = 1.746e-15
Identity = 44/151 (29.14%), Postives = 81/151 (53.64%), Query Frame = 1
Query:  208 IACMGGFVEVARIIIDCGSNIECET-TWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMR--PIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +A M G     ++++D GS+I  +  T     +  A  +G  E+++LL+ER  ++E    +G+ P+  A+SGG++E+ ++LLER  ++        R   +  A+  GH +  +L++ R   ID +N    + L LA     +D VQLL++
Sbjct: 1074 LAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVN 1224          

HSP 5 Score: 74.3294 bits (181), Expect = 1.392e-14
Identity = 41/163 (25.15%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  166 LNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMR--PIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +N  ++   + ++ +AC  G  EV  ++++  +N+E     G+ P+  A+S G  E+  +LLER  D+        R   +  A+  GH +  +L++ R  +I+  + +G  P+  A++GGHL +++LL+     +D  +N   + L  A +   +  V+ L+
Sbjct: 1094 INAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLV 1256          

HSP 6 Score: 71.633 bits (174), Expect = 1.111e-13
Identity = 45/162 (27.78%), Postives = 83/162 (51.23%), Query Frame = 1
Query:  166 LNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMS-ESILELAIQSKQMDCVQLLI 648
            +NT  ++    ++ +AC  G +E+ R +++ G++ E +T      +  A   G +E+  LLLE    +    +S   P+  A+ GGH E+  LL+ER  N+E  ++ G  P+  A+  GH +++ LLL +   I+ +   + E+ L LA     ++    LI
Sbjct:  259 INTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLI 420          

HSP 7 Score: 68.9366 bits (167), Expect = 7.712e-13
Identity = 44/158 (27.85%), Postives = 80/158 (50.63%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETT-WGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            ++ GH  +  A  GG VEVAR++++ G+ I   +  +    +  A  +G LE++  LLE   D E +T+     +  A   GH E+ +LLLE    +    +    P+  A+ GGH+++  LL++R   ++  N+   + L  A +    + V LL++
Sbjct:  230 NESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLA 387          

HSP 8 Score: 63.929 bits (154), Expect = 2.676e-11
Identity = 29/116 (25.00%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  211 ACMGGFVEVARIIIDCGSNIECETTWGMR--PIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            A  GG+ EV R++++ G+++        R   +  A+ +G  +   L++ R   I+     G  P+  A++GGH ++++LL+    +++  DNR + P+  A   GH+++++ L++
Sbjct: 1142 AASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVK 1257          

HSP 9 Score: 61.2326 bits (147), Expect = 2.009e-10
Identity = 50/198 (25.25%), Postives = 84/198 (42.42%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNS--GMRPIHYASSGGHSEILKLLL----------------------------------ERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMS--ESILELAIQSKQMDCVQLLISVQELFDFINR 681
            + +AC GG  EV  ++I  G+N E        P+  A+S G + I+ +LL    +I   T S  G+ P+  A+  GH+  +KLLL                                  ER  N+E     G+ P+  A+SGG+ ++ ++LL+R   ++     S  ++ L +A         +L+IS     D  N+
Sbjct: 1004 LSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNK 1201          

HSP 10 Score: 56.225 bits (134), Expect = 9.175e-9
Identity = 31/100 (31.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  364 DIEC---ETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMS-ESILELAIQSKQMDCVQLLIS 651
            DI+C   E+N     +  A +GGH +++ +L+ R  NIE  D +G  P+  A++ GH+ +++LLL     I+ ++  + ++ L LA    + + V+LLI+
Sbjct:  923 DIDCIHTESNHDT-ALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLIA 1021          

HSP 11 Score: 47.7506 bits (112), Expect = 4.030e-6
Identity = 30/121 (24.79%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECET-NSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLL 549
            G  ++  AC  G  +VA +++  G+++E E+  G  P+  A+  G +  +  L+ +  D+   T N+    +  A +GGH  +++LLL    +       G   +  A+ GGH  ++  L+
Sbjct:  463 GDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLI 583          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 89.7373 bits (221), Expect = 1.261e-19
Identity = 48/175 (27.43%), Postives = 83/175 (47.43%), Query Frame = 1
Query:  124 GNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            GN + V   L+        + +G  ++H+A   G  EV R ++  G+ ++ +      P+H A+  G LEI+ LLL+     +  T++G  P+H A+  GH ++  +LLE   ++     +G  P+H AS  G +++  LLLQR    D       + L +A          LL+
Sbjct:   59 GNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLL 233          

HSP 2 Score: 81.6481 bits (200), Expect = 5.979e-17
Identity = 46/185 (24.86%), Postives = 81/185 (43.78%), Query Frame = 1
Query:   97 QCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            Q  LQH+   +A                   G+  +H+A   G  +V  I+++ G+++   T  G  P+H AS  G +E+ +LLL+R    +    +G+ P+H AS   + ++  LLL++  +       G  P+H A+    L+I   LL+     +       + L L  Q    D   LL++
Sbjct:  131 QLLLQHMASPDA---------------ATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLA 300          

HSP 3 Score: 78.1814 bits (191), Expect = 7.238e-16
Identity = 40/153 (26.14%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++IE  T  G+ P+H ++  G L I+ +LL+           G   +H A+  G +E+++ LL     ++ +      P+H A+  G L+I++LLLQ     D   +   + L +A +    D   +L+
Sbjct:   15 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILL 167          

HSP 4 Score: 74.3294 bits (181), Expect = 1.229e-14
Identity = 38/153 (24.84%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  +++ G+     T  G+ P+H  +  G  ++ +LLL R  D+   T SG+ P+H A+      + ++L++   ++      G  P+  A   G+++++  LLQ    ++ K     + L  A Q      V LL+
Sbjct:  246 GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 5 Score: 74.3294 bits (181), Expect = 1.309e-14
Identity = 36/134 (26.87%), Postives = 72/134 (53.73%), Query Frame = 1
Query:  247 IIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++D G+N       G  P+H A  +  + ++ LLL+    IE  T SG+ P+H ++  G+  I+ +LL+   +    + RG   +H A+  G  ++++ LL+   ++D K    ++ L +A +  +++ VQLL+
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLL 134          

HSP 6 Score: 74.3294 bits (181), Expect = 1.524e-14
Identity = 43/177 (24.29%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +EG+ D     L+      +   +G   +H+A   G +EVA +++   ++ +     G+ P+H AS     ++  LLL++         +G  P+H A+     EI   LLE          +G+ P+H  +  GH  +  LLL R   ++       S L LA Q  +++  ++L+
Sbjct:  156 REGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV 332          

HSP 7 Score: 73.9442 bits (180), Expect = 1.992e-14
Identity = 40/161 (24.84%), Postives = 75/161 (46.58%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            +HIA   G +E+ ++++   ++ +  T+ G  P+H A+  G  ++  +LLE    +   T  G  P+H AS  G  E+  LLL+R  + +     G+ P+H AS   + ++  LLL +            + L +A +  Q++    L+      + I R 
Sbjct:  118 LHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQ 278          

HSP 8 Score: 72.7886 bits (177), Expect = 4.410e-14
Identity = 37/153 (24.18%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H  +  GH+++  LLL R  ++      G+ P+H A+    + + ++L++    ++    +  + L +A     +  V  L+
Sbjct:  213 GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLL 365          

HSP 9 Score: 68.1662 bits (165), Expect = 1.263e-12
Identity = 35/157 (22.29%), Postives = 72/157 (45.86%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   +H++   G + +  I++  G++       G   +H A+  G  E++  LL     ++ +      P+H A+  G  EI++LLL+   + +   + G  P+H A+  GH  +  +LL+    +        + L +A +  +M+   LL+
Sbjct:   44 VTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL 200          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 2.255e-17
Identity = 39/123 (31.71%), Postives = 68/123 (55.28%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQR 555
            +G  ++H+A   G  EV R ++  G+ ++ +      P+H A+  G LEI+ LLL+     +  T++G  P+H A+  GH ++  +LLE   ++     +G  P+H AS  G +++  LLLQR
Sbjct:  170 RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQR 292          

HSP 2 Score: 80.4925 bits (197), Expect = 1.262e-16
Identity = 40/150 (26.67%), Postives = 81/150 (54.00%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G    A++++D G+N       G  P+H A  +  + ++ LLL+    IE  T SG+ P+H ++  G+  I+ +LL+   +    + RG   +H A+  G  ++++ LL+   ++D K    ++ L +A +  +++ VQLL+
Sbjct:   75 ALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLL 224          

HSP 3 Score: 73.9442 bits (180), Expect = 1.687e-14
Identity = 41/154 (26.62%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G+  +H+A   G  +V  I+++ G+++   T  G  P+H AS  G +E+ +LLL+R    +    +G+ P+H AS   + ++  LLL++  +       G  P+H A+    L+I   LL+     +       + L L  Q    D   LL++
Sbjct:  237 GYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLA 390          

HSP 4 Score: 73.9442 bits (180), Expect = 1.947e-14
Identity = 40/153 (26.14%), Postives = 74/153 (48.37%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    + V  +++  G++IE  T  G+ P+H ++  G L I+ +LL+           G   +H A+  G +E+++ LL     ++ +      P+H A+  G L+I++LLLQ     D   +   + L +A +    D   +L+
Sbjct:  105 GFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILL 257          

HSP 5 Score: 70.4774 bits (171), Expect = 2.624e-13
Identity = 38/153 (24.84%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +E+A  +++ G+     T  G+ P+H  +  G  ++ +LLL R  D+   T SG+ P+H A+      + ++L++   ++      G  P+  A   G+++++  LLQ    ++ K     + L  A Q      V LL+
Sbjct:  336 GYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 6 Score: 68.1662 bits (165), Expect = 1.274e-12
Identity = 37/153 (24.18%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  LEI T LLE   +    T  G+ P+H  +  GH+++  LLL R  ++      G+ P+H A+    + + ++L++    ++    +  + L +A     +  V  L+
Sbjct:  303 GLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLL 455          

HSP 7 Score: 67.3958 bits (163), Expect = 2.753e-12
Identity = 43/177 (24.29%), Postives = 79/177 (44.63%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +EG+ D     L+      +   +G   +H+A   G +EVA +++   ++ +     G+ P+H AS     ++  LLL++         +G  P+H A+     EI   LLE          +G+ P+H  +  GH  +  LLL R   ++       S L LA Q  +++  ++L+
Sbjct:  246 REGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILV 422          

HSP 8 Score: 67.0106 bits (162), Expect = 3.345e-12
Identity = 38/149 (25.50%), Postives = 72/149 (48.32%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G +E+ ++++   ++ +  T+ G  P+H A+  G  ++  +LLE    +   T  G  P+H AS  G  E+  LLL+R  + +     G+ P+H AS   + ++  LLL +            + L +A +  Q++    L+
Sbjct:  208 LHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLL 356          

HSP 9 Score: 61.6178 bits (148), Expect = 1.900e-10
Identity = 35/157 (22.29%), Postives = 72/157 (45.86%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   +H++   G + +  I++  G++       G   +H A+  G  E++  LL     ++ +      P+H A+  G  EI++LLL+   + +   + G  P+H A+  GH  +  +LL+    +        + L +A +  +M+   LL+
Sbjct:  134 VTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL 290          

HSP 10 Score: 60.8474 bits (146), Expect = 2.724e-10
Identity = 37/153 (24.18%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A  G  VE  ++++   + ++  T   +  +H A+  G      +LL++  +      +G  P+H A       +++LLL+   +IE     G+ P+H ++  G+L I+ +LLQ     +  N   E+ L +A ++ Q + V+ L+
Sbjct:   39 GLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLL 191          

HSP 11 Score: 56.6102 bits (135), Expect = 5.558e-9
Identity = 29/120 (24.17%), Postives = 65/120 (54.17%), Query Frame = 1
Query:  289 GMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+ P+H A+  G  +++ +LLE+   I  +T +G+ P+H A+ G H E +++L++    ++      +  +H A+  GH +  K+LL +    + +     + L +A +  ++  ++LL+
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLL 125          

HSP 12 Score: 51.6026 bits (122), Expect = 2.450e-7
Identity = 33/110 (30.00%), Postives = 52/110 (47.27%), Query Frame = 1
Query:  487 GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            G+ P+HCA+  GH Q++++LL++   I  K     S L +A Q   ++CVQ+L+  +         D+I  D +            + LHV   A  C   R  K +LDK
Sbjct:    6 GLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPV------DDITLDYL------------TALHV---AAHCGHYRTAKVLLDK 94          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 52.373 bits (124), Expect = 2.407e-8
Identity = 34/118 (28.81%), Postives = 65/118 (55.08%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLL--LERNCDIECETNSGMRPIHYASSGGHSEILKLLLER-NCNIECEDNRGMR 495
            LK D LN I + QG   +H+A    + EV++ +I+ G+++  +  +   P+H A+S G L+++ LL  L ++  +  +   G  P+ +A + GH +   LL+E+     +  DN+G +
Sbjct:   96 LKPD-LNKITN-QGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSA-VNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAK 210          

HSP 2 Score: 51.6026 bits (122), Expect = 3.757e-8
Identity = 35/134 (26.12%), Postives = 64/134 (47.76%), Query Frame = 1
Query:  166 LNTIVDDQGHYSIHIACMGGFVEVARIIID--CGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLL--LERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQR 555
            L+   DD G    HIAC  G +EV + + D     ++   T  G+  +H A  +   E+   L+E    +  +      P+H A+S G  ++++LL  L ++  +  +D +G  P+  A + GH     LL+++
Sbjct:   64 LDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSA-VNWQDKQGWTPLFHALAEGHGDAAVLLVEK 196          

HSP 3 Score: 49.2914 bits (116), Expect = 2.578e-7
Identity = 34/123 (27.64%), Postives = 59/123 (47.97%), Query Frame = 1
Query:  289 GMRPIHYASSRGCLEILTLLLER--NCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ-RKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G  P H A S G LE++  L +R    D+   TN G+  +H A      E+ + L+E   ++  +D     P+H A+S G L++++LL    K  ++ ++    + L  A+     D   LL+
Sbjct:   72 GWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLV 194          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 50.447 bits (119), Expect = 3.529e-7
Identity = 39/176 (22.16%), Postives = 70/176 (39.77%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNI-ECETTWGMRPIHYASSRGCLEILTLLLER---------------------------------------NCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELA 609
            +H AC+     VA+ ++  G+N  +     G   +H+A+  G + I+ LLL+                                        N DI+ + N+   P+ +A+  G    ++LLL+    +   DNRG   +HCA  GG  +++  L+        +NN  +   +LA
Sbjct:   88 LHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLA 263          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 47.3654 bits (111), Expect = 3.077e-6
Identity = 22/53 (41.51%), Postives = 31/53 (58.49%), Query Frame = 1
Query:  397 PIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQR 555
            PI YA   GHSE++  LL+ N  ++ ED+ G  P+  A    H+ +L  LLQR
Sbjct:  595 PIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQR 647          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 46.595 bits (109), Expect = 5.287e-6
Identity = 36/121 (29.75%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERN-CDIECETNSGMRPIHYASSGGHSEILKLLLER--NCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            S HIA      +   I  D G         G   +  A  +G  +++  ++E    DI  + N+G   +H A+  GH EI++LL+E   + NI+  +  G  P+  AS+ GHL ++K LL+
Sbjct:  309 SSHIAVSKRPKQKKGIYRDSG---------GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLK 420          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 71.2478 bits (173), Expect = 6.093e-14
Identity = 56/227 (24.67%), Postives = 95/227 (41.85%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEIL--------------------------KLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFD 702
             FL  +  G+ D V K L         +  G  ++H AC+    ++ ++++D G++++     G   +H A+S G +EI   L+E   D+    N G  P+  A      ++L                          +  L +NC  E +D      +H ASS G+L+++ LLLQ    I+ K+  + + L  A    Q D  +LL   +   DF  RN  +  D
Sbjct:   52 VFLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL--SENGADFNARNKMVGID 276          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 64.3142 bits (155), Expect = 1.674e-12
Identity = 43/136 (31.62%), Postives = 67/136 (49.26%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMR---PIHYASSRGCLE-ILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECED-NRGMRPIHCASSGGHLQILKL 543
            LKS     +    G   IH A M G  E  R+++  GS+   +T   +R   P+HYA+  G L+  + +L+ER  D+E     G R IH AS  G  ++L  LL+   +IE +   R +  +H A+  G + +  L
Sbjct:   17 LKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLDAGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          

HSP 2 Score: 52.373 bits (124), Expect = 2.161e-8
Identity = 28/89 (31.46%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  301 IHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDN---RGMRPIHCASSGGHLQ-ILKLLLQR 555
            +HYA+  G  + + LLL+    +      G RPIH A+  GH+E +++LL    +   +     R M P+H A+  GHL   +++L++R
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMER 89          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Match: EDO34161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ63])

HSP 1 Score: 62.3882 bits (150), Expect = 2.351e-12
Identity = 28/73 (38.36%), Postives = 46/73 (63.01%), Query Frame = 1
Query:  232 EVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLL 450
            EV +  I  G++   +   G  P+H A +RG LE++ +L++   D+   +N G+RP+H A+ GGH E+L+LLL
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLL 73          

HSP 2 Score: 58.5362 bits (140), Expect = 5.054e-11
Identity = 24/73 (32.88%), Postives = 46/73 (63.01%), Query Frame = 1
Query:  331 EILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLL 549
            E++   + +  D   + N+G  P+H A + G  E++K+L++   ++    N G+RP+H A+ GGH+++L+LLL
Sbjct:    1 EVVKQCILQGADPTAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLL 73          

HSP 3 Score: 48.9062 bits (115), Expect = 1.266e-7
Identity = 24/73 (32.88%), Postives = 41/73 (56.16%), Query Frame = 1
Query:  172 TIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSG 390
            T  D+ G   +H AC  G +EV ++++  G+++   +  G+RP+H A+  G +E+L LLL    D    T +G
Sbjct:   14 TAKDNAGWTPLHEACARGKLEVVKVLVQYGADVNAHSNDGIRPLHDAAEGGHVEVLRLLLTYGADPMLATYAG 86          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 66.6254 bits (161), Expect = 5.074e-12
Identity = 42/153 (27.45%), Postives = 80/153 (52.29%), Query Frame = 1
Query:  238 ARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERN-CDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQE---LFDFINRN 684
            +++++D G+ I+ +    + PIHYA+  G +  +  LL+R+   I  E  +   P+H A+  GH+ ++K LL R   I+  +     P+ CA++ G +++  +LL     +D  +    + L LA +   ++ V+LL+S +    L D   RN
Sbjct:  266 SQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRN 418          

HSP 2 Score: 63.5438 bits (153), Expect = 5.174e-11
Identity = 40/142 (28.17%), Postives = 68/142 (47.89%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYS---IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQI 534
            K G    V   LK D    I++D+   S   +H+A + G   V + ++  G  I+        P+  A++RG +E+  +LL+ +  ++    +   P+H AS  GH E++KLLL R  NI   D+ G   +  A    H ++
Sbjct:  292 KFGRVRTVCALLKRD--PAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEV 431          

HSP 3 Score: 49.6766 bits (117), Expect = 1.357e-6
Identity = 56/228 (24.56%), Postives = 98/228 (42.98%), Query Frame = 1
Query:  292 MRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLL----------ERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDC-KNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMA-IECNADRIVKCILDKTVDDEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQ 939
            M P+H A S GC+ +   L+E   D+       M P+H+A   G+  + KLL             +  +  +D      +H A  GGH  + KL L++   ++  K + +++  +  + +++  C+ ++I V +L           +    KS    RE +   L+  D+  I C   R   CI  +  D    KDT     +EKN  D +R +    L++  DIA +
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARE--CIFVMIKVSKL----------KYLSFCKSEKIKREIL---LYFFDVVIIICYIIRFRACIECRDKD----KDTPLMIAAEKNHVDTVRTL----LQHGADIAAK 209          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 64.3142 bits (155), Expect = 5.341e-12
Identity = 42/136 (30.88%), Postives = 73/136 (53.68%), Query Frame = 1
Query:  217 MGGFVEVARIIIDCGSNIECETTWGM-RPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC--NIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQ 615
            + G V+VA +++D G+ I  E+      P+ +A  +G  +++ LLL R+ +IE  T  G  P+ +A+ GGH+++   LLE+    NI    N  + P+  A   GH  ++KLLL+    I+ +     + L LA +
Sbjct:   62 LAGHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDI-PLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAAR 196          

HSP 2 Score: 56.225 bits (134), Expect = 3.171e-9
Identity = 33/111 (29.73%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  322 GCLEILTLLLERNCDIECETNSGM-RPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESI-LELAIQSKQMDCVQLLI 648
            G +++ T+LL+   +I  E++S    P+ +A   GH ++++LLL R+ NIE     G  P+  A+ GGH  +   LL++  +++  +  +  I L  A      D V+LL+
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLL 174          

HSP 3 Score: 50.447 bits (119), Expect = 2.757e-7
Identity = 32/117 (27.35%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  166 LNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMR-PIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCAS 513
            +N   D      +  AC  G  +V  +++   +NIE  T  G  P+ +A+  G  ++   LLE+   +   + S    P+  A   GH +++KLLL+   NIE     G  P+  A+
Sbjct:   79 INVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAA 195          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 6.994e-26
Identity = 61/209 (29.19%), Postives = 108/209 (51.67%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++ +  + + P+H AS  G+S +++LLLER   I+     G+ P+HCA+  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+           + ++  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  181 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL-----------HHDVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKVIVDKKAN 368          

HSP 2 Score: 92.8189 bits (229), Expect = 2.973e-20
Identity = 44/140 (31.43%), Postives = 77/140 (55.00%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G + VA ++++ G+ ++ +    + P+H AS RG   ++ LLLER   I+  T  G+ P+H A+  GH +++++LL R   I  +   G+ P+H A+ G HL  ++LLL     +D
Sbjct:  198 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVD 337          

HSP 3 Score: 78.1814 bits (191), Expect = 2.269e-15
Identity = 39/149 (26.17%), Postives = 82/149 (55.03%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   + R++++ GS I+  T  G+ P+H A+  G  +++ +LL R   I  +T +G+ P+H A+ G H   ++LLL  +  ++   N  +  +H A+  GH ++ K+++ +K   + K     + L +A +  ++  ++LL+
Sbjct:  248 LHVASKRGNSNMVRLLLERGSKIDARTKDGLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLL 396          

HSP 4 Score: 77.7962 bits (190), Expect = 2.955e-15
Identity = 46/177 (25.99%), Postives = 83/177 (46.89%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            + GN +    YL++     I +  G  ++H+A   G VEV   +I  G+N++  T  G   +H AS  G  E++  L+    ++  ++ +G  P++ A+   H ++++LLLE   +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+
Sbjct:   26 RAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLL 198          

HSP 5 Score: 68.1662 bits (165), Expect = 4.266e-12
Identity = 37/146 (25.34%), Postives = 69/146 (47.26%), Query Frame = 1
Query:  211 ACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            A   G +E A   +  G +I      G+  +H AS  G +E++  L+++  +++  T  G   +H AS  G +E++K L+    N+  +   G  P++ A+   HL +++LLL+             + L +A+Q      V LL+
Sbjct:   24 AARAGNLEKALDYLQNGVDINICNQNGLNALHLASKEGHVEVVAELIKQGANVDAATKKGNTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLL 169          

HSP 6 Score: 62.3882 bits (150), Expect = 3.005e-10
Identity = 32/128 (25.00%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDC 573
            G   +H A   G  +V  ++++ G+ I  +T  G+ P+H A+    L  + LLL  +  ++  TN  +  +H A+  GH ++ K+++++  N   +   G  P+H A     +++++LLL+    I  
Sbjct:  277 GLTPLHCAARSGHEQVVEMLLNRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASIQA 404          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 2.930e-24
Identity = 60/209 (28.71%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + E+  G  P+H A+  G + + TLLL R   ++    + + P+H A+  G+S ++KLLL+R   IE +   G+ P+HC +  GH Q++++LL R   I  K     S L +A Q   ++CVQLL+             ++  D +  ++D++     + LHV   A  C   ++ K I+DK  +
Sbjct:  181 ALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQ-----------HDVPVDDV--TNDYL-----TALHV---AAHCGHYKVAKLIVDKKAN 368          

HSP 2 Score: 90.1225 bits (222), Expect = 2.117e-19
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            L++D    +    G   +HIA   G + VA ++++  + ++      + P+H A+ RG   ++ LLL+R   IE +T  G+ P+H  +  GH +++++LL+R   I  +   G+ P+H A+ G HL  ++LLLQ    +D   N   + L +A         +L++
Sbjct:  198 LQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIV 363          

HSP 3 Score: 84.7297 bits (208), Expect = 1.278e-17
Identity = 62/254 (24.41%), Postives = 112/254 (44.09%), Query Frame = 1
Query:  100 CFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFINRNDEIAFDKI---------WKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
             +L+  + GN + V  YLKS     I +  G  ++H+A   G VEV   ++  G++++  T  G   +H +S  G  E++T L+    ++  ++ +G  P++ A+   H E+++ LLE + +       G  P+  A   GH Q++ LLL+     D K  +    L +A +        LL+       V+    F   +    +  I           + DF+  N  + LHV   A +     +VK +LD+
Sbjct:   20 SYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHV---AAKRGNSNMVKLLLDR 266          

HSP 4 Score: 82.0333 bits (201), Expect = 1.009e-16
Identity = 51/205 (24.88%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI----SVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKC 804
            +H+A   G   + ++++D G+ IE +T  G+ P+H  +  G  +++ +LL+R   I  +T +G+ P+H A+ G H   ++LLL+ +  ++   N  +  +H A+  GH ++ KL++ +K   + K     + L +A +  ++  ++LL+    S+Q +        E     I  ++    ENI S L  ++     N   +V C
Sbjct:  248 LHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAV-------TESGLTPIHVAAFMGHENIVSAL--INHGASPNTTNVVSC 443          

HSP 5 Score: 59.6918 bits (143), Expect = 1.888e-9
Identity = 27/89 (30.34%), Postives = 48/89 (53.93%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCN 465
            ++H+A   G  +VA++I+D  +N   +   G  P+H A  +  + ++ LLL+    I+  T SG+ PIH A+  GH  I+  L+    +
Sbjct:  346 ALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGAS 434          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Match: ENSORLT00000006308.2 (pep primary_assembly:ASM223467v1:1:12516834:12530692:1 gene:ENSORLG00000005003.2 transcript:ENSORLT00000006308.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 2.982e-23
Identity = 58/209 (27.75%), Postives = 103/209 (49.28%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVD 825
            ++HIA      + A +++    N + ++  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ ++ LLL+R   I+ +   G+ P+HCA+  GH   ++LLL+R   I  +     S L ++ Q   ++CV+LL+  Q         D++  D +            + LHV   A  C   R+ K +LDK  +
Sbjct:  151 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPV------DDVTLDYL------------TALHV---AAHCGHYRVTKVLLDKKAN 338          

HSP 2 Score: 98.2117 bits (243), Expect = 3.124e-22
Identity = 46/140 (32.86%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G V V+ ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH   ++LLLER   I      G+ P+H ++ G H++ +KLLLQ +  +D
Sbjct:  168 LQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVD 307          

HSP 3 Score: 77.7962 bits (190), Expect = 2.291e-15
Identity = 42/153 (27.45%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A   G   +  +++D G+ I+ +T  G+ P+H A+  G    + LLLER   I   T +G+ P+H ++ G H E +KLLL+    ++      +  +H A+  GH ++ K+LL +K   + +     + L +A +  ++  ++LL+
Sbjct:  214 GITPLHVASKRGNTNMVALLLDRGAQIDAKTRDGLTPLHCAARSGHDPAVELLLERGAPILARTKNGLSPLHMSAQGDHIECVKLLLQHQAPVDDVTLDYLTALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLV 366          

HSP 4 Score: 73.9442 bits (180), Expect = 4.918e-14
Identity = 47/206 (22.82%), Postives = 88/206 (42.72%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC-----------------------------NIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            KEG+ D V + L+          +G+ ++HIA + G  EV ++++  G+++  ++  G  P++ A+    LE++   LE   +    T  G  P+  A   GH+ ++ LLLE +                              N + +   G  P+H A+  G++ +  LLL R   +D       + L +A +    + V LL+
Sbjct:   29 KEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEHDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTNMVALLL 234          

HSP 5 Score: 70.8626 bits (172), Expect = 4.380e-13
Identity = 56/243 (23.05%), Postives = 101/243 (41.56%), Query Frame = 1
Query:  133 DGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS------VQELFDFINRNDEIAFDKIWKSS---------DFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            D V ++LK+    +  +  G  ++H+A   G  ++   ++  G+ ++  T  G   +H AS  G  E++ LL+ R  D+  ++ +G  P++ A+   H E+++  LE   N       G  P+  A   GH  ++ LLL+     D K  +    L +A +        LL+       VQ    F   +    +  +  S+         DF   N  + LHV       N   +V  +LD+
Sbjct:    1 DKVLEFLKNGVDISTCNQNGLNALHLAAKEGHKDLVEELLQRGAPVDSATKKGNTALHIASLAGQKEVVKLLVSRGADVNAQSQNGFTPLYMAAQENHLEVVRYFLENEGNQSIATEDGFTPLAIALQQGHNSVVSLLLEH----DTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVSTLLLNRGAAVDFTARNGITPLHVASKRGNTN---MVALLLDR 236          

HSP 6 Score: 57.3806 bits (137), Expect = 1.213e-8
Identity = 26/94 (27.66%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECED 480
            ++H+A   G   V ++++D  +N       G  P+H A  +  ++++ LL++    I+  T SG+ PIH A+  GH  I+ LLL+   + +  +
Sbjct:  316 ALHVAAHCGHYRVTKVLLDKKANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVRN 409          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 94.3597 bits (233), Expect = 2.414e-20
Identity = 56/206 (27.18%), Postives = 98/206 (47.57%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA        A +++    N +  +  G  P+H A+    + +  LLL R  ++     +G+ P+H AS  G+  +++LLL+R   I+ +    + P+HCA+  GH++I+++LL+    I  K     S + +A Q   MDC      V++L  +    D+I  D +            + LHV   A  C   R+ K +LDK
Sbjct:  174 ALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDC------VRQLLQYNAEIDDITLDHL------------TPLHV---AAHCGHHRMAKVLLDK 358          

HSP 2 Score: 91.2781 bits (225), Expect = 2.516e-19
Identity = 45/140 (32.14%), Postives = 79/140 (56.43%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    ++   G   +HIA     + VA+++++ G+N+      G+ P+H AS RG + ++ LLL+R   I+ +T   + P+H A+  GH  I+++LLE    I+ +   G+ PIH A+ G H+  ++ LLQ    ID
Sbjct:  191 LQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEID 330          

HSP 3 Score: 90.8929 bits (224), Expect = 3.130e-19
Identity = 45/165 (27.27%), Postives = 86/165 (52.12%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            G+  +HIA     +EVA +++  G++  CE+  G+ P+H AS  G  +++ +L+ +  ++     +G+ P+H  +  GH  I   L+++  ++      G  P+H A   G+++++K LLQ++  ++ K  M  + L  A Q    D V LL+    L + I  N
Sbjct:  600 GYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSN 764          

HSP 4 Score: 88.9669 bits (219), Expect = 1.455e-18
Identity = 49/165 (29.70%), Postives = 83/165 (50.30%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRN 684
            GH  +HIA   G +   RI++D G+     T  G  P+H AS  G +++  LLLER  +      +G+ P+H A    + +++KLL+ +  +       G  P+H A+    +++  +LLQ     +C++    + L LA Q  + D V +LIS Q   +  N+N
Sbjct:  501 GHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKN 665          

HSP 5 Score: 84.7297 bits (208), Expect = 3.501e-17
Identity = 44/149 (29.53%), Postives = 83/149 (55.70%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G V + R+++D G+ I+ +T   + P+H A+  G + I+ +LLE    I+ +T +G+ PIH A+ G H + ++ LL+ N  I+      + P+H A+  GH ++ K+LL +  + + +     + L +A +   M  + LL+
Sbjct:  241 LHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLL 389          

HSP 6 Score: 83.9593 bits (206), Expect = 6.413e-17
Identity = 42/149 (28.19%), Postives = 78/149 (52.35%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +H+A   G   +A++++D G+        G  P+H A  +  +  + LLL+ +  +E  T SG+ P+H A+  GH  I+K LL+R  +    + +   P+H AS  GH ++ + LLQ   ++D +    ++ L  A +    + V+LL+
Sbjct:  340 LHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLL 488          

HSP 7 Score: 80.1073 bits (196), Expect = 9.073e-16
Identity = 41/153 (26.80%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    +    +++   +++E  T  G+ P+H A+  G L I+  LL+R             P+H AS  GH E+ + LL+    ++        P+HCA+  GH +++KLLL  K   D       + L +A +   +  +++L+
Sbjct:  369 GFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILL 521          

HSP 8 Score: 77.411 bits (189), Expect = 7.152e-15
Identity = 40/150 (26.67%), Postives = 75/150 (50.00%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            +H+A   G  EVA+ ++   + ++        P+H A+  G  E++ LLL+   + +  T +G  P+H A+  GH   +++LL+          +G  P+H AS  G + + +LLL+R    +       + L +A+    +D V+LL+S
Sbjct:  439 LHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVS 588          

HSP 9 Score: 74.3294 bits (181), Expect = 7.516e-14
Identity = 50/196 (25.51%), Postives = 89/196 (45.41%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC-------------NIECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDE 690
            +H A   G V +  I+++ G+ I+ +T  G+ PIH A+    ++ +  LL+ N +I+  T   + P+H A+  GH  + K+LL++               +I C+ N                     G+ P+H A+  GHL I+K LLQR    +  N   E+ L +A ++   +  Q L+      D   ++D+
Sbjct:  274 LHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQ 469          

HSP 10 Score: 74.3294 bits (181), Expect = 8.218e-14
Identity = 35/156 (22.44%), Postives = 77/156 (49.36%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ 657
            G   +H+A     ++V ++++  G +       G  P+H A+ +  +E+ ++LL+      CE+  G+ P+H AS  G  +++ +L+ +  N+   +  G+ P+H  +  GH+ I   L+++   +   + M  + L +A     +  V+ L+  Q
Sbjct:  567 GLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQ 722          

HSP 11 Score: 73.1738 bits (178), Expect = 1.534e-13
Identity = 43/156 (27.56%), Postives = 75/156 (48.08%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            DDQ    +H A   G  E+ ++++D  +N +  TT G  P+H A+  G +  + +LL+        T  G  P+H AS  G  ++ +LLLER  N       G+ P+H A    +L ++KLL+ +            + L +A +  Q++   +L+
Sbjct:  467 DDQT--PLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLL 620          

HSP 12 Score: 72.0182 bits (175), Expect = 4.389e-13
Identity = 40/177 (22.60%), Postives = 82/177 (46.33%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +EG+   +   L +      +  +G   +H+A   G V+VA ++++ G+N       G+ P+H A     L+++ LL+ +         +G  P+H A+     E+  +LL+   +  CE  +G+ P+H AS  G   ++ +L+ ++  ++  N    + L L  Q   +     L+
Sbjct:  510 REGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLV 686          

HSP 13 Score: 70.8626 bits (172), Expect = 9.683e-13
Identity = 42/162 (25.93%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  178 VDDQGHYSIHIACMGGFVEVARIIIDCG-----SNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            V + G   +H+A   G + + + ++  G     SN++ ET     P+H AS  G  E+   LL+    ++        P+H A+  GH E++KLLL+   N +     G  P+H A+  GH+  +++LL    +         + L +A +  ++D  +LL+
Sbjct:  398 VTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVET-----PLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLL 554          

HSP 14 Score: 66.2402 bits (160), Expect = 2.615e-11
Identity = 37/149 (24.83%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLL 549
            FL+  + GN D    ++K+     I +  G   +H+A   G V++   ++  G  +E  T  G   +H A+  G  +++  L+    ++  +++ G  P++ A+   H E++K LLE   N       G  P+  A   GH  ++ LL+
Sbjct:   14 FLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLI 162          

HSP 15 Score: 63.929 bits (154), Expect = 1.595e-10
Identity = 46/195 (23.59%), Postives = 91/195 (46.67%), Query Frame = 1
Query:  118 KEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQ---ILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQ---ELFDFINRN 684
            +EG  D V   +       + +  G   +H+    G V +A  ++  G+++   +  G  P+H A   G ++++  LL++   +  +T  G  P+H A+  GH++I+ LLL+         + G  P+  A   G++    +LKL+ +       + +  E++ E+   S+    + LL  +Q   EL DF+ +N
Sbjct:  642 QEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVTEESVSTH-RMSFPETVDEILDVSEDEVILSLLFFLQEEAELLDFVLQN 835          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 92.0485 bits (227), Expect = 1.475e-19
Identity = 54/206 (26.21%), Postives = 102/206 (49.51%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDK 816
            ++HIA      + A +++    N + ++  G  P+H A+  G + + TLLL R   ++    +G+ P+H AS  G++ +++LLL+R   I+ +   G+ P+HCA+  GH   +++LL++   +  +     S L +A Q   ++CV+ L+  +         D++  D +            + LHV   A  C   R+ K +LDK
Sbjct:  196 ALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPV------DDVTLDYL------------TALHV---AAHCGHYRVTKLLLDK 380          

HSP 2 Score: 91.2781 bits (225), Expect = 2.028e-19
Identity = 45/140 (32.14%), Postives = 78/140 (55.71%), Query Frame = 1
Query:  151 LKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRID 570
            L++D    +    G   +HIA   G V VA ++++ G+ ++     G+ P+H AS RG   ++ LLL+R   I+ +T  G+ P+H A+  GH   +++LLE+   +      G+ P+H A+ G H++ +K LLQ K  +D
Sbjct:  213 LQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVD 352          

HSP 3 Score: 81.2629 bits (199), Expect = 4.889e-16
Identity = 47/182 (25.82%), Postives = 89/182 (48.90%), Query Frame = 1
Query:  103 FLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            FL+  + GN D V +YLK     +  +  G  ++H+A   G +++ + ++D G+ ++  T  G   +H +S  G  E++  L++R  DI  ++ +G  P++ A+   H ++++ LLE   N       G  P+  A   GH Q++ +LL+     D K  +    L +A +        LL+
Sbjct:   36 FLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN----DTKGKVRLPALHIAARKDDTKSAALLL 213          

HSP 4 Score: 79.337 bits (194), Expect = 2.060e-15
Identity = 40/150 (26.67%), Postives = 80/150 (53.33%), Query Frame = 1
Query:  199 SIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            ++H+A   G   V ++++D  +N       G  P+H A  +  ++++ LL++    I+  T SG+ PIH A+  GH  I+ LLL+   + +  + RG   +H A+  G  ++++ LL+    +D +    ++ L +A +  + + VQLL+
Sbjct:  361 ALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLL 510          

HSP 5 Score: 78.1814 bits (191), Expect = 4.579e-15
Identity = 42/153 (27.45%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +HIAC    V+V  +++  G++I+  T  G+ PIH A+  G L I+ LLL+     +     G   +H A+  G +E+++ LL     ++        P+H AS  G  +I++LLLQ     D       + L ++ +  Q++   +L+
Sbjct:  391 GFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLL 543          

HSP 6 Score: 77.411 bits (189), Expect = 7.771e-15
Identity = 58/229 (25.33%), Postives = 93/229 (40.61%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSG---------------------------------GHSEILKLLLERNCN-------------IECEDNR--------------------GMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDE 690
            +H+A   G   + R+++D GS I+ +T  G+ P+H A+  G    + +LLE+   +   T +G+ P+H A+ G                                 GH  + KLLL++  N             I C+ NR                    G+ PIH A+  GHL I+ LLLQ     D  N   E+ L +A ++ Q + V+ L+    + D   R D+
Sbjct:  263 LHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQ 491          

HSP 7 Score: 75.485 bits (184), Expect = 2.845e-14
Identity = 45/154 (29.22%), Postives = 70/154 (45.45%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +G  S+H+A   G  EV R ++  G+ ++        P+H AS  G  EI+ LLL+     +  T +G  P+H ++  G  E   +LLE   +      +G  P+H  S  G L + KLLLQR+   D       + L +A          LL+
Sbjct:  456 RGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLL 609          

HSP 8 Score: 74.7146 bits (182), Expect = 6.079e-14
Identity = 41/154 (26.62%), Postives = 73/154 (47.40%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLIS 651
            G+  +HI+   G +E A ++++ G++    T  G  P+H  S  G L++  LLL+R    +    +G+ P+H A+   + ++  LLL++  +       G  P+H A+    + I  +LLQ     +       + L LA Q    D   LL+S
Sbjct:  523 GYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMS 676          

HSP 9 Score: 68.9366 bits (167), Expect = 4.157e-12
Identity = 40/149 (26.85%), Postives = 71/149 (47.65%), Query Frame = 1
Query:  202 IHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            +HIA   G  E+ ++++   ++ +  TT G  P+H ++  G LE  ++LLE        T  G  P+H  S  G  ++ KLLL+R    +     G+ P+H A+   + ++  LLL +            + L +A +  QMD   +L+
Sbjct:  494 LHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLL 642          

HSP 10 Score: 65.0846 bits (157), Expect = 6.056e-11
Identity = 35/153 (22.88%), Postives = 71/153 (46.41%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G+  +HIA     +++A +++  G+     T  G+ P+H AS  G  ++  LL+ +   I   T SG+  +H A+      + ++L+    N++ +   G  P+  A   G+ +++  LLQ    ++ K     + L  A Q      + +L+
Sbjct:  622 GYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLL 774          

HSP 11 Score: 64.3142 bits (155), Expect = 1.248e-10
Identity = 35/153 (22.88%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  190 GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLI 648
            G   +H+A      +VA +++D G++       G  P+H A+ +  ++I T+LL+   +    T  G+ P+H AS  GH+++  LL+ +   I      G+  +H A+    + + ++L++    +D +  +  + L +A        V  L+
Sbjct:  589 GLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLL 741          

HSP 12 Score: 59.6918 bits (143), Expect = 3.425e-9
Identity = 29/122 (23.77%), Postives = 63/122 (51.64%), Query Frame = 1
Query:  187 QGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ 552
            QG   +H+A   G  ++A +++  G+ I   T  G+  +H A+    + +  +L+    +++ +T  G  P+  A   G+++++  LL+   ++  +   G  P+H A+  G+  I+ +LLQ
Sbjct:  654 QGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQ 775          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Match: SMESG000019753.1 (SMESG000019753.1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 315/350 (90.00%), Postives = 316/350 (90.29%), Query Frame = 1
Query:   85 MGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNS---------------------------------GMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYFN 1035
            MGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSR CLEILTLLLERNCDIECETNS                                 GMRPIHYASSGGHSEILKLL+ERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYFN
Sbjct:    1 MGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRSCLEILTLLLERNCDIECETNSRMRPIHYASSGGHSEILKLLVERNCNIECEDNRGMRPIHYASSGGHSEILKLLVERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYFN 350          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Match: SMESG000043462.1 (SMESG000043462.1)

HSP 1 Score: 322.398 bits (825), Expect = 3.017e-108
Identity = 173/353 (49.01%), Postives = 220/353 (62.32%), Query Frame = 1
Query:   85 MGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNC---------------------------------NIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDD----EEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYF 1032
            MGDFQCF +HL  GN +GV   LK +F++ IVD+ G++ IHI C  GF+ V R+++DC  NIECE   GMRPIH+AS  G LEIL LLL+RNC+IECE   G  PIHYAS  GHSEILKLLL+RNC                                 NIECE+  G R +H ASS GH +ILKLLLQRKCR DCK    +S L+LA Q   +DCV+LL  V++ F  I R+D I  + ++ S +FI+ NIY+GL+VL+MAI  NA++IVKCILDK+VD+    E     N     E+N+ D    +C+IC + PV I FQCGHL C  CS +   C  C+A I  R K++F
Sbjct:    1 MGDFQCFKEHLMNGNVEGVRNNLKWEFVDKIVDNDGNFPIHIVCRNGFLSVVRLLLDCNCNIECEDKCGMRPIHWASENGHLEILKLLLDRNCNIECENRWGRIPIHYASGNGHSEILKLLLDRNCNIECQDKWGNRPIHWACRNGHSEILKLLLDRNCNIECENKSGRRSVHFASSNGHSEILKLLLQRKCRFDCKTKDGKSPLDLAKQFNNVDCVELLTHVEKFFAIIARDDPIEIENLFISFNFIQPNIYTGLNVLEMAINNNAEKIVKCILDKSVDNKAEIERSHRNNAKLSKEENQPDNEIPMCHICQDNPVSIGFQCGHLTCNVCSDQLFECPYCKADIVSRIKMFF 353          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Match: SMESG000010464.1 (SMESG000010464.1)

HSP 1 Score: 296.204 bits (757), Expect = 9.100e-92
Identity = 152/257 (59.14%), Postives = 184/257 (71.60%), Query Frame = 1
Query:   64 NSKKYFMMGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEE 834
            N K    MGDF  F QHL  GNA+GV + L+ +F   IVD  G + IHIAC  GFV+ ARI++D   NIECET  GMRPIH+AS +G  EI+ LL +R C IECE  SG RPIH A++ GHSEILKLLLERNCNIECED  G RPIH ASSGGH ++LKLLLQRKC I+CK     S L+LA +  +  CVQLL  V+ LF  I  +D IAF  + KSSDFIR+N+Y+GL VL+ AI+ NA+ I+KCILDK +DD+E
Sbjct:   27 NQKGNIKMGDFIYFKQHLMNGNAEGVRENLRREFAYKIVDKHGKFPIHIACRDGFVDTARILLDINCNIECETKSGMRPIHWASMKGHSEIVKLLNDRYCSIECEDKSGSRPIHCATTEGHSEILKLLLERNCNIECEDKWGRRPIHLASSGGHSELLKLLLQRKCLINCKTKSGMSPLDLAKKFNRAKCVQLLTHVENLFAIIEWDDPIAFYDLCKSSDFIRQNLYTGLAVLEKAIDSNANNIIKCILDKLIDDKE 283          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Match: SMESG000010464.1 (SMESG000010464.1)

HSP 1 Score: 295.434 bits (755), Expect = 2.427e-91
Identity = 152/257 (59.14%), Postives = 184/257 (71.60%), Query Frame = 1
Query:   64 NSKKYFMMGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEE 834
            N K    MGDF  F QHL  GNA+GV + L+ +F   IVD  G + IHIAC  GFV+ ARI++D   NIECET  GMRPIH+AS +G  EI+ LL +R C IECE  SG RPIH A++ GHSEILKLLLERNCNIECED  G RPIH ASSGGH ++LKLLLQRKC I+CK     S L+LA +  +  CVQLL  V+ LF  I  +D IAF  + KSSDFIR+N+Y+GL VL+ AI+ NA+ I+KCILDK +DD+E
Sbjct:   27 NQKGNIKMGDFIYFKQHLMNGNAEGVRENLRREFAYKIVDKHGKFPIHIACRDGFVDTARILLDINCNIECETKSGMRPIHWASMKGHSEIVKLLNDRYCSIECEDKSGSRPIHCATTEGHSEILKLLLERNCNIECEDKWGRRPIHLASSGGHSELLKLLLQRKCLINCKTKSGMSPLDLAKKFNRAKCVQLLTHVENLFAIIEWDDPIAFYDLCKSSDFIRQNLYTGLAVLEKAIDSNANNIIKCILDKLIDDKE 283          

HSP 2 Score: 65.4698 bits (158), Expect = 3.344e-11
Identity = 46/173 (26.59%), Postives = 87/173 (50.29%), Query Frame = 1
Query:  547 LQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWK--SSDFIRENIYSGLHVLDMAIECNAD--RIV---KCILDKTVD---DEEPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYFN 1035
            + +K  ++ KN  ++S ++LAI++ Q+D + LLI   E  D  + N + A  ++ +  S      N    +  +  A+    D  +I    + ILD   +     E ++ +  + +  N        C IC++ P+++ FQCGHL C+ C+ +   CH+CR +I  + K++FN
Sbjct:  817 INKKKFVNLKNRRNQSAVQLAIKADQLDLIDLLIHESEGLDCEDTNGKSALGQLMEKLSISNNEHNHERLISAVKSAMRSGGDIYKITTKGRRILDSCTNMDAKAEIEEFHRRQPTNINPTGNEANTCTICMDKPLNMVFQCGHLCCSDCADQIFECHMCRIEILTKTKLFFN 989          
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Match: SMESG000019959.1 (SMESG000019959.1)

HSP 1 Score: 273.478 bits (698), Expect = 4.231e-83
Identity = 144/284 (50.70%), Postives = 190/284 (66.90%), Query Frame = 1
Query:   85 MGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQ-GHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLL---------------------------------LQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDEE 834
            MGDFQ F +HL +GNA+ V   L   F++ IVDD+ G++ IHIAC  GFVEVA++++D   N  CET  G RPIHYAS +G  EI+ LLL+RNC+ ECE  SG RPIHYAS  GHSEI+KLLL+RNCN ECE   GMRPIH AS  GH +I+KLL                                 LQRKCRIDCKN   +S L+ A +  ++DC++LL ++++LF  I R+D I  +K++ S +FIRENIY+GL+VL+MA+  NAD+I+K ILDK++D++E
Sbjct:    1 MGDFQSFKKHLMKGNAERVRNNLSGGFVDKIVDDKYGYFPIHIACRDGFVEVAKLLLDRNCNTICETKSGDRPIHYASWQGHSEIVKLLLDRNCNTECENESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLFLQRKCRIDCKNKDGKSPLDFAKEYNRVDCMKLLTNMEKLFAIIERDDPIEIEKLFISCEFIRENIYTGLNVLEMAMTSNADKIIKWILDKSIDNKE 284          

HSP 2 Score: 120.939 bits (302), Expect = 1.953e-29
Identity = 83/265 (31.32%), Postives = 127/265 (47.92%), Query Frame = 1
Query:  181 DDQGHYSIHIACMGGFVEVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECETNSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQILKLLLQ----------------RKCRIDCK---------------------NNMSESILELAIQSKQMDCVQLLISVQE-----------LFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDE 831
            ++ G+  IH A   G  E+ ++++D   N ECET  GMRPIHYAS  G  EI+ LLL+RNC+ ECE  SG RPIHYAS  GHSEI+KL L+R C I+C++  G  P+  A     +  +KLL                   K  I C+                     + + + IL+ +I +K++D V   ++ ++           L+  I R+    F +   +     +    G   L++A+E   D ++  IL KT+ D+
Sbjct:  100 NESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLFLQRKCRIDCKNKDGKSPLDFAKEYNRVDCMKLLTNMEKLFAIIERDDPIEIEKLFISCEFIRENIYTGLNVLEMAMTSNADKIIKWILDKSIDNKEIDEVIKELTAKDKENANLLKERLLYLCITRHHMRGFKRFHSAEVINGQRRTVGPTFLELAVENGCDLLIDLILRKTIYDK 364          

HSP 3 Score: 56.9954 bits (136), Expect = 1.720e-8
Identity = 48/163 (29.45%), Postives = 76/163 (46.63%), Query Frame = 1
Query:  598 LELAIQSKQMDCVQLLI---------------SVQELFDFINRNDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDE-EPKDTNDHKDS-EKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRASSCHVCRAQITDRRKIYFN 1035
             ++AI+ ++MD V  LI               ++ +L + I+ ++ + F +    S  I+  I  G  +  M       RI+    D    +E E    N+ K S E+N+ D    +C IC    V+I FQCGHLIC  CS +   C  C+A I  R K++F+
Sbjct:  834 FQIAIEIEEMDLVNALIIETKDCHSEDEGGTCALTQLLEKISISNNVNFKRKLILS--IKSIISLGGDIYKMTSR-GQHRIIDACTDSVAKEEIERYHRNNAKPSKEENKPDNEIPMCKICQNKQVNIGFQCGHLICDLCSDQLFECPFCKADIVTRTKMFFS 993          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK31.631e-2428.23ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK25.554e-2328.16ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK37.149e-2328.23ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK37.153e-2328.23ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK37.895e-2328.23ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-445.767e-1629.71AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.767e-1629.71AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.781e-1629.71AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.781e-1629.71AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.794e-1629.71AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank23.514e-2428.23gene:FBgn0261788 transcript:FBtr0303120[more]
Ank25.052e-2428.23gene:FBgn0261788 transcript:FBtr0334062[more]
Ank29.283e-2428.23gene:FBgn0261788 transcript:FBtr0303119[more]
Ank21.703e-2228.23gene:FBgn0261788 transcript:FBtr0334061[more]
Ank21.918e-2228.23gene:FBgn0261788 transcript:FBtr0303118[more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b5.051e-2529.13ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b5.264e-2529.13ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3a1.031e-2228.71ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.031e-2228.71ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
BX469921.11.032e-2228.71ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm42.309e-2228.23tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.315e-2228.23tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.319e-2228.23tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.319e-2228.23tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.328e-2228.23tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank21.556e-2428.23ankyrin 2, brain [Source:MGI Symbol;Acc:MGI:88025][more]
Ank33.603e-2328.64ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.616e-2328.64ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.636e-2328.64ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.677e-2328.64ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|G5E8K5|ANK3_MOUSE2.581e-2228.64Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q12955|ANK3_HUMAN3.791e-2228.23Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|Q54KA7|SECG_DICDI1.129e-2028.49Ankyrin repeat, PH and SEC7 domain containing prot... [more]
sp|O70511|ANK3_RAT3.306e-2027.65Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|Q8C8R3|ANK2_MOUSE4.480e-2028.04Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9HSB72.467e-3136.77AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
Q16FI95.217e-3034.39AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
W4Z5P47.321e-2937.74ANK_REP_REGION domain-containing protein OS=Strong... [more]
Q16FJ05.789e-2833.97AAEL014741-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
A0A4Q2V5092.108e-2633.96ANK_REP_REGION domain-containing protein (Fragment... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b8.508e-2529.67ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000037173.12.354e-2227.27pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3a3.009e-2227.75ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a4.016e-2027.19ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a4.398e-2027.19ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000095.16.211e-2428.16pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.15.533e-2333.97pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000002048.11.124e-2028.19pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000007449.11.261e-1927.43pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000007446.12.255e-1731.71pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NAS62.407e-828.81Evolutionarily conserved 19S regulatory particle a... [more]
AKR23.529e-722.16Ankyrin repeat-containing protein; member of a fam... [more]
PHO813.077e-641.51Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
HOS45.287e-629.75Subunit of the Set3 complex; complex is a meiotic-... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436906.093e-1424.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460991.674e-1231.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341612.351e-1238.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387025.074e-1227.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281785.341e-1230.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040233.16.994e-2629.19pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ENSORLT00000039903.12.930e-2428.71pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ENSORLT00000006308.22.982e-2327.75pep primary_assembly:ASM223467v1:1:12516834:125306... [more]
ank1b2.414e-2027.18ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039458.11.475e-1926.21ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
back to top
BLAST of E3 ubiquitin-protein ligase RGLG4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019753.10.000e+090.00SMESG000019753.1[more]
SMESG000043462.13.017e-10849.01SMESG000043462.1[more]
SMESG000010464.19.100e-9259.14SMESG000010464.1[more]
SMESG000010464.12.427e-9159.14SMESG000010464.1[more]
SMESG000019959.14.231e-8350.70SMESG000019959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010632 ID=SMED30010632|Name=E3 ubiquitin-protein ligase RGLG4|organism=Schmidtea mediterranea sexual|type=transcript|length=1172bp
TTGATTTTAGATTTGTTTTATCGCTATCAACTTTTGTTTGGCCTTGTAAT
ATCTATTTAATTCAATTCCAAGAAATATTTTATGATGGGGGATTTCCAAT
GTTTTTTGCAGCATTTGAAGGAAGGCAATGCCGATGGGGTCTGGAAATAT
TTAAAGTCCGATTTCCTAAATACAATTGTTGATGATCAAGGGCACTATTC
TATTCACATCGCATGTATGGGGGGCTTCGTTGAAGTGGCTAGGATAATAA
TCGATTGCGGCAGTAATATAGAATGTGAGACAACATGGGGAATGCGACCA
ATTCATTATGCAAGCAGTAGAGGTTGTTTGGAAATATTGACATTGTTGCT
AGAGCGCAACTGCGATATCGAATGTGAGACCAATTCGGGAATGCGACCTA
TTCATTATGCGAGTAGCGGAGGCCATTCAGAAATATTGAAATTATTGCTT
GAGCGCAATTGCAATATCGAATGTGAGGACAATAGGGGGATGAGACCGAT
TCATTGTGCAAGCAGTGGAGGCCATTTACAAATATTGAAATTATTGCTGC
AACGGAAATGCCGGATTGATTGCAAAAATAATATGAGCGAATCTATACTC
GAATTGGCAATACAGAGCAAACAGATGGATTGCGTGCAACTATTGATTAG
TGTTCAAGAGCTATTCGATTTCATCAATCGGAATGATGAGATCGCATTTG
ACAAAATATGGAAATCAAGTGATTTTATCAGAGAGAATATTTATTCGGGA
TTGCATGTGCTGGATATGGCAATTGAATGCAATGCTGATCGGATCGTTAA
ATGTATCCTTGACAAAACCGTTGATGATGAAGAACCCAAGGATACAAATG
ATCATAAAGACAGCGAAAAAAATGAAGATGATAAACTGAGAGGAATTTGC
AATATTTGCTTGGAATATCCGGTGGACATTGCGTTCCAATGTGGCCATTT
GATCTGCACGCCTTGCTCTCTCCGAGCTTCCTCTTGTCATGTTTGCAGGG
CGCAAATCACTGATAGAAGAAAAATTTATTTTAATTAATTTCGATCAGAT
TCATTGTTTATCTTATTGATGATTTCCATATGGTGCAAACACTTTGTCAG
GCTTTTAGAGGTTACCGAGATCAGAGGGTTATCGAAAAAATCTGTCTGTA
AAGACTCGGTCAGCTGATGGAA
back to top

protein sequence of SMED30010632-orf-1

>SMED30010632-orf-1 ID=SMED30010632-orf-1|Name=SMED30010632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=319bp
MMGDFQCFLQHLKEGNADGVWKYLKSDFLNTIVDDQGHYSIHIACMGGFV
EVARIIIDCGSNIECETTWGMRPIHYASSRGCLEILTLLLERNCDIECET
NSGMRPIHYASSGGHSEILKLLLERNCNIECEDNRGMRPIHCASSGGHLQ
ILKLLLQRKCRIDCKNNMSESILELAIQSKQMDCVQLLISVQELFDFINR
NDEIAFDKIWKSSDFIRENIYSGLHVLDMAIECNADRIVKCILDKTVDDE
EPKDTNDHKDSEKNEDDKLRGICNICLEYPVDIAFQCGHLICTPCSLRAS
SCHVCRAQITDRRKIYFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR018957Znf_C3HC4_RING-type
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 69..98
e-value: 6.5
score: 15.7
coord: 168..197
e-value: 840.0
score: 5.6
coord: 222..251
e-value: 250.0
score: 9.5
coord: 135..164
e-value: 0.014
score: 24.6
coord: 102..131
e-value: 0.033
score: 23.3
coord: 36..65
e-value: 0.027
score: 23.6
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 36..68
score: 9.19
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 102..134
score: 10.499
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 69..101
score: 9.164
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 135..167
score: 10.499
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 5..215
e-value: 1.3E-43
score: 150.8
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 6..207
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 246..318
e-value: 1.1E-12
score: 49.2
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 107..189
e-value: 2.0E-13
score: 50.7
coord: 21..97
e-value: 2.8E-7
score: 31.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 36..190
score: 38.594
IPR018957Zinc finger, C3HC4 RING-typePFAMPF00097zf-C3HC4coord: 273..305
e-value: 2.4E-4
score: 20.9
NoneNo IPR availablePANTHERPTHR24202FAMILY NOT NAMEDcoord: 11..145
coord: 70..193
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 272..312
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 273..306
score: 10.085