Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30010631
Length (bp)1292
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30010631) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30010631) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30010631) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30010631) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010631

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30010631SMESG000055436.1 SmedASXL_012583SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30010631SMESG000055436.1 dd_Smed_v6_13296_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30010631SMESG000055436.1 dd_Smed_v4_13296_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30010631SMESG000055436.1 dd_Smed_v4_13296_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 50.447 bits (119), Expect = 7.969e-7
Identity = 30/110 (27.27%), Postives = 51/110 (46.36%), Query Frame = 3
Query:  372 LLLTFITVLIICEIMLIAIAGVSMAFNQ--NFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            L   +I V+    +M+  + G    F +  N +      L ++++ T         +  VT+A+DQ+QQ+  CCG++ +    + W   + S WI  Q  G   VP SCC
Sbjct:   58 LATAYILVVAGTVVMVTGVLGCCATFKERRNLLRLLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNS----QDW---RDSEWIRSQEAGGRVVPDSCC 160          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD53 (CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686])

HSP 1 Score: 48.521 bits (114), Expect = 6.096e-6
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASG 599
            MVVAF+G  GS + + CLL++F  +L+I  +  + +A +   + Q    Y    LTDSI R +        ++    A D +Q  L CCG +G
Sbjct:   64 MVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYH-------SDNSTKAAWDSIQSFLQCCGING 149          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD53 (CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686])

HSP 1 Score: 48.521 bits (114), Expect = 6.096e-6
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASG 599
            MVVAF+G  GS + + CLL++F  +L+I  +  + +A +   + Q    Y    LTDSI R +        ++    A D +Q  L CCG +G
Sbjct:   64 MVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYH-------SDNSTKAAWDSIQSFLQCCGING 149          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 48.521 bits (114), Expect = 7.482e-6
Identity = 27/87 (31.03%), Postives = 44/87 (50.57%), Query Frame = 3
Query:  435 VSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            ++ A+ Q      + NL D++ + Y        +  VT+A+DQ+QQ+  CCG++ +    + W   + S WI  Q  G   VP SCC
Sbjct:  110 LAYAYYQQLNTELKENLKDTMTKRY----HQPGHEAVTSAVDQLQQEFHCCGSNNS----QDW---RDSEWIRSQEAGGRVVPDSCC 185          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 66.2402 bits (160), Expect = 5.429e-12
Identity = 42/126 (33.33%), Postives = 65/126 (51.59%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASG-NGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            ++V F+GLCG+  RS  LLL F+  LI   +  +A+  +S+ F ++ +   + N+ + ++  YGV T    N  VT  ID++Q    CCG+ G   Y    WS    ST    +    P  P+SCC
Sbjct:   73 LLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSL-FYKDKVYSVKENVREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDYISSRWS---QSTNQDSEEIESPLFPVSCC 194          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 58.9214 bits (141), Expect = 1.939e-9
Identity = 48/159 (30.19%), Postives = 68/159 (42.77%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSM----AFNQNFINYFEANLT--------------DSIQ---------------RTYGVSTEITRNSEVTTAIDQMQQQLSCCGASG-NGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            ++V F+GLCG+  RS  LLL F+  LI   +  +A+  +S+     F+ N++  +  NLT              D+IQ                 YGV T    N  VT  ID++Q    CCG+ G   Y    WS    ST    +    P  P+SCC
Sbjct:   73 LLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKFSNNYMGVYLKNLTYNRYSRDRWVLPLMDTIQFYVYSVKENVREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDYISSRWS---QSTNQDSEEIESPLFPVSCC 228          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 51.9878 bits (123), Expect = 2.618e-7
Identity = 47/169 (27.81%), Postives = 68/169 (40.24%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSM----AFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYG--PPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAP-PIANSSTVNNYL 806
            ++V F+GLCG+  RS  LLL F+  LI   +  +A+  +S+     F+ N++  +  NLT             +R+  V   +D +Q    CCG  G          YK S W +         +VP SCC                 Q+G   AP PI    T   YL
Sbjct:   73 LLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKFSNNYMGVYLKNLT---------YNRYSRDRWVLPLMDTIQFYHQCCGGEGP-------LDYKDSFWYITNTLRGTRSFVPPSCCK--------------QAQVGRAWAPVPIDPMCTTYRYL 211          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 58.5362 bits (140), Expect = 3.169e-9
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  330 AFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFN--QNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNG 605
            AF G CG  + S CLL++F  V++I  +M+  IA  + AF+      +   A +  S+Q  YG ST  +R    T   D +Q+ L CCGA G G
Sbjct:   70 AFFGCCGVCRESQCLLVSFFCVILI--VMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR----TVTFDTLQKNLKCCGADGPG 157          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 58.151 bits (139), Expect = 3.622e-9
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  330 AFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFN--QNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNG 605
            AF G CG  + S CLL++F  V++I  +M+  IA  + AF+      +   A +  S+Q  YG ST  +R    T   D +Q+ L CCGA G G
Sbjct:   70 AFFGCCGVCRESQCLLVSFFCVILI--VMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR----TVTFDTLQKNLKCCGADGPG 157          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0084912)

HSP 1 Score: 58.151 bits (139), Expect = 3.622e-9
Identity = 35/94 (37.23%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  330 AFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFN--QNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNG 605
            AF G CG  + S CLL++F  V++I  +M+  IA  + AF+      +   A +  S+Q  YG ST  +R    T   D +Q+ L CCGA G G
Sbjct:   70 AFFGCCGVCRESQCLLVSFFCVILI--VMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSR----TVTFDTLQKNLKCCGADGPG 157          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp86D (gene:FBgn0037848 transcript:FBtr0330150)

HSP 1 Score: 49.6766 bits (117), Expect = 2.796e-6
Identity = 35/123 (28.46%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  327 VAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            V+F G  G+ + ++ LL  +   L++  I+ +++A +   F Q   ++ E   TD I  +Y        +S++   ID  QQ+ +CCG S  GY   S + Y + +    +  G PY   SCC
Sbjct:   94 VSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSY------RDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPY---SCC 207          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp86D (gene:FBgn0037848 transcript:FBtr0306640)

HSP 1 Score: 48.521 bits (114), Expect = 5.326e-6
Identity = 35/123 (28.46%), Postives = 60/123 (48.78%), Query Frame = 3
Query:  327 VAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            V+F G  G+ + ++ LL  +   L++  I+ +++A +   F Q   ++ E   TD I  +Y        +S++   ID  QQ+ +CCG S  GY   S + Y + +    +  G PY   SCC
Sbjct:   94 VSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSY------RDDSDLQNFIDFAQQEFNCCGLSNAGYQDWSKNEYFNCSSPSVERCGVPY---SCC 207          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 53.5286 bits (127), Expect = 8.604e-8
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGV-SMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            M+   +G C + +    LL  +  VL++C  +L  +AGV +  + Q   +  + NL +++ + Y  S +      VT A+D++QQ+  CCG++ +       S +  S WI         VP SCC
Sbjct:   72 MITGVLGCCATFKEQRRLLRVYF-VLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYNQSEQ----EHVTKAVDKLQQEFKCCGSNSS-------SDWVDSAWIRSSEADGRLVPDSCC 185          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 52.373 bits (124), Expect = 2.762e-7
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGV-SMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            M+   +G C + +    LL  +  VL++C  +L  +AGV +  + Q   +  + NL +++ + Y  S +      VT A+D++QQ+  CCG++ +       S +  S WI         VP SCC
Sbjct:   72 MITGVLGCCATFKEQRRLLRVYF-VLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYNQSEQ----EHVTKAVDKLQQEFKCCGSNSS-------SDWVDSAWIRSSEADGRLVPDSCC 185          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 48.1358 bits (113), Expect = 7.789e-6
Identity = 37/125 (29.60%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
             V+ FIG C + + S C L+TF  VL    +++ A   V +     +    EA +  SIQ+ Y    + T     + AID +Q+QL CCG         ++S + ++ W +        VP+SCC
Sbjct:   65 FVIGFIGCCATIRESRCGLVTFSAVL----LLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYN-EYKGTNTDAPSRAIDYVQRQLHCCGI-------HNYSDWMNTHWFIESKNNS--VPVSCC 175          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan3b (tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42])

HSP 1 Score: 48.1358 bits (113), Expect = 7.789e-6
Identity = 37/125 (29.60%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
             V+ FIG C + + S C L+TF  VL    +++ A   V +     +    EA +  SIQ+ Y    + T     + AID +Q+QL CCG         ++S + ++ W +        VP+SCC
Sbjct:   65 FVIGFIGCCATIRESRCGLVTFSAVL----LLVFATEVVVVVLGYIYRAKVEAVVNHSIQKVYN-EYKGTNTDAPSRAIDYVQRQLHCCGI-------HNYSDWMNTHWFIESKNNS--VPVSCC 175          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: ENSXETT00000022348.1 (tetraspanin-4-like [Source:NCBI gene;Acc:101734690])

HSP 1 Score: 52.373 bits (124), Expect = 7.223e-7
Identity = 29/91 (31.87%), Postives = 45/91 (49.45%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGA 593
            MVV FIG  G+     CLLLTF  +L+I  ++ +    + + + + F NY + +L   +Q         T N  +T A D +Q +  CCG 
Sbjct:  145 MVVGFIGCLGAVTEHRCLLLTFFVILLIIFLLEMISMALFLTYTEQFHNYAQEDLKKGLQL-----YNTTGNLGLTNAWDIVQTEFRCCGV 230          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: ENSXETT00000022335.1 (tetraspanin-4-like [Source:NCBI gene;Acc:101734690])

HSP 1 Score: 51.2174 bits (121), Expect = 9.957e-7
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGAS 596
            MVV FIG  G+     CLLLTF  +L+I  ++ +    + + + + F NY + +L   +Q         T N  +T A D +Q +  CCG  
Sbjct:   65 MVVGFIGCLGAVTEHRCLLLTFFVILLIIFLLEMISMALFLTYTEQFHNYAQEDLKKGLQL-----YNTTGNLGLTNAWDIVQTEFRCCGVK 151          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: asmt (acetylserotonin O-methyltransferase [Source:Xenbase;Acc:XB-GENE-942483])

HSP 1 Score: 51.2174 bits (121), Expect = 1.052e-6
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGAS 596
            MVV FIG  G+     CLLLTF  +L+I  ++ +    + + + + F NY + +L   +Q         T N  +T A D +Q +  CCG  
Sbjct:   67 MVVGFIGCLGAVTEHRCLLLTFFVILLIIFLLEMISMALFLTYTEQFHNYAQEDLKKGLQL-----YNTTGNLGLTNAWDIVQTEFRCCGVK 153          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: asmt (acetylserotonin O-methyltransferase [Source:Xenbase;Acc:XB-GENE-942483])

HSP 1 Score: 51.2174 bits (121), Expect = 1.126e-6
Identity = 29/92 (31.52%), Postives = 45/92 (48.91%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGAS 596
            MVV FIG  G+     CLLLTF  +L+I  ++ +    + + + + F NY + +L   +Q         T N  +T A D +Q +  CCG  
Sbjct:   86 MVVGFIGCLGAVTEHRCLLLTFFVILLIIFLLEMISMALFLTYTEQFHNYAQEDLKKGLQL-----YNTTGNLGLTNAWDIVQTEFRCCGVK 172          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 50.8322 bits (120), Expect = 1.615e-6
Identity = 33/125 (26.40%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            M+   +G C + +    LL  +  +L++C  +L  +AG+        +N   A L  S+++T     +     +VT A+D++QQ+  CCG++ +    + W   + S WI         VP SCC
Sbjct:   72 MITGILGCCATFKERKSLLKVYF-ILLLCIFILEVLAGILAYIYYQQLN---AELKQSLKQTMTTKYKQPGEEKVTNAVDKLQQEFKCCGSNNS----EDW---RDSIWINSPEAEKRLVPDSCC 185          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Tspan15 (tetraspanin 15 [Source:MGI Symbol;Acc:MGI:1917673])

HSP 1 Score: 50.0618 bits (118), Expect = 2.677e-6
Identity = 36/136 (26.47%), Postives = 63/136 (46.32%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPY--VPLSCCALQSNQVIN 722
             +V+FIG+  S + + CLL +F+ +L IC +M +    V++ F    I++   N+   I+  Y        + +    +D +Q++  CCG  G  Y   S + Y   +       GP    VP +CC   +  V+N
Sbjct:   74 FIVSFIGVLASLRDNLCLLQSFMYILGICLVMELIGGIVALIFRNQTIDFLNDNIRRGIENYYD-------DLDFKNIMDFVQKKFKCCG--GEDYRDWSKNQYHDCS-----APGPLACGVPYTCCIRNTTDVVN 195          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q11098|TSP17_CAEEL (Tetraspanin-17 OS=Caenorhabditis elegans OX=6239 GN=tsp-17 PE=1 SV=4)

HSP 1 Score: 58.9214 bits (141), Expect = 2.467e-8
Identity = 48/159 (30.19%), Postives = 68/159 (42.77%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSM----AFNQNFINYFEANLT--------------DSIQ---------------RTYGVSTEITRNSEVTTAIDQMQQQLSCCGASG-NGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            ++V F+GLCG+  RS  LLL F+  LI   +  +A+  +S+     F+ N++  +  NLT              D+IQ                 YGV T    N  VT  ID++Q    CCG+ G   Y    WS    ST    +    P  P+SCC
Sbjct:   73 LLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKFSNNYMGVYLKNLTYNRYSRDRWVLPLMDTIQFYVYSVKENVREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDYISSRWS---QSTNQDSEEIESPLFPVSCC 228          
BLAST of Tetraspanin vs. TrEMBL
Match: V4B2G9 (Tetraspanin OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_157853 PE=3 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.657e-21
Identity = 68/207 (32.85%), Postives = 102/207 (49.28%), Query Frame = 3
Query:  249 AAVIMYNDLYRAGYXXXXXXXXXXMVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYK--SSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPA--PPIANSSTVNNYLNMQGCYTVLSDALTYYS 857
             A I+  DLY AG  +LI  G L++V++F G CG+ Q +   L  +I +L +   + IA A V   F     +  +  L   I   YGV+ +I  N+  T A D++Q ++ CCG SGN  +  SW+ YK   + W      G PYVP SCC            CQG  ++  PP+  PP+ +   +N  L   GC+  + + L + S
Sbjct:   45 VAAIVGTDLYEAGSYVLIAGGGLIIVISFCGWCGTIQENRTFLCCYIFILSLLLTVFIAAAVVGFIFKDQITDQLQVELETRIIYKYGVNLDIRENNFFTEAWDRLQLKIMCCGVSGNINSTDSWAFYKHYHTRWYEQFQPGSPYVPESCCDPAGED----PKCQGDMEMNGPPSLGPPVNSDMVLNMALYTDGCFDKIKNILKFNS 247          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A210PUQ4 (Tetraspanin OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08583 PE=3 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.152e-20
Identity = 68/221 (30.77%), Postives = 110/221 (49.77%), Query Frame = 3
Query:  213 VWLAVWTSYFNYAAVIMYNDLYRAGYXXXXXXXXXXMVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEI-TRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYK--SSTWILGQNYGP-PYVPLSCCALQSNQVINAAFCQGTTQIGSPP--APPIANSSTVNNYLNMQGCYTVLSDALTYYS 857
            +WL V        +V++ ++L+  G  L++  G ++ ++AF G CG+ +   C+L  +  VL++  + LI    ++  F +N  + F+  L  +I++ YG      T N  VT A D +Q++L CCGA GN  +  SW++YK  S  W    +    P VP SCC       ++   CQG   I  PP   PP   S T N ++   GCY  + D +  +S
Sbjct:  112 IWLLVTDFSAREVSVVIDSNLFEIGTYLILAGGGMIALLAFCGCCGTMREDRCILGFYGVVLVLVFMALIVGGVLAFMFRENMTSDFKEKLVVTIEKQYGFEVRTNTHNRLVTDAWDSIQRKLKCCGAYGNISSDFSWAIYKQHSDWWARRPSRDKYPMVPDSCCVPD----MDKEKCQGRVFIEGPPNKGPPFKGSHTENPHIYTVGCYDKVIDYMMQHS 328          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A0L8FY26 (Tetraspanin OS=Octopus bimaculoides OX=37653 GN=OCBIM_22004386mg PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 4.466e-20
Identity = 58/178 (32.58%), Postives = 90/178 (50.56%), Query Frame = 3
Query:  324 VVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSE-VTTAIDQMQQQLSCCGASGNGYTGKSWSLYK-SSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPA--PPIANSSTVNNYLNMQGCYTVLSDAL 845
            ++AF G CG+ +   C+L  +   L    + L    G++  F +        ++T++I++ YG+ T    N++ VT A D +Q+QL CCG  G   +  SWS+YK  S W        PYVP SCC   SN+      C G  ++ +PPA  PPI  +   N+ LN +GC   + + L
Sbjct:  150 LLAFCGCCGTMREDKCVLGFYSGTLSFMLLFLTVSCGMAFYFRRQVTKDIVKHMTNTIEQQYGLDTRTNSNNKLVTDAWDSLQRQLQCCGIKGGENSSFSWSVYKLRSEWYRRNPEQSPYVPRSCCKKDSNE----KKCTGEIRLRAPPALGPPIGKNDLRNHDLNTEGCLDKIREHL 323          
BLAST of Tetraspanin vs. TrEMBL
Match: K1QZN2 (Tetraspanin OS=Crassostrea gigas OX=29159 GN=CGI_10023435 PE=3 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.268e-18
Identity = 66/229 (28.82%), Postives = 108/229 (47.16%), Query Frame = 3
Query:  213 VWLAVWTSYFNYAAVIMYNDLYRAGYXXXXXXXXXXMVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEI-TRNSEVTTAIDQMQQQLSCCG-----ASGNGYTG-KSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQI--GSPPAPPIANSSTVNNYLNMQGCYTVLSDALTYYSRAMFG 872
            +WL V         VI+ +D++  G  +++  G L+ ++AF G CG+ +   C+L  +  VL +  + L+A   ++  F +N     +  L  ++Q  YG      T N  +T A D MQ++  CCG       G    G KSW  +KS+ W + ++   P VP SCC   +++      CQG + I  G P   P        ++L+ +GCY  +   LT YS  + G
Sbjct:  132 IWLLVTDFSAREITVIINSDMFEIGTYMILAGGGLVALLAFCGCCGTMREDRCILGFYGVVLALVFMALLAGGAMAFLFRENISEDIKTKLEYTLQTQYGQDVRGNTTNRLITDAWDSMQRKFECCGPYSLDEDGEDLRGAKSWDFFKSTNWYMSKSQKYPMVPESCCIEGADK----QKCQGQSIIMKGPPNYGPAQLPKKFESHLHTEGCYEKVKKYLTEYSLILGG 356          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267FJJ2 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003051g2 PE=3 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.497e-16
Identity = 52/175 (29.71%), Postives = 93/175 (53.14%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYK-SSTW-----ILGQNYGPPYVPLSCCALQSNQVI-NAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCY 824
            +V +  GL G+ + ++CL L ++ V+I   +  + +  +  AF     +  ++ L  SI + YG++ +  RN+E+TTA D +Q+  SCCGA G   + +SW LY+ +S W     +L  N   P+VPLSCC  +++  + +   C G   + + P       +  N  L ++GC+
Sbjct:   98 LVASIFGLIGTVKNNTCLHLFYLIVVICLFVTFLVVGAIGFAFYTELQDAVKSTLETSIAKYYGINLDADRNTEITTATDAVQRYFSCCGAYGGVNSTRSWYLYQNASAWYQATTVLEGN-KAPFVPLSCCKRRADSSVQDQPRCLGNVNVTNAPPANPPPLTGSNAALFIEGCF 271          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd151l (CD151 antigen-like [Source:NCBI gene;Acc:103028881])

HSP 1 Score: 52.373 bits (124), Expect = 2.922e-7
Identity = 35/131 (26.72%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGV-SMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSN 710
            M+   +G C + +    LL  +  VL++C  +L  +AGV +  + Q      + NL +++ + Y    +      +T A+D++QQ+  CCG++ +       S +  S WI         VP SCC  QS 
Sbjct:   72 MITGVLGCCATFKEQRRLLRVYF-VLLLCIFLLEVLAGVLAYIYYQQLNEELKDNLKETMVQKYHQPDQ----DHITKAVDKLQQEFKCCGSNKS-------SDWAESVWIRSNEARGRKVPDSCCKSQSE 190          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd151l (CD151 antigen-like [Source:NCBI gene;Acc:103028881])

HSP 1 Score: 51.9878 bits (123), Expect = 3.048e-7
Identity = 35/131 (26.72%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGV-SMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSN 710
            M+   +G C + +    LL  +  VL++C  +L  +AGV +  + Q      + NL +++ + Y    +      +T A+D++QQ+  CCG++ +       S +  S WI         VP SCC  QS 
Sbjct:   72 MITGVLGCCATFKEQRRLLRVYF-VLLLCIFLLEVLAGVLAYIYYQQLNEELKDNLKETMVQKYHQPDQ----DHITKAVDKLQQEFKCCGSNKS-------SDWAESVWIRSNEARGRKVPDSCCKSQSE 190          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 51.2174 bits (121), Expect = 5.499e-7
Identity = 58/187 (31.02%), Postives = 77/187 (41.18%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFI------NYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYT----VLSDALTY 851
             ++  IG C +T R S + L+F  V     I+L+  A    AF   FI         E +++D  Q+  G      +N+E T A+D +Q QL CCG   N YT   WS   S  W    N     VP+SCC   S        C G  Q   P              LN+QGC      +L D L+Y
Sbjct:   64 FIIGLIGCC-ATLRESKVGLSFFMV-----ILLLVFAAEVAAFVFGFIYRGKIKGDLEKSMSDVFQKYDG------KNAE-TAAVDYLQSQLQCCGV--NNYT--DWS---SRPWFTSHN---STVPVSCCKANST-------CTG--QFDKP------------ELLNVQGCEAKLEKLLQDVLSY 206          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan36 (tetraspanin 36 [Source:NCBI gene;Acc:437021])

HSP 1 Score: 50.8322 bits (120), Expect = 6.200e-7
Identity = 58/187 (31.02%), Postives = 77/187 (41.18%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFI------NYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYT----VLSDALTY 851
             ++  IG C +T R S + L+F  V     I+L+  A    AF   FI         E +++D  Q+  G      +N+E T A+D +Q QL CCG   N YT   WS   S  W    N     VP+SCC   S        C G  Q   P              LN+QGC      +L D L+Y
Sbjct:   64 FIIGLIGCC-ATLRESKVGLSFFMV-----ILLLVFAAEVAAFVFGFIYRGKIKGDLEKSMSDVFQKYDG------KNAE-TAAVDYLQSQLQCCGV--NNYT--DWS---SRPWFTSHN---STVPVSCCKANST-------CTG--QFDKP------------ELLNVQGCEAKLEKLLQDVLSY 206          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:103032697])

HSP 1 Score: 47.3654 bits (111), Expect = 9.307e-6
Identity = 34/125 (27.20%), Postives = 55/125 (44.00%), Query Frame = 3
Query:  327 VAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPY--VPLSCC 695
            +AF G CG+ + + C++  F  +L +  I+ I  A  +  F        +  L D I++    S E          +D++Q+ L CCGA+             SS W+   N+ P +  VP SCC
Sbjct:   67 IAFFGCCGAWKENYCMVTMFAILLSLIIIVEIGTAIAAYVFRDKLTGLVDDGLRDMIKQYNNGSKEYQEG------LDRIQKDLKCCGAA------------NSSDWV---NFKPDHTSVPDSCC 170          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 47.3654 bits (111), Expect = 2.740e-6
Identity = 33/125 (26.40%), Postives = 55/125 (44.00%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
             VV  +G C + + S C L TF  +L++   + +  A +  A+     +  E  ++       G     T ++  + AID +Q QL CCG        K++  +K   W    + G   VP+SCC
Sbjct:   67 FVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNG-----TDSNTASRAIDYVQHQLKCCGV-------KNYLDWKDRPWF--NHTGNNSVPISCC 177          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35283 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLY4])

HSP 1 Score: 51.9878 bits (123), Expect = 1.238e-7
Identity = 38/130 (29.23%), Postives = 65/130 (50.00%), Query Frame = 3
Query:  324 VVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNY-GPPYVPLSCCALQSN 710
            +V+F G  G+ + + C+L TF  +L+I   + IA A ++  +     +  E++LT +++  YG S +      VT A D +Q++  CCG   NGY            W   + Y G   VP SCC ++++
Sbjct:   68 IVSFFGCLGAWKENRCMLGTFFVLLLILLTLEIAAAVLAYNYRGKVKDEIESDLTKALKGDYGSSGQ----DGVTKAFDALQEKQKCCGV--NGYL----------DWKASKKYNGTSTVPDSCCVVKAD 181          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 50.8322 bits (120), Expect = 2.866e-7
Identity = 37/136 (27.21%), Postives = 61/136 (44.85%), Query Frame = 3
Query:  327 VAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEA------NLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNG-YTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQ 713
            V F G CG+ + S C+L T++  L+   + L     +   + + F+ + +       NL + I+ TYG       +SEV + I+ +Q +L CCG    G + G  W    +             VPLSCC   +N+
Sbjct:   65 VGFFGCCGAVKESRCMLATWLKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYG------YDSEVESHINNLQIRLKCCGGERPGDWLGSKWKRDLNK---------DKIVPLSCCTENANK 185          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO39846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S900])

HSP 1 Score: 49.2914 bits (116), Expect = 3.875e-7
Identity = 37/125 (29.60%), Postives = 59/125 (47.20%), Query Frame = 3
Query:  324 VVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYG-PPYVPLSCC 695
            +VAF+G CG+ + S C+L+ F   ++I   + IA A ++        +  E  L + I+   G +    RN     A+D MQ+ + CCG +       ++  +KSS      N G    VP SCC
Sbjct:   61 IVAFLGCCGAWKESKCMLICFFVCMLILFCLEIAAAVLAFVKKDKVKDELENELKNQIKSYTGSA----RN-----AVDDMQKTVKCCGIT-------TYEDWKSS-----DNLGLTDNVPDSCC 164          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE8])

HSP 1 Score: 47.7506 bits (112), Expect = 3.177e-6
Identity = 39/124 (31.45%), Postives = 58/124 (46.77%), Query Frame = 3
Query:  324 VVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            +V+F G CG+ +   CLL TF  +L I  I+ + I G ++ +     N  E  L   +  T  VS        +T A D +Q++  CCG   NG+  K W   + S +  G +     VP SCC
Sbjct:   66 LVSFFGCCGAIKEHRCLLATFFALLFI--ILAVEITGTALGYVYR--NKVEEQLGKDMNDTI-VSYGEKGKEGITDAYDAIQKKEKCCGI--NGF--KDW---QRSYYTKGNH---SIVPDSCC 174          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 46.9802 bits (110), Expect = 4.812e-6
Identity = 38/145 (26.21%), Postives = 60/145 (41.38%), Query Frame = 3
Query:  330 AFIGLCGSTQRSSCLLLTF---ITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCG-ASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQI 752
            AF+  CG+ + S C+L T+   +T +   E+  I +A V       +    E NL   I+ T      ++ +  VT AID++ +   CCG A    +    W+              P  VP SCC   S+   N    +  T+I
Sbjct:   61 AFLACCGALKESQCMLGTYFGLVTAIFCLEVTAIVLAYV-------YRERIEKNLHGDIRSTMN-EYHLSGHDAVTRAIDEIHRDFKCCGNAQYRDWFETKWA-----------KTHPDMVPRSCCKDPSDSKCNENISKDPTKI 186          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000001610.2 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:101161865])

HSP 1 Score: 53.5286 bits (127), Expect = 9.302e-8
Identity = 35/126 (27.78%), Postives = 63/126 (50.00%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGV-SMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
            MV   +G C + +    LL  +  VL++C  +L  +AGV +  + Q      + NL +++ R Y    E+     +T A+D++QQ+  CCG++ +       S +K ++W++        VP SCC
Sbjct:   72 MVTGVLGCCATFKEQRRLLRVYF-VLLLCIFLLEVLAGVLAYIYYQQLNEELKLNLKETLIRKY----EVGSYEHITRAVDKLQQEFKCCGSNSS-------SDWKENSWVMDTG---RKVPDSCC 182          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan34 (tetraspanin-1 [Source:NCBI gene;Acc:101174246])

HSP 1 Score: 48.9062 bits (115), Expect = 3.263e-6
Identity = 25/90 (27.78%), Postives = 49/90 (54.44%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCG 590
            +++ F+G CG+ + S C+LLTF  ++++  I+ +A A V  AF+    +    N+ + ++    + TE  R+  +T+      +Q  CCG
Sbjct:   70 VIIGFLGCCGAVKESRCMLLTFFCIVLVIFIVEVAGAIVLFAFD-GLADKILDNVENEVRSK--LQTEFGRDESLTSVWGSTMEQFKCCG 156          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000055436.1 (SMESG000055436.1)

HSP 1 Score: 612.068 bits (1577), Expect = 0.000e+0
Identity = 343/346 (99.13%), Postives = 346/346 (100.00%), Query Frame = 3
Query:   84 MYGQRSTNNQVVIEDQQSYAIGTTNTXXXXXXXXXXXXXXXXXVWLAVWTSYFNYAAVIMYNDLYRAGYXXXXXXXXXXMVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYTVLSDALTYYSRAMFGXXXXXXXXXXXXXXXXCVLVRDIEVKKKELNDLQSGNLEKDMKHKVQPTKDLHSIPKQRNTNEYQQNESPIKNSYKDSQRILK 1121
            MYGQRSTNNQVVIEDQQSYAIGTTNTILSFFLFLIAIGIFGFGVWLAVWTSYFNYAAVIMYNDLYRAGYILLIISGSLLMVVAFIGLCGSTQRSSCLLLTFITVLIICEIML+AIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILG+NYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYTVLSDALTYYSRAMFGLSLASAIYLLIILILSCVLVRDIE+KKKELNDLQSGNLEKDMKHKVQPTKDLHSIPKQRNTNEYQQNESPIKNSYKDSQRILK
Sbjct:    1 MYGQRSTNNQVVIEDQQSYAIGTTNTILSFFLFLIAIGIFGFGVWLAVWTSYFNYAAVIMYNDLYRAGYILLIISGSLLMVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLMAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGKNYGPPYVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYTVLSDALTYYSRAMFGLSLASAIYLLIILILSCVLVRDIEIKKKELNDLQSGNLEKDMKHKVQPTKDLHSIPKQRNTNEYQQNESPIKNSYKDSQRILK 346          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000073695.1 (SMESG000073695.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.118e-9
Identity = 40/137 (29.20%), Postives = 63/137 (45.99%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCCALQSNQVINAAF 731
             VV F G CG+ + S  LL T+I +L++  I+ I+    +    +  +   E +L  SI + Y      T N  +  AID +Q+   CCG      T K+W   ++STW + +N      P SCC       + + F
Sbjct:   70 FVVGFCGCCGAIRESRLLLGTYIVLLLLIMIVEISCGIYATVKEKEVVRKIEKSLEKSIIKNYPPFNS-TSNQNLKNAIDYIQKTFRCCGVK----TYKNW---ENSTWYISRNDSFMETPSSCCESDIESELRSCF 198          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021627.1 (SMESG000021627.1)

HSP 1 Score: 50.0618 bits (118), Expect = 9.638e-7
Identity = 35/125 (28.00%), Postives = 56/125 (44.80%), Query Frame = 3
Query:  321 MVVAFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVPLSCC 695
             V+AF G CG+ + S  LL  +I  L++   + +A+   ++ + Q         L  +I   YG   +   N ++T   D +QQ LSCCG  G     + W   + S W + +       P SCC
Sbjct:   67 FVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKD---NDKIT---DNIQQILSCCGIEGP----QDW---EKSKWYIEKMNKSQMFPKSCC 178          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000043582.1 (SMESG000043582.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.960e-6
Identity = 43/175 (24.57%), Postives = 69/175 (39.43%), Query Frame = 3
Query:  330 AFIGLCGSTQRSSCLLLTFITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITRNSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPP--YVPLSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYTVLSDALT 848
            A  G CG  + S C ++ FI V +I   +L     +   +N    +   ++L       YG+    TR        ++ Q +  CCG   NG   KS   Y S +     N  P    VPLSCC ++    +N   C       S P          + Y+  +GC+ +L + ++
Sbjct:   63 AIFGFCGILRESRCCMILFILVTVIAFTILTVSGALLFVYNNQVKSTVISHLKKEFINKYGIDASYTR------LWNEFQPKHMCCGID-NGADYKSTKWYNSPS-----NEFPKEGEVPLSCCTMKDEHFLNTTACA-----HSRPEDQ-------SKYIYNKGCWDILRNVVS 213          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CD1517.969e-727.27CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
CD536.096e-633.33CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686][more]
CD536.096e-633.33CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686][more]
CD1517.482e-631.03CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tsp-175.429e-1233.33Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-171.939e-930.19Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-172.618e-727.81Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp96F3.169e-937.23gene:FBgn0027865 transcript:FBtr0330163[more]
Tsp96F3.622e-937.23gene:FBgn0027865 transcript:FBtr0330164[more]
Tsp96F3.622e-937.23gene:FBgn0027865 transcript:FBtr0084912[more]
Tsp86D2.796e-628.46gene:FBgn0037848 transcript:FBtr0330150[more]
Tsp86D5.326e-628.46gene:FBgn0037848 transcript:FBtr0306640[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cd151l8.604e-827.78CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
cd151l2.762e-727.78CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
tspan3b7.789e-629.60tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
tspan3b7.789e-629.60tetraspanin 3b [Source:ZFIN;Acc:ZDB-GENE-070424-42... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000022348.17.223e-731.87tetraspanin-4-like [Source:NCBI gene;Acc:101734690... [more]
ENSXETT00000022335.19.957e-731.52tetraspanin-4-like [Source:NCBI gene;Acc:101734690... [more]
asmt1.052e-631.52acetylserotonin O-methyltransferase [Source:Xenbas... [more]
asmt1.126e-631.52acetylserotonin O-methyltransferase [Source:Xenbas... [more]
cd1511.615e-626.40CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tspan152.677e-626.47tetraspanin 15 [Source:MGI Symbol;Acc:MGI:1917673][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q11098|TSP17_CAEEL2.467e-830.19Tetraspanin-17 OS=Caenorhabditis elegans OX=6239 G... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B2G91.657e-2132.85Tetraspanin OS=Lottia gigantea OX=225164 GN=LOTGID... [more]
A0A210PUQ41.152e-2030.77Tetraspanin OS=Mizuhopecten yessoensis OX=6573 GN=... [more]
A0A0L8FY264.466e-2032.58Tetraspanin OS=Octopus bimaculoides OX=37653 GN=OC... [more]
K1QZN25.268e-1828.82Tetraspanin OS=Crassostrea gigas OX=29159 GN=CGI_1... [more]
A0A267FJJ24.497e-1629.71Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd151l2.922e-726.72CD151 antigen-like [Source:NCBI gene;Acc:103028881... [more]
cd151l3.048e-726.72CD151 antigen-like [Source:NCBI gene;Acc:103028881... [more]
tspan365.499e-731.02tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
tspan366.200e-731.02tetraspanin 36 [Source:NCBI gene;Acc:437021][more]
cd639.307e-627.20CD63 molecule [Source:NCBI gene;Acc:103032697][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tspan3a2.740e-626.40tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352831.238e-729.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359382.866e-727.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398463.875e-729.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475923.177e-631.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468874.812e-626.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000001610.29.302e-827.78CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
tspan343.263e-627.78tetraspanin-1 [Source:NCBI gene;Acc:101174246][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000055436.10.000e+099.13SMESG000055436.1[more]
SMESG000073695.13.118e-929.20SMESG000073695.1[more]
SMESG000021627.19.638e-728.00SMESG000021627.1[more]
SMESG000043582.11.960e-624.57SMESG000043582.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010631 ID=SMED30010631|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1292bp
GAAACACTTTCAAATTTGAGTAAATTAAATTTAGATAATAAAATTTAATC
CAAATATTAATGAAATAAAAATTGGAAATAAGGATGTATGGACAAAGATC
TACTAATAATCAAGTAGTTATTGAGGATCAACAATCATATGCCATTGGCA
CAACCAACACAATCTTATCTTTTTTTTTATTTTTAATAGCAATTGGGATA
TTTGGGTTTGGAGTGTGGCTGGCAGTATGGACGAGTTATTTCAATTACGC
TGCTGTGATTATGTATAATGATCTGTACCGAGCTGGATATATCTTATTAA
TTATATCCGGCTCCTTACTGATGGTTGTCGCATTCATTGGACTGTGTGGT
AGCACTCAAAGGAGTTCCTGTTTATTGTTAACTTTTATAACCGTACTAAT
TATTTGTGAAATCATGCTCATAGCAATCGCCGGTGTCAGCATGGCTTTCA
ATCAGAACTTTATAAATTACTTCGAGGCAAATCTCACTGACTCAATTCAA
AGAACCTACGGAGTTAGTACAGAAATTACTAGAAATTCAGAAGTAACAAC
GGCCATTGATCAAATGCAACAACAGTTATCATGCTGTGGGGCAAGTGGAA
ATGGATACACTGGTAAGTCTTGGAGTTTATACAAATCATCGACTTGGATT
CTTGGGCAAAACTATGGACCACCCTATGTACCGCTAAGTTGCTGTGCATT
ACAATCAAACCAAGTAATAAATGCTGCATTTTGTCAAGGAACAACCCAAA
TCGGAAGCCCACCAGCTCCACCGATTGCAAACAGTTCTACTGTAAACAAC
TATCTTAATATGCAAGGCTGCTACACCGTTCTGTCTGATGCGCTTACTTA
TTACTCCAGAGCAATGTTCGGATTGTCTTTGGCCTCCGCTATTTATTTGT
TGATTATACTGATTCTTTCCTGCGTTCTCGTGAGAGATATAGAGGTTAAG
AAAAAAGAATTAAACGACTTACAGTCTGGAAATCTAGAGAAAGACATGAA
ACATAAAGTCCAACCCACAAAGGATTTGCATTCCATTCCAAAACAACGTA
ATACAAATGAATACCAGCAAAACGAGTCACCCATTAAAAACTCATATAAA
GATTCTCAAAGAATTTTGAAATAATTTTGAATTTCTTTTATTTATTAAAA
CAAATAAAACAGAGAAAAAACCCGAATTCCGCTACCGACGGCTTCGTCAG
TGCTATTAAAATTAATTTATGACTTAAATGTTTTCGTTTTCTTGATTAAT
GTTTTGTAAATTTTCACTATTTTCCTTTTTTCGAGAGATCGG
back to top

protein sequence of SMED30010631-orf-1

>SMED30010631-orf-1 ID=SMED30010631-orf-1|Name=SMED30010631-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=347bp
MYGQRSTNNQVVIEDQQSYAIGTTNTILSFFLFLIAIGIFGFGVWLAVWT
SYFNYAAVIMYNDLYRAGYILLIISGSLLMVVAFIGLCGSTQRSSCLLLT
FITVLIICEIMLIAIAGVSMAFNQNFINYFEANLTDSIQRTYGVSTEITR
NSEVTTAIDQMQQQLSCCGASGNGYTGKSWSLYKSSTWILGQNYGPPYVP
LSCCALQSNQVINAAFCQGTTQIGSPPAPPIANSSTVNNYLNMQGCYTVL
SDALTYYSRAMFGLSLASAIYLLIILILSCVLVRDIEVKKKELNDLQSGN
LEKDMKHKVQPTKDLHSIPKQRNTNEYQQNESPIKNSYKDSQRILK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR018503Tetraspanin_CS
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 65..91
score: 30.73
coord: 260..286
score: 21.99
coord: 92..120
score: 22.89
coord: 23..46
score: 22.61
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 26..284
e-value: 3.6E-31
score: 108.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..346
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 316..346
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 29..283
NoneNo IPR availablePANTHERPTHR19282:SF283TETRASPANIN-21coord: 29..283
NoneNo IPR availableTMHMMTMhelixcoord: 69..91
NoneNo IPR availableTMHMMTMhelixcoord: 27..49
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
IPR018503Tetraspanin, conserved sitePROSITEPS00421TM4_1coord: 76..98
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 134..254