Homeobox protein

Overview
NameHomeobox protein
Smed IDSMED30010627
Length (bp)1792
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox protein (SMED30010627) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox protein (SMED30010627) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox protein (SMED30010627) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox protein (SMED30010627) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010627

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010627SMESG000078684.1 dd_Smed_v4_8553_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 171.785 bits (434), Expect = 3.078e-48
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 172.17 bits (435), Expect = 2.129e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   49 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 233          
BLAST of Homeobox protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 172.17 bits (435), Expect = 2.129e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   49 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 233          
BLAST of Homeobox protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 172.17 bits (435), Expect = 2.309e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   49 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 233          
BLAST of Homeobox protein vs. Ensembl Human
Match: MEIS2 (Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001])

HSP 1 Score: 172.17 bits (435), Expect = 2.417e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 143.665 bits (361), Expect = 8.245e-37
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXX----XXXFNEDVMVFAKELV-TSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
            HE     K +KESIY+H L+PLL ++FEKCELAT TP+ +S      S    S SF +D+  F +     +DK+ Y  N ++D +M+Q+IQ+LRFHLLE+EKVHELCDNFC+RY+ CLK KMP+D+V ++R S+
Sbjct:   13 HEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASS 146          
BLAST of Homeobox protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 143.665 bits (361), Expect = 1.324e-36
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXX----XXXFNEDVMVFAKELV-TSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
            HE     K +KESIY+H L+PLL ++FEKCELAT TP+ +S      S    S SF +D+  F +     +DK+ Y  N ++D +M+Q+IQ+LRFHLLE+EKVHELCDNFC+RY+ CLK KMP+D+V ++R S+
Sbjct:   50 HEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASS 183          
BLAST of Homeobox protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 142.895 bits (359), Expect = 1.619e-36
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXX----XXXFNEDVMVFAKELV-TSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
            HE     K +KESIY+H L+PLL ++FEKCELAT TP+ +S      S    S SF +D+  F +     +DK+ Y  N ++D +M+Q+IQ+LRFHLLE+EKVHELCDNFC+RY+ CLK KMP+D+V ++R S+
Sbjct:   13 HEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASS 146          
BLAST of Homeobox protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 143.665 bits (361), Expect = 2.007e-36
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXX----XXXFNEDVMVFAKELV-TSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
            HE     K +KESIY+H L+PLL ++FEKCELAT TP+ +S      S    S SF +D+  F +     +DK+ Y  N ++D +M+Q+IQ+LRFHLLE+EKVHELCDNFC+RY+ CLK KMP+D+V ++R S+
Sbjct:   87 HEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASS 220          
BLAST of Homeobox protein vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 143.28 bits (360), Expect = 2.247e-36
Identity = 69/134 (51.49%), Postives = 95/134 (70.90%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXX----XXXFNEDVMVFAKELV-TSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
            HE     K +KESIY+H L+PLL ++FEKCELAT TP+ +S      S    S SF +D+  F +     +DK+ Y  N ++D +M+Q+IQ+LRFHLLE+EKVHELCDNFC+RY+ CLK KMP+D+V ++R S+
Sbjct:   50 HEMGEAMKRDKESIYAHPLYPLLVLLFEKCELATSTPRDTSRDGSTSSDVCSSASFKDDLNEFVRHTQENADKQYYVPNPQLDQIMLQSIQMLRFHLLELEKVHELCDNFCNRYVVCLKGKMPLDIVGDERASS 183          
BLAST of Homeobox protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0344145)

HSP 1 Score: 160.999 bits (406), Expect = 6.000e-45
Identity = 78/122 (63.93%), Postives = 97/122 (79.51%), Query Frame = 2
Query:  884 KGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDS 1246
            K +K++IY H LFPLLA+IFEKCELAT TP+          SSESFNED+ +F+K+ + S K  Y+ + E+D LM+QAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQ-IRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDT 211          
BLAST of Homeobox protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100455)

HSP 1 Score: 160.999 bits (406), Expect = 6.000e-45
Identity = 78/122 (63.93%), Postives = 97/122 (79.51%), Query Frame = 2
Query:  884 KGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDS 1246
            K +K++IY H LFPLLA+IFEKCELAT TP+          SSESFNED+ +F+K+ + S K  Y+ + E+D LM+QAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQ-IRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDT 211          
BLAST of Homeobox protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0100454)

HSP 1 Score: 160.229 bits (404), Expect = 1.119e-44
Identity = 78/122 (63.93%), Postives = 97/122 (79.51%), Query Frame = 2
Query:  884 KGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDS 1246
            K +K++IY H LFPLLA+IFEKCELAT TP+          SSESFNED+ +F+K+ + S K  Y+ + E+D LM+QAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQ-IRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDT 211          
BLAST of Homeobox protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082256)

HSP 1 Score: 163.31 bits (412), Expect = 9.204e-44
Identity = 78/122 (63.93%), Postives = 97/122 (79.51%), Query Frame = 2
Query:  884 KGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDS 1246
            K +K++IY H LFPLLA+IFEKCELAT TP+          SSESFNED+ +F+K+ + S K  Y+ + E+D LM+QAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQ-IRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDT 211          
BLAST of Homeobox protein vs. Ensembl Fly
Match: hth (gene:FBgn0001235 transcript:FBtr0082255)

HSP 1 Score: 163.31 bits (412), Expect = 1.176e-43
Identity = 78/122 (63.93%), Postives = 97/122 (79.51%), Query Frame = 2
Query:  884 KGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDS 1246
            K +K++IY H LFPLLA+IFEKCELAT TP+          SSESFNED+ +F+K+ + S K  Y+ + E+D LM+QAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD+
Sbjct:   91 KRDKDAIYEHPLFPLLALIFEKCELATCTPREPGVQGGDVCSSESFNEDIAMFSKQ-IRSQKPYYTADPEVDSLMVQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDT 211          
BLAST of Homeobox protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 166.007 bits (419), Expect = 6.734e-47
Identity = 80/124 (64.52%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD +
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGS 191          
BLAST of Homeobox protein vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 168.318 bits (425), Expect = 4.102e-46
Identity = 83/129 (64.34%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K+SIY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DR+    + S
Sbjct:   69 LKRDKDSIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDS 196          
BLAST of Homeobox protein vs. Ensembl Zebrafish
Match: meis1b (Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122-1])

HSP 1 Score: 169.859 bits (429), Expect = 4.959e-46
Identity = 83/129 (64.34%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K+SIY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DR+    + S
Sbjct:   69 LKRDKDSIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDS 196          
BLAST of Homeobox protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 166.777 bits (421), Expect = 1.361e-45
Identity = 80/124 (64.52%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD +
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGS 191          
BLAST of Homeobox protein vs. Ensembl Zebrafish
Match: meis2a (Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-2])

HSP 1 Score: 166.777 bits (421), Expect = 1.622e-45
Identity = 80/124 (64.52%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD +
Sbjct:   69 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGS 191          
BLAST of Homeobox protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 169.088 bits (427), Expect = 1.730e-46
Identity = 83/129 (64.34%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVIEDR+    + S
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDREGGSKSDS 198          
BLAST of Homeobox protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 169.088 bits (427), Expect = 1.974e-46
Identity = 83/129 (64.34%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVIEDR+    + S
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDREGGSKSDS 198          
BLAST of Homeobox protein vs. Ensembl Xenopus
Match: meis2 (Meis homeobox 2 [Source:NCBI gene;Acc:100036664])

HSP 1 Score: 169.088 bits (427), Expect = 3.687e-46
Identity = 94/177 (53.11%), Postives = 119/177 (67.23%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD +  +        S+NL   +   S     +  ST H    PG  SG H S + D
Sbjct:   72 LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPA-SWRDHDDAVST-HSAGTPGPSSGGHASQSGD 245          
BLAST of Homeobox protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 170.629 bits (431), Expect = 3.901e-46
Identity = 82/124 (66.13%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVIEDR+  
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDREGG 193          
BLAST of Homeobox protein vs. Ensembl Xenopus
Match: MEIS1 (Meis homeobox 1 [Source:NCBI gene;Acc:100488182])

HSP 1 Score: 168.318 bits (425), Expect = 4.594e-46
Identity = 83/129 (64.34%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVIEDR+    + S
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEDREGGSKSDS 198          
BLAST of Homeobox protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 172.17 bits (435), Expect = 1.660e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 171.785 bits (434), Expect = 2.292e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   61 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 245          
BLAST of Homeobox protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 172.17 bits (435), Expect = 2.382e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Mouse
Match: Meis2 (Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564])

HSP 1 Score: 171.785 bits (434), Expect = 2.912e-47
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   61 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 245          
BLAST of Homeobox protein vs. Ensembl Mouse
Match: Meis1 (Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717])

HSP 1 Score: 166.392 bits (420), Expect = 3.280e-47
Identity = 86/146 (58.90%), Postives = 107/146 (73.29%), Query Frame = 2
Query:  830 ASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
            A  +GS  N+        K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DR+    + S
Sbjct:   33 APSMGSSVNDA------LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDS 171          
BLAST of Homeobox protein vs. UniProt/SwissProt
Match: sp|P97367|MEIS2_MOUSE (Homeobox protein Meis2 OS=Mus musculus OX=10090 GN=Meis2 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 5.649e-46
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. UniProt/SwissProt
Match: sp|O14770|MEIS2_HUMAN (Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=MEIS2 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 5.881e-46
Identity = 99/195 (50.77%), Postives = 126/195 (64.62%), Query Frame = 2
Query:  827 PASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
            PAS +GS  N+        K +K++IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        S     +  ++ H    PG  SG H S + D
Sbjct:   62 PAS-MGSAVNDA------LKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. UniProt/SwissProt
Match: sp|Q6DIF3|MEIS3_XENTR (Homeobox protein meis3 OS=Xenopus tropicalis OX=8364 GN=meis3 PE=2 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 5.918e-45
Identity = 83/126 (65.87%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX---XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K EK+ IY H LFPLLA++FEKCELAT +P+ +S S       SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVH+LCDNFC RYITCLK KMPIDLVI+DRD +
Sbjct:   63 LKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQ-VRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRDGS 187          
BLAST of Homeobox protein vs. UniProt/SwissProt
Match: sp|Q60954|MEIS1_MOUSE (Homeobox protein Meis1 OS=Mus musculus OX=10090 GN=Meis1 PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 6.008e-45
Identity = 82/129 (63.57%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DR+    + S
Sbjct:   71 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDS 198          
BLAST of Homeobox protein vs. UniProt/SwissProt
Match: sp|Q5U4X3|MEI3A_XENLA (Homeobox protein meis3-A OS=Xenopus laevis OX=8355 GN=meis3-a PE=2 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 6.038e-45
Identity = 83/126 (65.87%), Postives = 101/126 (80.16%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX---XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSA 1249
             K EK+ IY H LFPLLA++FEKCELAT +P+ +S S       SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVH+LCDNFC RYITCLK KMPIDLVI+DRD +
Sbjct:   63 LKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQ-VRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRDGS 187          
BLAST of Homeobox protein vs. TrEMBL
Match: A0A1S6KMH3 (Meis_PKNOX_N domain-containing protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 385/385 (100.00%), Postives = 385/385 (100.00%), Query Frame = 2
Query:  566 MSTNVSNNSKNFNMRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHXXXXXXXXXXXYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAEXXXXXXXXXXXXXXXXXXXXXXXSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG 1720
            MSTNVSNNSKNFNMRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHSSESSINQQSSYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSESFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESGGGGGNGGSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAELHHSDPQQQHQHQLKMQQQLYHLSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG
Sbjct:    1 MSTNVSNNSKNFNMRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHSSESSINQQSSYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSESFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESGGGGGNGGSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAELHHSDPQQQHQHQLKMQQQLYHLSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG 385          
BLAST of Homeobox protein vs. TrEMBL
Match: A0A504YY93 (Homeobox protein Meis2 OS=Fasciola gigantica OX=46835 GN=FGIG_01411 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 1.384e-51
Identity = 98/150 (65.33%), Postives = 113/150 (75.33%), Query Frame = 2
Query:  872 DYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX----------XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSN 1291
            D   +  + S+Y H LFPLLA+IFEKCELAT TP+ + ++              SSESFNED++VFAKEL +S K I + + EMD L+IQAIQVLRFHLLEIEKVHELCDNFCSRYITCL+ KMPIDLVIEDRDSAGSTGS  SPQP S 
Sbjct:  300 DTDLQKARSSVYEHPLFPLLALIFEKCELATCTPRDTGTNNAPSNTSGNGMDVWSSESFNEDIVVFAKELTSSQKSIATSDPEMDSLIIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVSG 449          
BLAST of Homeobox protein vs. TrEMBL
Match: A0A4E0S265 (Homeobox protein Meis2 OS=Fasciola hepatica OX=6192 GN=D915_001891 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.199e-51
Identity = 111/201 (55.22%), Postives = 132/201 (65.67%), Query Frame = 2
Query:  872 DYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX----------XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQ---HVSGNSDLRLLAENAN 1435
            D   +  + S+Y H LFPLLA+IFEKCELAT TP+ + ++              SSESFNED++VFAKEL +S K I + + EMD L+IQAIQVLRFHLLEIEKVHELCDNFCSRYITCL+ KMPIDLVIEDRDSAGSTGS  SPQP S   T+ +  S     +     +   I  N SG    H SGNS    L ++ N
Sbjct:  303 DTDLQKARSSVYEHPLFPLLALIFEKCELATCTPRDTGTNNASSNTSGNGMDVWSSESFNEDIVVFAKELTSSQKSIATNDPEMDSLIIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPVSG--TLPSNISSNNTASNSGNNNATAI--NASGNLATHTSGNSLFNNLGDDGN 499          
BLAST of Homeobox protein vs. TrEMBL
Match: A0A183NW69 (Meis_PKNOX_N domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6355 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 2.174e-50
Identity = 96/143 (67.13%), Postives = 113/143 (79.02%), Query Frame = 2
Query:  893 KESIYSHSLFPLLAVIFEKCELATYTPK-------------YXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQP 1282
            + ++Y H LFPLLA+IFEKCELAT TP+              ++ +M++ SSESFNED++VFAKELV S K I + + E+D L+IQAIQVLRFHLLEIEKVHELCDNFCSRYITCL+ KMPIDLVIEDRDSAGSTGS  SPQP
Sbjct:  333 RSALYEHPLFPLLALIFEKCELATCTPRDPMSAAAASASGNTNTGNMEVWSSESFNEDIIVFAKELVNSQKTIRTGDPELDSLIIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQP 475          
BLAST of Homeobox protein vs. TrEMBL
Match: G7YMY5 (Homeobox protein meis3 OS=Clonorchis sinensis OX=79923 GN=CLF_102139 PE=4 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 3.845e-50
Identity = 97/143 (67.83%), Postives = 111/143 (77.62%), Query Frame = 2
Query:  893 KESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXX----------XXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSN 1291
            + S+Y H LFPLLA+IFEKCELAT TP+ ++ S              SSESFNED++VFAKEL +S K I +   E+D L+IQAIQVLRFHLLEIEKVHELCDNFCSRYITCL+ KMPIDLVIEDRDSAGSTGS  SPQP+S 
Sbjct:  233 RASVYDHPLFPLLALIFEKCELATCTPRDATGSSASNHSASAGLDVWSSESFNEDIVVFAKELASSQKNIRTGEPELDSLIIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLRGKMPIDLVIEDRDSAGSTGSGNSPQPASG 375          
BLAST of Homeobox protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 169.859 bits (429), Expect = 1.206e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPTSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 170.244 bits (430), Expect = 2.385e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPTSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 169.474 bits (428), Expect = 2.472e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   73 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPTSWRDHDDATSTHSAGTPGPSSGGHASQSGD 246          
BLAST of Homeobox protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 169.088 bits (427), Expect = 3.087e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   72 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPTSWRDHDDATSTHSAGTPGPSSGGHASQSGD 245          
BLAST of Homeobox protein vs. Ensembl Cavefish
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:103045180])

HSP 1 Score: 169.474 bits (428), Expect = 1.077e-45
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   72 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPTSWRDHDDATSTHSAGTPGPSSGGHASQSGD 245          
BLAST of Homeobox protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001860.1 (pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 gene:ENSPMAG00000001690.1 transcript:ENSPMAT00000001860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 2.955e-45
Identity = 86/129 (66.67%), Postives = 104/129 (80.62%), Query Frame = 2
Query:  911 HSLFPLLAVIFEKCELATYTPKYXXXXX-XXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGST-GSAASPQPSSN 1291
            H LFPLLA++FEKCELAT TP+    +  D+CSS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DRD  GST G     +PSS+
Sbjct:    1 HPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDRD--GSTKGDDDVSRPSSS 126          
BLAST of Homeobox protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 97.4413 bits (241), Expect = 1.350e-22
Identity = 52/134 (38.81%), Postives = 78/134 (58.21%), Query Frame = 2
Query:  878 QFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQ 1279
            Q   +K SIYSH LFPLL ++  +CE AT   +         +S   + ++    + ++ +  +++S N + D LM++A+QVLR HLLE+EKV ELC +FC RYI CL+ K+  D ++  R  AG   S   PQ
Sbjct:   37 QMDADKNSIYSHPLFPLLRLMMLRCEEATQGAE-------GITSAGLSAEI----QAMLGTQSELFSGNGDTDSLMLKAVQVLRIHLLELEKVRELCQDFCERYIACLRGKLSSDNLL--RGDAGPASSQLDPQ 157          
BLAST of Homeobox protein vs. Ensembl Sea Lamprey
Match: pknox2 (pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-031118-112])

HSP 1 Score: 92.8189 bits (229), Expect = 1.275e-20
Identity = 55/111 (49.55%), Postives = 73/111 (65.77%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKM 1213
             + +K ++Y H LFPLLA++FE+CE AT          D  SS  F+ D+  F +   +  K  +S   E+D LM++AIQVLR HLLE+EKV +LC +FCSRYITCLKSKM
Sbjct:   38 LEADKRAVYRHPLFPLLALLFERCEEATL-------GSDSVSSAGFDLDIEGFVQRQESERKPFFSDEPEIDNLMVKAIQVLRIHLLELEKVSDLCKDFCSRYITCLKSKM 141          
BLAST of Homeobox protein vs. Ensembl Nematostella
Match: EDO36439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIN3])

HSP 1 Score: 171.785 bits (434), Expect = 9.478e-49
Identity = 94/170 (55.29%), Postives = 117/170 (68.82%), Query Frame = 2
Query:  806 IRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAG-STGSAASPQ-PSSNLQTVS 1306
            + S+  HP S +   +  +  SD   K +KE +Y H LFPLLA+IFEKCELAT TP+   +      SS SFNED+  FAK+   SDK I+S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYITCLK KMPIDLV++++++ G S G    P  PS +LQ  +
Sbjct:    6 VTSSYHHPPSSLAVTSTMSTVSDIH-KRDKEVLYGHPLFPLLALIFEKCELATCTPREPGAVGGDVCSSASFNEDIQAFAKQF-KSDKAIFSSNHEVDSLMIQAIQVLRFHLLELEKVHELCDNFCKRYITCLKGKMPIDLVMDEKENGGKSKGDVDLPDSPSDDLQQTA 173          
BLAST of Homeobox protein vs. Ensembl Nematostella
Match: EDO39375 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAC9])

HSP 1 Score: 102.449 bits (254), Expect = 3.461e-24
Identity = 54/108 (50.00%), Postives = 71/108 (65.74%), Query Frame = 2
Query:  890 EKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKM 1213
            EK +IY H LFPLLA++ EKCE AT T        D  +S++F+ D+  F  +     K  +S + E+D L+I+AIQV R HLLE+EKV+ELC +FC RYI CLK KM
Sbjct:    4 EKVAIYRHPLFPLLAMLLEKCEHATQT-------SDCPTSDAFDNDIKNFMMQHNREGKPCFSGDQELDNLIIKAIQVFRIHLLELEKVNELCKDFCQRYIACLKGKM 104          
BLAST of Homeobox protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 169.859 bits (429), Expect = 1.149e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGD 244          
BLAST of Homeobox protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 169.474 bits (428), Expect = 1.390e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   70 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGD 243          
BLAST of Homeobox protein vs. Ensembl Medaka
Match: meis2a (Meis homeobox 2 [Source:NCBI gene;Acc:101174873])

HSP 1 Score: 170.629 bits (431), Expect = 2.617e-46
Identity = 92/177 (51.98%), Postives = 117/177 (66.10%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSD 1408
             K +K+ IY H LFPLLA++FEKCELAT TP+    +     SS+SFNED+ VFAK+ V ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI++RD  GS+ S       S+        +     +  ++ H    PG  SG H S + D
Sbjct:   71 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQ-VRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERD--GSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGD 244          
BLAST of Homeobox protein vs. Ensembl Medaka
Match: meis1b (Meis homeobox 1 [Source:NCBI gene;Acc:101167316])

HSP 1 Score: 166.777 bits (421), Expect = 9.512e-46
Identity = 82/129 (63.57%), Postives = 101/129 (78.29%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             K +K++IY H LFPLLA+IFEKCELAT TP+    +     SSESFNED+ VFAK+ + ++K ++S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVI+DR+    + S
Sbjct:   70 LKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFAKQ-IRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDDREGGSKSDS 197          
BLAST of Homeobox protein vs. Ensembl Medaka
Match: meis2a (homeobox protein Meis1 [Source:NCBI gene;Acc:101171546])

HSP 1 Score: 162.54 bits (410), Expect = 2.513e-44
Identity = 92/178 (51.69%), Postives = 116/178 (65.17%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGS-----TGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVS 1396
             K +K+ IY H LFPLLA++FEKCELAT TP+   ++     SS+SF+ED+ VF+K+ +  +K I+S N E+D LMIQAIQVLRFHLLE+EKVHELCDNFC RYI+CLK KMPIDLVIE+RD         TGS      S+NL  ++            +   G   PG  SG H+S
Sbjct:   46 LKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGAAGGDVCSSDSFSEDICVFSKQ-IRVEKPIFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIEERDICKQDFDDLTGS------STNLADLNPASWRDMDDVHSAPSVG--TPGPSSGGHIS 214          
BLAST of Homeobox protein vs. Planmine SMEST
Match: SMESG000078684.1 (SMESG000078684.1)

HSP 1 Score: 632.869 bits (1631), Expect = 0.000e+0
Identity = 372/372 (100.00%), Postives = 372/372 (100.00%), Query Frame = 2
Query:  605 MRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHXXXXXXXXXXXYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESXXXXXXXXSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAEXXXXXXXXXXXXXXXXXXXXXXXSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG 1720
            MRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHSSESSINQQSSYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSESFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESGGGGGNGGSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAELHHSDPQQQHQHQLKMQQQLYHLSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG
Sbjct:    1 MRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLSKHLNHNNDVDDLSRSVCHSSESSINQQSSYIRSTVSHPASYVGSLANNTHESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSESFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVESGGGGGNGGSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNPHHQSNHYSGSNHRLVHDASMYQLAAELHHSDPQQQHQHQLKMQQQLYHLSHQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHG 372          
BLAST of Homeobox protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 171.4 bits (433), Expect = 3.094e-45
Identity = 91/133 (68.42%), Postives = 114/133 (85.71%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASP 1276
            FK +K+ IY+H LFPLLA+IFEKCELAT +PK S++S +   SSESFN+D+  F KE++TS+K ++S + +++ L+IQA+QVLRFHLLEIEKVHELCDNFC+RYITCLK KMPIDLVIEDRDS GSTGS +SP
Sbjct:  123 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPDINSLIIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSP 255          
BLAST of Homeobox protein vs. Planmine SMEST
Match: SMESG000006530.1 (SMESG000006530.1)

HSP 1 Score: 171.4 bits (433), Expect = 3.259e-45
Identity = 91/133 (68.42%), Postives = 114/133 (85.71%), Query Frame = 2
Query:  881 FKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXX-XXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASP 1276
            FK +K+ IY+H LFPLLA+IFEKCELAT +PK S++S +   SSESFN+D+  F KE++TS+K ++S + +++ L+IQA+QVLRFHLLEIEKVHELCDNFC+RYITCLK KMPIDLVIEDRDS GSTGS +SP
Sbjct:  123 FKLDKKEIYNHPLFPLLALIFEKCELATTSPKDSTNSANDVCSSESFNDDITAFVKEIMTSEKDLFSADPDINSLIIQAVQVLRFHLLEIEKVHELCDNFCTRYITCLKGKMPIDLVIEDRDSTGSTGSTSSP 255          
BLAST of Homeobox protein vs. Planmine SMEST
Match: SMESG000013307.1 (SMESG000013307.1)

HSP 1 Score: 112.849 bits (281), Expect = 9.784e-26
Identity = 52/134 (38.81%), Postives = 85/134 (63.43%), Query Frame = 2
Query:  863 HESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYXXXXXXXXXXXXFNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHELCDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGS 1264
             ++D   + EK+SIY H L+P+L+++ E+CE AT +P          S ++F  D+  +      ++K  ++ N ++D LM++AIQVLR HL+E+ KV+ELC +FCSRYI CLK+K+  D + +D + +   GS
Sbjct:   16 QQADPGLEKEKKSIYGHPLYPILSLLLEQCEQATASPD-------SQSPDTFEADLQSYILRNDNNEKYFFTDNKDLDSLMVKAIQVLRIHLIELRKVNELCRDFCSRYINCLKTKIQSDSMFDDSEESSPNGS 142          
The following BLAST results are available for this feature:
BLAST of Homeobox protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS23.078e-4850.77Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.129e-4750.77Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.129e-4750.77Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.309e-4750.77Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
MEIS22.417e-4750.77Meis homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7001][more]
back to top
BLAST of Homeobox protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-628.245e-3751.49Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.324e-3651.49Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-621.619e-3651.49Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-622.007e-3651.49Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
unc-622.247e-3651.49Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hth6.000e-4563.93gene:FBgn0001235 transcript:FBtr0344145[more]
hth6.000e-4563.93gene:FBgn0001235 transcript:FBtr0100455[more]
hth1.119e-4463.93gene:FBgn0001235 transcript:FBtr0100454[more]
hth9.204e-4463.93gene:FBgn0001235 transcript:FBtr0082256[more]
hth1.176e-4363.93gene:FBgn0001235 transcript:FBtr0082255[more]
back to top
BLAST of Homeobox protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a6.734e-4764.52Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis1b4.102e-4664.34Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis1b4.959e-4664.34Meis homeobox 1 b [Source:ZFIN;Acc:ZDB-GENE-020122... [more]
meis2a1.361e-4564.52Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
meis2a1.622e-4564.52Meis homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-020122-... [more]
back to top
BLAST of Homeobox protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEIS11.730e-4664.34Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS11.974e-4664.34Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
meis23.687e-4653.11Meis homeobox 2 [Source:NCBI gene;Acc:100036664][more]
MEIS13.901e-4666.13Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
MEIS14.594e-4664.34Meis homeobox 1 [Source:NCBI gene;Acc:100488182][more]
back to top
BLAST of Homeobox protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meis21.660e-4750.77Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis22.292e-4750.77Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis22.382e-4750.77Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis22.912e-4750.77Meis homeobox 2 [Source:MGI Symbol;Acc:MGI:108564][more]
Meis13.280e-4758.90Meis homeobox 1 [Source:MGI Symbol;Acc:MGI:104717][more]
back to top
BLAST of Homeobox protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P97367|MEIS2_MOUSE5.649e-4650.77Homeobox protein Meis2 OS=Mus musculus OX=10090 GN... [more]
sp|O14770|MEIS2_HUMAN5.881e-4650.77Homeobox protein Meis2 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6DIF3|MEIS3_XENTR5.918e-4565.87Homeobox protein meis3 OS=Xenopus tropicalis OX=83... [more]
sp|Q60954|MEIS1_MOUSE6.008e-4563.57Homeobox protein Meis1 OS=Mus musculus OX=10090 GN... [more]
sp|Q5U4X3|MEI3A_XENLA6.038e-4565.87Homeobox protein meis3-A OS=Xenopus laevis OX=8355... [more]
back to top
BLAST of Homeobox protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMH30.000e+0100.00Meis_PKNOX_N domain-containing protein (Fragment) ... [more]
A0A504YY931.384e-5165.33Homeobox protein Meis2 OS=Fasciola gigantica OX=46... [more]
A0A4E0S2653.199e-5155.22Homeobox protein Meis2 OS=Fasciola hepatica OX=619... [more]
A0A183NW692.174e-5067.13Meis_PKNOX_N domain-containing protein OS=Schistos... [more]
G7YMY53.845e-5067.83Homeobox protein meis3 OS=Clonorchis sinensis OX=7... [more]
back to top
BLAST of Homeobox protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.206e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a2.385e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a2.472e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a3.087e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
meis2a1.077e-4551.98Meis homeobox 2 [Source:NCBI gene;Acc:103045180][more]
back to top
BLAST of Homeobox protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001860.12.955e-4566.67pep scaffold:Pmarinus_7.0:GL485367:2529:11155:-1 g... [more]
pknox21.350e-2238.81pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
pknox21.275e-2049.55pbx/knotted 1 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Homeobox protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO364399.478e-4955.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393753.461e-2450.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
meis2a1.149e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a1.390e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis2a2.617e-4651.98Meis homeobox 2 [Source:NCBI gene;Acc:101174873][more]
meis1b9.512e-4663.57Meis homeobox 1 [Source:NCBI gene;Acc:101167316][more]
meis2a2.513e-4451.69homeobox protein Meis1 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of Homeobox protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000078684.10.000e+0100.00SMESG000078684.1[more]
SMESG000006530.13.094e-4568.42SMESG000006530.1[more]
SMESG000006530.13.259e-4568.42SMESG000006530.1[more]
SMESG000013307.19.784e-2638.81SMESG000013307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010627 ID=SMED30010627|Name=Homeobox protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1792bp
AACAGAGTTAGCGGCATCAAGAATGTAGAGAGAGAGAGAGAGTGATTGAG
TTAGACAGACACACACAAACACATATTATACGAGTCAGTGAAGCAGCAGC
GGCCCACACGGAATATTAATTCGGCTTCATATACTGCCTGTCATTCTCGA
TTAAATTTATATCTCTCTGTCACTGCGCATACTCGACAGTACCGCCGCTA
TATTTTTTTAGTTTCTCGTGACTCTATCAACTCAACATCTGGACCGATCA
TTACATTCACTATTAATAAAAAAGCGTCAATCTATCGCTGTCAATCTATC
TGCGCGCACTCTCCCGCTTTGTCTAATTCAGTGTCAGATTTGTCAGTTTT
AATATCGAAATCAATCTCCAGACGCATCAGTAGTAAATAGTGCTTTAACA
CCTACAAATTCGACATTTTATTGACAACTAGTACTCAAGTTTGGAAATAC
CTTTGGTGTTTTTATTTTAACGAAACCGATCGAATAATTGTGAAAAGAAA
AAGAGAGAAAAAAATTGTTTCAAACGAAATACAAAAAAAAGTAAAAAGAA
AAACAATCGGATAAAATGTCAACAAACGTGTCAAACAACTCGAAAAATTT
CAATATGAGAAATGAAAATCTGACAGTTAGTTTGAAATCGAATTGTTCGA
ATTCCAATGGACTTTTGACAACGTCCTCGCCTTTGTCGGGAGACTTGACC
AATACGTCATTATCGAAACATTTGAATCACAATAATGATGTCGATGATCT
GTCGAGATCAGTTTGTCATTCCTCAGAATCATCAATTAATCAACAGTCAT
CCTACATCAGATCAACAGTTTCCCATCCAGCCTCCTATGTAGGATCGTTG
GCCAATAATACGCATGAATCAGATTACCAGTTTAAAGGCGAAAAGGAAAG
CATTTATAGCCATTCTCTTTTTCCGTTATTGGCGGTTATTTTTGAGAAAT
GCGAACTTGCCACTTACACCCCAAAATATTCATCAAGCTCAATGGATATC
TGTTCTTCTGAATCCTTCAATGAAGATGTTATGGTGTTTGCAAAAGAGTT
AGTGACATCAGACAAAAAAATCTACTCACAAAACTCAGAAATGGATTTAT
TGATGATTCAAGCCATTCAAGTATTGCGGTTCCATCTGCTGGAAATAGAA
AAAGTACATGAATTGTGTGACAATTTCTGTTCGCGTTACATAACGTGCTT
GAAAAGTAAAATGCCGATTGATCTGGTAATTGAAGATCGGGATTCGGCTG
GATCGACTGGGTCTGCCGCTAGTCCACAACCGAGCAGTAATTTGCAAACC
GTGTCGACAGTTGAGTCTGGTGGTGGCGGAGGGAATGGTGGTTCAACGAA
ACACGGTAAAACCATTCCCGGAAATGAAAGCGGTCAACATGTGTCAGGAA
ATTCTGATCTCAGACTGTTAGCGGAAAATGCCAATTATTCTCATCAGAAT
TTTATACTTAATCCCCATCATCAGTCGAATCATTATTCTGGTTCCAACCA
TCGTTTGGTTCATGACGCAAGCATGTATCAGTTGGCCGCTGAACTCCACC
ATTCAGATCCCCAACAACAGCACCAGCATCAACTAAAAATGCAACAGCAA
CTATATCATCTATCACATCAAGCTGCTCTCGGTGGTAACCCAACCCATCT
TTCATCTTTACTCTCAAATCATATTGATCCATGCCTCGAAAAATCCCCAA
TCCATCAGATGCATCATGGCAACAATGTTCCGAATAACGTTTGCAACAAC
ATTCACAATAGAAATAGCAATAACAATAACAATAACAACAAC
back to top

protein sequence of SMED30010627-orf-1

>SMED30010627-orf-1 ID=SMED30010627-orf-1|Name=SMED30010627-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MSTNVSNNSKNFNMRNENLTVSLKSNCSNSNGLLTTSSPLSGDLTNTSLS
KHLNHNNDVDDLSRSVCHSSESSINQQSSYIRSTVSHPASYVGSLANNTH
ESDYQFKGEKESIYSHSLFPLLAVIFEKCELATYTPKYSSSSMDICSSES
FNEDVMVFAKELVTSDKKIYSQNSEMDLLMIQAIQVLRFHLLEIEKVHEL
CDNFCSRYITCLKSKMPIDLVIEDRDSAGSTGSAASPQPSSNLQTVSTVE
SGGGGGNGGSTKHGKTIPGNESGQHVSGNSDLRLLAENANYSHQNFILNP
HHQSNHYSGSNHRLVHDASMYQLAAELHHSDPQQQHQHQLKMQQQLYHLS
HQAALGGNPTHLSSLLSNHIDPCLEKSPIHQMHHGNNVPNNVCNNIHNRN
SNNNNNNNN
back to top
Aliases
The feature 'Homeobox protein' has the following synonyms
Synonym
meis2*
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR019774Aromatic-AA_hydroxylase_C
IPR032453PKNOX/Meis_N
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032453Homeobox protein PKNOX/Meis, N-terminalPFAMPF16493Meis_PKNOX_Ncoord: 143..227
e-value: 9.9E-40
score: 134.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..255
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 229..276
NoneNo IPR availablePANTHERPTHR11850HOMEOBOX PROTEIN TRANSCRIPTION FACTORScoord: 54..289
NoneNo IPR availablePANTHERPTHR11850:SF266HOMEOBOX PROTEIN HOMOTHORAXcoord: 54..289