Histone acetyltransferase

Overview
NameHistone acetyltransferase
Smed IDSMED30010620
Length (bp)2693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase (SMED30010620) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30010620) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase (SMED30010620) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30010620) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010620

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30010620h1SMcG0020805 SmedASXL_014804SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30010620h1SMcG0020805 SmedASXL_014804SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30010620h1SMcG0020805 dd_Smed_v4_12274_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT2B (lysine acetyltransferase 2B [Source:HGNC Symbol;Acc:HGNC:8638])

HSP 1 Score: 413.305 bits (1061), Expect = 2.351e-130
Identity = 279/716 (38.97%), Postives = 385/716 (53.77%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSD----------------ANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPV----LDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXXXXXXATFPSNGVSRRKSSRLQQXXXXXXKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDV-----RQLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHS 2138
            +EK+  Y +CK E+ CKC GW   N                   +C+ C H+   HV  +  +S E++  L  +V DVE L++    E + D +Q+YFY+ K ++K I   G KPV    L+   PFEKP +   + NF+   +SH  + + + +V++A+  L  IN + L + S   ++ P++ IS YK  Y RWL +C VP+FC SLPRY+ + +FGR  L S+F   + +LLE+ + E   L       + T FPKFL  LEEE+ +  SPIWD  F                       L + S+ S       G+  V+N P      P +                        T   N      SS L+Q       A  S+  C+ S  +  +P E        K++    HV EE     V      +L+ E+    +D        +  L +  A  + A R+EE  G IEFH++ NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS+EI++ K  Y GYIK+YEGATLMGCEL P+I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW P+    S
Sbjct:   91 LEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRG-KPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDF-----------------------LSASSRTSQL-----GIQTVINPP------PVA-----------------------GTISYNST----SSSLEQ-----PNAGSSSPACKASSGLEANPGE--------KRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAA-RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPSGKEKS 719          

HSP 2 Score: 110.538 bits (275), Expect = 3.926e-24
Identity = 47/107 (43.93%), Postives = 78/107 (72.90%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+K++YY  +++F++D+ R+F NC+ YN  +S  YK + +LE+FF S ++E+ L+
Sbjct:  724 DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLI 830          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT2A (lysine acetyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:4201])

HSP 1 Score: 291.967 bits (746), Expect = 4.506e-85
Identity = 151/251 (60.16%), Postives = 187/251 (74.50%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S +A+RD  AR+EE  G IEFH+I NSLT K   +V +WLV LQ VFS QLP MPKEYI RLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++++  +   YPG+S   FKE    +    +PG++E GW P
Sbjct:  479 LLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPVESVPGIRETGWKP 718          

HSP 2 Score: 154.836 bits (390), Expect = 5.805e-38
Identity = 103/317 (32.49%), Postives = 164/317 (51.74%), Query Frame = 3
Query:   78 IEKILPYQSCK-KEDCKCRGWI---------------ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCA--VQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKG 962
            +EK+  + +CK  E CKC GW                A N    C+ C+H   +HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    ++PV++      PFEKP +   + NF+   +SH + +  + M ++++  L C+N ++L + +      Q ++  +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F +    G      T  +   +SV  +    +P  SP  G
Sbjct:  103 LEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-TRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEG------TQLVPRPASVSAAVVPSTPIFSPSMG 412          

HSP 3 Score: 105.145 bits (261), Expect = 2.221e-22
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER++S+YY  R++F++D+ R+  NCR YN  DS   + ++ LE+FF   ++E  L+
Sbjct:  727 LKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLI 835          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT2A (lysine acetyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:4201])

HSP 1 Score: 128.642 bits (322), Expect = 2.096e-32
Identity = 84/257 (32.68%), Postives = 138/257 (53.70%), Query Frame = 3
Query:   78 IEKILPYQSCKK-EDCKCRGWI---------------ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCA--VQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPK 782
            +EK+  + +CK  E CKC GW                A N    C+ C+H   +HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    ++PV++      PFEKP +   + NF+   +SH +  + + M ++++  L C+N ++L + +      Q ++  +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPK
Sbjct:   21 LEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-TRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPK 276          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT2A (lysine acetyltransferase 2A [Source:HGNC Symbol;Acc:HGNC:4201])

HSP 1 Score: 103.219 bits (256), Expect = 5.178e-26
Identity = 44/63 (69.84%), Postives = 54/63 (85.71%), Query Frame = 3
Query: 1725 GYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLM 1913
            GYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM
Sbjct:    1 GYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLM 63          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: BPTF (bromodomain PHD finger transcription factor [Source:HGNC Symbol;Acc:HGNC:3581])

HSP 1 Score: 95.5153 bits (236), Expect = 3.836e-20
Identity = 42/116 (36.21%), Postives = 77/116 (66.38%), Query Frame = 3
Query: 2310 SSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQ 2657
            S+E+   + T P+ + D+  + L+ ++  L+ H ++ PFL+PV+ ++AP YY +I  P+DL T+ ER++ +YY+    F++D+ ++F NCR YN +DS  Y+ + VLE FF+  ++
Sbjct:  301 STEDAMTVLT-PLTEKDY--EGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLK 413          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: pcaf-1 (P300/CBP Associated Factor homolog [Source:UniProtKB/TrEMBL;Acc:Q9N3S7])

HSP 1 Score: 241.121 bits (614), Expect = 1.028e-67
Identity = 149/431 (34.57%), Postives = 211/431 (48.96%), Query Frame = 3
Query: 1371 MSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQES 2663
            ++   SR ++A  EE +G IEF +I N L   Q ++  V LVELQ +F  QLP MPKEY+TRL+FD +H+N+V++K         +  VIGGICFR FP++GF EIVFCA+   EQVKGYGT LMNH KDY I++ + H LTYAD +A GYF KQGFS ++ +N   YQG+IK                                             EY G +L       GC    QI   K   +       S  I  +      + G   +  + G +E     +  +    R    TD  ++H   K S  +L+E         D L  ++  I+  L     + PF  PV+  E P YY  I  PID +T+ E++K K Y H+ +FI+D+ R+F NC V+N  ++  YK    L    + +++ S
Sbjct:  396 LNTEVSRGLSALQEEESGLIEFRVIGNDLDPFQHHEQLVHLVELQNLFGAQLPKMPKEYVTRLIFDSRHQNMVILKR--------DMGVIGGICFRTFPSRGFVEIVFCAITAMEQVKGYGTHLMNHCKDYMIKNKIYHMLTYADEFAIGYFTKQGFSEKLEINDTVYQGWIK---------------------------------------------EYEGATLM------GCHLHPQISYTKFPDF-------SKGIQALHCGYKSENGAESRGKVFGGLEHLFRESSPQLLELRKVPGTDSLKMH---KKSCYHLDE-------RDDSLDSKIGAILKKLTADKNAWPFASPVDVKEVPEYYDHIKHPIDFKTMQEKLKRKAYTHQHLFIADLNRLFQNCYVFNGAEAVYYKYGYKLNELALKLLKTS 750          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: athp-2 (AT Hook plus PHD finger transcription factor [Source:UniProtKB/TrEMBL;Acc:Q9N5L9])

HSP 1 Score: 68.1662 bits (165), Expect = 2.931e-11
Identity = 43/138 (31.16%), Postives = 64/138 (46.38%), Query Frame = 3
Query: 2247 PTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            PT+K++  ST  T             N+I  V I +       +  ++ +      S PFLQPV+S E P YY +I  P++LRT+  +IK + Y       +D   +  NC  YNE ++ IYK S  L  F    + E
Sbjct: 1299 PTSKKSVTSTPTT-------------NDISRVIIPNIKEKMTLIETLLKEAMRQECSWPFLQPVDSKEVPDYYDVIKRPMNLRTMMNKIKQRIYNKPIEVRNDFQLILSNCETYNEPENEIYKLSRELHDFMADRLDE 1423          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: nurf-1 (Nucleosome-remodeling factor subunit NURF301-like [Source:UniProtKB/Swiss-Prot;Acc:Q6BER5])

HSP 1 Score: 62.003 bits (149), Expect = 4.294e-11
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 3
Query: 2412 LSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            +S PF  PV+ +E P Y K I  P+DL TI+++++   Y +   F++DV +MF N + YN   +A++K +  ++  F
Sbjct:    1 MSTPFRNPVDLNEFPDYEKFIKKPMDLSTITKKVERTEYLYLSQFVNDVNQMFENAKTYNPKGNAVFKCAETMQEVF 77          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: nurf-1 (Nucleosome-remodeling factor subunit NURF301-like [Source:UniProtKB/Swiss-Prot;Acc:Q6BER5])

HSP 1 Score: 62.003 bits (149), Expect = 4.294e-11
Identity = 27/77 (35.06%), Postives = 47/77 (61.04%), Query Frame = 3
Query: 2412 LSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            +S PF  PV+ +E P Y K I  P+DL TI+++++   Y +   F++DV +MF N + YN   +A++K +  ++  F
Sbjct:    1 MSTPFRNPVDLNEFPDYEKFIKKPMDLSTITKKVERTEYLYLSQFVNDVNQMFENAKTYNPKGNAVFKCAETMQEVF 77          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: nurf-1 (Nucleosome-remodeling factor subunit NURF301-like [Source:UniProtKB/Swiss-Prot;Acc:Q6BER5])

HSP 1 Score: 65.4698 bits (158), Expect = 8.624e-11
Identity = 28/79 (35.44%), Postives = 48/79 (60.76%), Query Frame = 3
Query: 2406 HSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            H +S PF  PV+ +E P Y K I  P+DL TI+++++   Y +   F++DV +MF N + YN   +A++K +  ++  F
Sbjct:  260 HRMSTPFRNPVDLNEFPDYEKFIKKPMDLSTITKKVERTEYLYLSQFVNDVNQMFENAKTYNPKGNAVFKCAETMQEVF 338          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Gcn5 (gene:FBgn0020388 transcript:FBtr0075969)

HSP 1 Score: 325.865 bits (834), Expect = 5.311e-98
Identity = 179/436 (41.06%), Postives = 242/436 (55.50%), Query Frame = 3
Query: 1362 KLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            ++L  ++ SRD   + EE    IEFH++ NSLT     Q  +WL+ LQ VF+ QLP MP+EYI++LVFD KHK L L+K         E   IGGICFR FP+QGFTEIVFCAV  +EQVKGYGT LMNHLKDY IQ G+ H LT+AD  A GYF+KQGFS++I+L +  Y GYIKEY+ ATLM CEL+P IV T+F  +IR Q +I+  +I +R   ++   PG  L  FKE    +    IPGL+E GW P                              Q  P  ++ P + +T     +T F  +             + +V      W    LRP+ A                 +E P YY  I +P+DL+T+ ER+K  YY+ R++F++D+ R+F NCR YN  D+  Y+ +  LER+F + M+E  L
Sbjct:  448 EILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIK---------ENQPIGGICFRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHNEVQKVRPG--LTCFKEGLPVIPVESIPGLREIGWKP------------------------------QNRPARSSRPLEESTDPEKLATSFASV-------------LQSVRQHTTAWPF--LRPVTA-----------------AEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGL 810          

HSP 2 Score: 117.087 bits (292), Expect = 1.720e-26
Identity = 76/279 (27.24%), Postives = 134/279 (48.03%), Query Frame = 3
Query:   78 IEKILPYQSCKKEDCKCRGWIAD----------------NSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCI---HHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCIN--NFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQ 848
            + K+  Y +C+ E C+C GW                   N +     C HS   H+  +  +S   + +L   + D+E L+   +   + D +++Y Y+ + +++C+        +  L D  PFE PC+   + + +   Y+H S+ + + M ++A++ L  +N  NF   S     +  ++  +YK+ Y RWL  C+VP FC SL + + S++FGR  L ++F    ++L +K  SE     E   + + T  PKFL  L  EL    SPIWD  ++
Sbjct:   90 LAKLSMYSACQSEGCRCTGWKTPQENRHRDVESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRVEDEDTKKVYQYLFRLLRQCVLTRQQAVIRGPLGD-PPFETPCITKAVLSLVFYKYNHLSTPELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLRQCETSLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSII-TLMPKFLETLRAELLKDDSPIWDTSYR 366          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: E(bx) (gene:FBgn0000541 transcript:FBtr0072522)

HSP 1 Score: 80.8777 bits (198), Expect = 4.666e-15
Identity = 33/93 (35.48%), Postives = 59/93 (63.44%), Query Frame = 3
Query: 2367 ADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
             ++L+ ++  ++ H  + PF++PV+  EAP YYK+I  P+DL+ +  +++S  Y     FI D+ ++F NCR YN  +S+ YK +  LE +F+
Sbjct: 2542 VEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESSFYKCAEALESYFV 2634          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: E(bx) (gene:FBgn0000541 transcript:FBtr0332102)

HSP 1 Score: 80.8777 bits (198), Expect = 4.734e-15
Identity = 33/93 (35.48%), Postives = 59/93 (63.44%), Query Frame = 3
Query: 2367 ADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
             ++L+ ++  ++ H  + PF++PV+  EAP YYK+I  P+DL+ +  +++S  Y     FI D+ ++F NCR YN  +S+ YK +  LE +F+
Sbjct: 2654 VEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESSFYKCAEALESYFV 2746          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: E(bx) (gene:FBgn0000541 transcript:FBtr0332103)

HSP 1 Score: 80.8777 bits (198), Expect = 4.915e-15
Identity = 33/93 (35.48%), Postives = 59/93 (63.44%), Query Frame = 3
Query: 2367 ADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
             ++L+ ++  ++ H  + PF++PV+  EAP YYK+I  P+DL+ +  +++S  Y     FI D+ ++F NCR YN  +S+ YK +  LE +F+
Sbjct: 2561 VEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESSFYKCAEALESYFV 2653          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: E(bx) (gene:FBgn0000541 transcript:FBtr0072521)

HSP 1 Score: 80.8777 bits (198), Expect = 4.915e-15
Identity = 33/93 (35.48%), Postives = 59/93 (63.44%), Query Frame = 3
Query: 2367 ADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
             ++L+ ++  ++ H  + PF++PV+  EAP YYK+I  P+DL+ +  +++S  Y     FI D+ ++F NCR YN  +S+ YK +  LE +F+
Sbjct: 2562 VEELKNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDMTKIFDNCRYYNPKESSFYKCAEALESYFV 2654          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat2a (K(lysine) acetyltransferase 2A [Source:NCBI gene;Acc:555517])

HSP 1 Score: 378.637 bits (971), Expect = 6.463e-118
Identity = 204/435 (46.90%), Postives = 270/435 (62.07%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+HG+ +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE        QIP               + IP I+ T                          KP+ K  +K                         + D D L + L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER+K++YY  +++FI+D+ R+  NCR YN  DS   K++  LE+FF   ++E+ L+
Sbjct:  437 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPG--LTCFKEG-----VRQIP--------------VESIPGIRETG------------------------WKPSAKEKSKE------------------------LKDPDLLYNMLKNLLAQIKTHPDAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKSANTLEKFFYFKLKEAGLI 793          

HSP 2 Score: 160.614 bits (405), Expect = 3.897e-40
Identity = 106/302 (35.10%), Postives = 158/302 (52.32%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDA---------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-------ILSP 878
            F  ++ +EK+  + SCK  D CKC GW   N                   C+ C HS  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI   G KPV++      PFEKP +   + NF+   +SH + K  + M ++++  L C+N ++L + S      Q ++  +YK+ Y RWL +C+VP+   SLPRY+   +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G       +LSP
Sbjct:   57 FPRAKKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMG-KPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSP 357          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat2a (K(lysine) acetyltransferase 2A [Source:NCBI gene;Acc:555517])

HSP 1 Score: 317.39 bits (812), Expect = 9.752e-95
Identity = 154/257 (59.92%), Postives = 190/257 (73.93%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHS 2138
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+HG+ +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE    +    IPG++E GW P+    S
Sbjct:  437 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPG--LTCFKEGVRQIPVESIPGIRETGWKPSAKEKS 682          

HSP 2 Score: 160.229 bits (404), Expect = 5.058e-40
Identity = 106/302 (35.10%), Postives = 158/302 (52.32%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDA---------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-------ILSP 878
            F  ++ +EK+  + SCK  D CKC GW   N                   C+ C HS  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI   G KPV++      PFEKP +   + NF+   +SH + K  + M ++++  L C+N ++L + S      Q ++  +YK+ Y RWL +C+VP+   SLPRY+   +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G       +LSP
Sbjct:   57 FPRAKKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMG-KPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSP 357          

HSP 3 Score: 93.9745 bits (232), Expect = 3.663e-19
Identity = 41/89 (46.07%), Postives = 65/89 (73.03%), Query Frame = 3
Query: 2406 HSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            H  + PF++PV  SEAP YY++I FPIDL+T++ER+K++YY  +++FI+D+ R+  NCR YN  DS   K++  LE+FF   ++E+ L+
Sbjct:  729 HPDAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKSANTLEKFFYFKLKEAGLI 817          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat2b (K(lysine) acetyltransferase 2B [Source:NCBI gene;Acc:563942])

HSP 1 Score: 297.36 bits (760), Expect = 1.558e-87
Identity = 154/251 (61.35%), Postives = 190/251 (75.70%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S H++RD AAR+EE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FKE    ++   IPG++E GW P
Sbjct:  440 LLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIKDYEGATLMGCELNPCIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIAIESIPGIRETGWKP 679          

HSP 2 Score: 164.081 bits (414), Expect = 3.047e-41
Identity = 111/314 (35.35%), Postives = 170/314 (54.14%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDAN--------------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD--DCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSP 941
            +EK+  Y SCK E  CKC GW + N                        C+ C H+  +HV  +  +S E++  L  +V DVE LY+    E + D +Q+YF + K ++KCI   G +PV++  +  PFEKP +   + NF+   +SH  S + + +V++A+  L  IN ++L + S    + PD+ ++ YK+ Y RWL +C VP+FC SLPRY+A+ IFGR FL S+F   +++LLE+ + E   L       + T FPKFL  LEEE+ +  SPIW   F +   +G   PT+ +      S+  S S P+P
Sbjct:   57 LEKLGVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPTAVSLMEPCRSCSHALGDHVTHLENVSEEEMNRLLGIVLDVEYLYTCVHKEEDPDTKQVYFSLFKLLRKCILQMG-RPVVEALESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQKRQRAPDDDVAGYKVNYTRWLCYCNVPQFCDSLPRYEATQIFGRIFLRSVFTIMRKQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSHNSPIWSENF-MIGLSGGQIPTVVSAPPVNRSLYYSSS-PAP 367          

HSP 3 Score: 113.235 bits (282), Expect = 3.989e-25
Identity = 49/109 (44.95%), Postives = 79/109 (72.48%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+KS+YY  R++F++D+ R+F NCR YN  +S  YK + +LE+FF + ++E+ L+
Sbjct:  686 LKDPDQLYSTLKNILTQVKSHPNAWPFMEPVKKNEAPGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYTKIKEAGLI 794          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat2a (K(lysine) acetyltransferase 2A [Source:NCBI gene;Acc:555517])

HSP 1 Score: 194.126 bits (492), Expect = 1.676e-52
Identity = 94/138 (68.12%), Postives = 107/138 (77.54%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGL 1781
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+HG+
Sbjct:  437 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGI 565          

HSP 2 Score: 161.77 bits (408), Expect = 2.109e-41
Identity = 106/302 (35.10%), Postives = 158/302 (52.32%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDA---------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-------ILSP 878
            F  ++ +EK+  + SCK  D CKC GW   N                   C+ C HS  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI   G KPV++      PFEKP +   + NF+   +SH + K  + M ++++  L C+N ++L + S      Q ++  +YK+ Y RWL +C+VP+   SLPRY+   +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G       +LSP
Sbjct:   57 FPRAKKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMG-KPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSP 357          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: bptf (bromodomain PHD finger transcription factor [Source:ZFIN;Acc:ZDB-GENE-030131-3200])

HSP 1 Score: 95.5153 bits (236), Expect = 2.425e-19
Identity = 44/112 (39.29%), Postives = 73/112 (65.18%), Query Frame = 3
Query: 2310 SSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
            S+E+   + T P+ D D+  + L+ I+  L+ H ++ PFL+PV+ ++AP YY II  P+DL T+ ERI+ ++Y     F++D+ ++F NCR YN +DS  Y+ +  LE FF+
Sbjct: 2770 STEDAMTVLT-PLTDKDY--EGLKRILRSLQSHKMAWPFLEPVDPNDAPDYYGIIKEPMDLSTMEERIQKRFYSKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEFLESFFV 2878          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: diras2 (DIRAS family GTP binding RAS like 2 [Source:Xenbase;Acc:XB-GENE-485682])

HSP 1 Score: 303.138 bits (775), Expect = 8.605e-90
Identity = 192/435 (44.14%), Postives = 250/435 (57.47%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++R   +   YPG  L  FKE    +    IPG++E GW PA           +I  P +     K  L+ QI+   +A P     K               KS + +  E+   PID        L+ +   LK+                  YY           ++++I          FI+D+ R+  NCR YN  DS   K +  LE+FF   ++E+ L+
Sbjct:  408 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERRHAQIRKVYPG--LTCFKEGLRQIPVECIPGIRETGWKPACKDKGK-----EIKDPDQLYNILKN-LLAQIKTHPSAWPFMEPVK---------------KSEAPDYYEVIRFPID--------LKTMTERLKNR-----------------YY-----------VTKKI----------FIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGLI 764          

HSP 2 Score: 132.109 bits (331), Expect = 5.346e-31
Identity = 86/248 (34.68%), Postives = 135/248 (54.44%), Query Frame = 3
Query:  141 ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCAVQPDNP--ISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            A   D+   +C   +  HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI     +PV++      PFEKP +   + NF+   +SH   K  + M ++++  L C+N ++L + S    +  N    +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G
Sbjct:   80 ASARDSEASVC-FLAANHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-IRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLQPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPTTEG 325          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: diras2 (DIRAS family GTP binding RAS like 2 [Source:Xenbase;Acc:XB-GENE-485682])

HSP 1 Score: 303.138 bits (775), Expect = 1.010e-89
Identity = 192/435 (44.14%), Postives = 250/435 (57.47%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++R   +   YPG  L  FKE    +    IPG++E GW PA           +I  P +     K  L+ QI+   +A P     K               KS + +  E+   PID        L+ +   LK+                  YY           ++++I          FI+D+ R+  NCR YN  DS   K +  LE+FF   ++E+ L+
Sbjct:  419 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERRHAQIRKVYPG--LTCFKEGLRQIPVECIPGIRETGWKPACKDKGK-----EIKDPDQLYNILKN-LLAQIKTHPSAWPFMEPVK---------------KSEAPDYYEVIRFPID--------LKTMTERLKNR-----------------YY-----------VTKKI----------FIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGLI 775          

HSP 2 Score: 130.183 bits (326), Expect = 2.431e-30
Identity = 83/231 (35.93%), Postives = 129/231 (55.84%), Query Frame = 3
Query:  192 HVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCAVQPDNP--ISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI     +PV++      PFEKP +   + NF+   +SH   K  + M ++++  L C+N ++L + S    +  N    +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G
Sbjct:   97 HVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-IRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLQPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPTTEG 326          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: diras2 (DIRAS family GTP binding RAS like 2 [Source:Xenbase;Acc:XB-GENE-485682])

HSP 1 Score: 303.138 bits (775), Expect = 1.039e-89
Identity = 192/435 (44.14%), Postives = 250/435 (57.47%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++R   +   YPG  L  FKE    +    IPG++E GW PA           +I  P +     K  L+ QI+   +A P     K               KS + +  E+   PID        L+ +   LK+                  YY           ++++I          FI+D+ R+  NCR YN  DS   K +  LE+FF   ++E+ L+
Sbjct:  414 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERRHAQIRKVYPG--LTCFKEGLRQIPVECIPGIRETGWKPACKDKGK-----EIKDPDQLYNILKN-LLAQIKTHPSAWPFMEPVK---------------KSEAPDYYEVIRFPID--------LKTMTERLKNR-----------------YY-----------VTKKI----------FIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGLI 770          

HSP 2 Score: 129.798 bits (325), Expect = 3.337e-30
Identity = 83/231 (35.93%), Postives = 129/231 (55.84%), Query Frame = 3
Query:  192 HVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCAVQPDNP--ISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI     +PV++      PFEKP +   + NF+   +SH   K  + M ++++  L C+N ++L + S    +  N    +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G
Sbjct:   92 HVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-IRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLQPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPTTEG 321          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: diras2 (DIRAS family GTP binding RAS like 2 [Source:Xenbase;Acc:XB-GENE-485682])

HSP 1 Score: 302.368 bits (773), Expect = 2.025e-89
Identity = 192/435 (44.14%), Postives = 250/435 (57.47%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++R   +   YPG  L  FKE    +    IPG++E GW PA           +I  P +     K  L+ QI+   +A P     K               KS + +  E+   PID        L+ +   LK+                  YY           ++++I          FI+D+ R+  NCR YN  DS   K +  LE+FF   ++E+ L+
Sbjct:  421 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERRHAQIRKVYPG--LTCFKEGLRQIPVECIPGIRETGWKPACKDKGK-----EIKDPDQLYNILKN-LLAQIKTHPSAWPFMEPVK---------------KSEAPDYYEVIRFPID--------LKTMTERLKNR-----------------YY-----------VTKKI----------FIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGLI 777          

HSP 2 Score: 130.183 bits (326), Expect = 2.600e-30
Identity = 83/234 (35.47%), Postives = 130/234 (55.56%), Query Frame = 3
Query:  183 SEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCAVQPDNP--ISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            +  HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI     +PV++      PFEKP +   + NF+   +SH   K  + M ++++  L C+N ++L + S    +  N    +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G
Sbjct:   94 AANHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-IRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLQPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPTTEG 326          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: KAT2B (K(lysine) acetyltransferase 2B [Source:NCBI gene;Acc:100488927])

HSP 1 Score: 290.812 bits (743), Expect = 5.840e-85
Identity = 152/252 (60.32%), Postives = 189/252 (75.00%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA 2123
             +S  ++RD AAR+EE  G IEFH++ NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P+I YTEFS +I++QK+I+ +II++++  +   YPG+S   FKE    +    IPG++E GW P+
Sbjct:  448 FLSAISARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMIWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNVLNFLTYADEYAIGYFKKQGFSKDIKVPKARYVGYIKDYEGATLMGCELNPKIPYTEFSVIIKKQKEIIKKIIERKQAQIRKVYPGLSC--FKEGVRQIPIESIPGIRETGWKPS 688          

HSP 2 Score: 144.821 bits (364), Expect = 5.597e-35
Identity = 96/283 (33.92%), Postives = 149/283 (52.65%), Query Frame = 3
Query:   78 IEKILPYQSCKK-EDCKCRGWIADNSDAN----------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTS 857
            +EK+  Y +CK  E CKC GW   N                    C+ C H+   HV  +  +S E++  L  +V D+E L++    E + D +Q+YF + K ++KCI     KP ++      PFEKP +   + NF+   +SH  S + + ++++A+  L  IN + L + S   ++ P++ I+ YK  Y RWL +C VP+FC SL RY+ + +FGR  L S+F   + +LLE+ + E   L +     + T FPKFL  LEEE+ +  SPIWD  F   S
Sbjct:   65 LEKLGVYSACKADETCKCNGWKNPNPPPTPPKMDLQQTVVSLAEPCRSCGHTLAAHVSHLENVSEEEMNRLLGIVLDIEYLFTCVHKEEDADTKQVYFCLFKLLRKCILQM-VKPAVEGSLGSPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIIELAKMFLNRINYWHLETPSQRRLRSPNDDIAGYKENYTRWLCYCNVPQFCDSLNRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILTHFPKFLSMLEEEVYSSNSPIWDEDFMSAS 346          

HSP 3 Score: 111.309 bits (277), Expect = 2.456e-24
Identity = 48/107 (44.86%), Postives = 79/107 (73.83%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D D L + L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+K+KYY  +++F++D+ R+F NCR YN  +S  +K + +LE+FF S ++E+ L+
Sbjct:  698 DPDQLYNILKTILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERVKNKYYVTKKLFMADLQRIFTNCREYNPPESEYFKCANILEKFFYSKIKEAGLI 804          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat2b (K(lysine) acetyltransferase 2B [Source:MGI Symbol;Acc:MGI:1343094])

HSP 1 Score: 413.305 bits (1061), Expect = 9.155e-131
Identity = 275/716 (38.41%), Postives = 379/716 (52.93%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDA----------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPV----LDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXXXXXXATFPSNGVSRRKSSRLQQXXXXXXKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVR-----QLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHS 2138
            +EK+  Y +CK E+ CKC GW   N                   +C+ C H+   HV  +  +S E++  L  +V DVE L++    E + D +Q+YFY+ K ++K I   G KPV    L+   PFEKP +   + NF+   +SH  S + +  +++A+  L  IN + L + S   ++ P++ IS YK  Y RWL +C VP+FC SLPRY+ + +FGR  L S+F   + +LLE+ + E   L       + T FPKFL  LEEE+ +  SPIWD  F                       L + S+ SP      G+  V++ P                                A F SN  S  +                ++  C  S  +  +P E        K++    H  EE     V      +L+ E+    +D        +  L +  A  + A R+EE  G IEFH++ NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS+EI++ K  Y GYIK+YEGATLMGCEL PQI YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW P+    S
Sbjct:   73 LEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRG-KPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDF-----------------------LSASSRTSPL-----GIQTVISPP----------------------------VTGTALFSSNSTSHEQ-----------INGGRTSPGCRGSSGLEANPGE--------KRKMNNSHAPEEAKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAA-RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPSGKEKS 700          

HSP 2 Score: 108.612 bits (270), Expect = 1.116e-23
Identity = 45/107 (42.06%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D + L   L+ I+  +K+H  + PF++PV  +EAPGYY++I FP+DL+T+SER++++YY  +++F++D+ R+F NC+ YN  +S  YK +++LE+FF S ++E+ L+
Sbjct:  705 DPEQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLI 811          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat2a (K(lysine) acetyltransferase 2A [Source:MGI Symbol;Acc:MGI:1343101])

HSP 1 Score: 292.352 bits (747), Expect = 2.408e-85
Identity = 151/251 (60.16%), Postives = 187/251 (74.50%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S +A+RD  AR+EE  G IEFH+I NSLT K   +V +WLV LQ VFS QLP MPKEYI RLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++++  +   YPG+S   FKE    +    +PG++E GW P
Sbjct:  472 LLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPVESVPGIRETGWKP 711          

HSP 2 Score: 152.91 bits (385), Expect = 1.359e-37
Identity = 96/285 (33.68%), Postives = 153/285 (53.68%), Query Frame = 3
Query:   78 IEKILPYQSCK-KEDCKCRGWI---------------ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCA--VQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            +EK+  + +CK  E CKC GW                A N    C+ C+H   +HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    ++PV++      PFEKP +   + NF+   +SH + +  + M ++++  L C+N ++L + +      Q ++  +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F +    G
Sbjct:   98 LEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-TRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEG 381          

HSP 3 Score: 105.145 bits (261), Expect = 1.434e-22
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER++S+YY  R++F++D+ R+  NCR YN  DS   + ++ LE+FF   ++E  L+
Sbjct:  720 LKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLI 828          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat2a (K(lysine) acetyltransferase 2A [Source:MGI Symbol;Acc:MGI:1343101])

HSP 1 Score: 292.352 bits (747), Expect = 2.461e-85
Identity = 151/251 (60.16%), Postives = 187/251 (74.50%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S +A+RD  AR+EE  G IEFH+I NSLT K   +V +WLV LQ VFS QLP MPKEYI RLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++++  +   YPG+S   FKE    +    +PG++E GW P
Sbjct:  471 LLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPVESVPGIRETGWKP 710          

HSP 2 Score: 152.91 bits (385), Expect = 1.428e-37
Identity = 96/285 (33.68%), Postives = 153/285 (53.68%), Query Frame = 3
Query:   78 IEKILPYQSCK-KEDCKCRGWI---------------ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCA--VQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            +EK+  + +CK  E CKC GW                A N    C+ C+H   +HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    ++PV++      PFEKP +   + NF+   +SH + +  + M ++++  L C+N ++L + +      Q ++  +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F +    G
Sbjct:   98 LEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-TRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEG 381          

HSP 3 Score: 105.145 bits (261), Expect = 1.457e-22
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER++S+YY  R++F++D+ R+  NCR YN  DS   + ++ LE+FF   ++E  L+
Sbjct:  719 LKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLI 827          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat2b (K(lysine) acetyltransferase 2B [Source:MGI Symbol;Acc:MGI:1343094])

HSP 1 Score: 110.923 bits (276), Expect = 4.763e-27
Identity = 70/206 (33.98%), Postives = 109/206 (52.91%), Query Frame = 3
Query:  111 KEDCKCRGWIADNSD----------------ANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPV----LDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIF 659
            +E CKC GW   N                   +C+ C H+   HV  +  +S E++  L  +V DVE L++    E + D +Q+YFY+ K ++K I   G KPV    L+   PFEKP +   + NF+   +SH  S + +  +++A+  L  IN + L + S   ++ P++ IS YK  Y RWL +C VP+FC SLPRY+ + +F
Sbjct:    7 EESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRG-KPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVF 211          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat2b (K(lysine) acetyltransferase 2B [Source:MGI Symbol;Acc:MGI:1343094])

HSP 1 Score: 89.7373 bits (221), Expect = 8.813e-21
Identity = 52/99 (52.53%), Postives = 73/99 (73.74%), Query Frame = 3
Query: 1803 DSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGL 2099
            D YA GYF+KQGFS+EI++ K  Y GYIK+YEGATLMGCEL PQI YTEFS +I++QK+I+ ++I++++  +   YPG  L+ FK+    +    IPG+
Sbjct:    2 DEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPG--LSCFKDGVRQIPIESIPGI 98          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9JHD1|KAT2B_MOUSE (Histone acetyltransferase KAT2B OS=Mus musculus OX=10090 GN=Kat2b PE=1 SV=2)

HSP 1 Score: 413.305 bits (1061), Expect = 6.404e-130
Identity = 275/716 (38.41%), Postives = 379/716 (52.93%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDA----------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPV----LDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXXXXXXATFPSNGVSRRKSSRLQQXXXXXXKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVR-----QLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHS 2138
            +EK+  Y +CK E+ CKC GW   N                   +C+ C H+   HV  +  +S E++  L  +V DVE L++    E + D +Q+YFY+ K ++K I   G KPV    L+   PFEKP +   + NF+   +SH  S + +  +++A+  L  IN + L + S   ++ P++ IS YK  Y RWL +C VP+FC SLPRY+ + +FGR  L S+F   + +LLE+ + E   L       + T FPKFL  LEEE+ +  SPIWD  F                       L + S+ SP      G+  V++ P                                A F SN  S  +                ++  C  S  +  +P E        K++    H  EE     V      +L+ E+    +D        +  L +  A  + A R+EE  G IEFH++ NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS+EI++ K  Y GYIK+YEGATLMGCEL PQI YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW P+    S
Sbjct:   73 LEKLGVYSACKAEESCKCNGWKNPNPSPTPPRGDLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMDRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRG-KPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPSKERQTTIELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTKVFGRTLLRSVFTIMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDF-----------------------LSASSRTSPL-----GIQTVISPP----------------------------VTGTALFSSNSTSHEQ-----------INGGRTSPGCRGSSGLEANPGE--------KRKMNNSHAPEEAKRSRVMGDIPVELINEVMSTITDPAGMLGPETNFLSAHSARDEAA-RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPSGKEKS 700          

HSP 2 Score: 108.612 bits (270), Expect = 7.807e-23
Identity = 45/107 (42.06%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D + L   L+ I+  +K+H  + PF++PV  +EAPGYY++I FP+DL+T+SER++++YY  +++F++D+ R+F NC+ YN  +S  YK +++LE+FF S ++E+ L+
Sbjct:  705 DPEQLYSTLKNILQQVKNHPNAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLRNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLI 811          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q92831|KAT2B_HUMAN (Histone acetyltransferase KAT2B OS=Homo sapiens OX=9606 GN=KAT2B PE=1 SV=3)

HSP 1 Score: 413.305 bits (1061), Expect = 1.129e-129
Identity = 279/716 (38.97%), Postives = 385/716 (53.77%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSD----------------ANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPV----LDDCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXXXXXXATFPSNGVSRRKSSRLQQXXXXXXKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDV-----RQLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHS 2138
            +EK+  Y +CK E+ CKC GW   N                   +C+ C H+   HV  +  +S E++  L  +V DVE L++    E + D +Q+YFY+ K ++K I   G KPV    L+   PFEKP +   + NF+   +SH  + + + +V++A+  L  IN + L + S   ++ P++ IS YK  Y RWL +C VP+FC SLPRY+ + +FGR  L S+F   + +LLE+ + E   L       + T FPKFL  LEEE+ +  SPIWD  F                       L + S+ S       G+  V+N P      P +                        T   N      SS L+Q       A  S+  C+ S  +  +P E        K++    HV EE     V      +L+ E+    +D        +  L +  A  + A R+EE  G IEFH++ NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS+EI++ K  Y GYIK+YEGATLMGCEL P+I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW P+    S
Sbjct:   91 LEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRG-KPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDF-----------------------LSASSRTSQL-----GIQTVINPP------PVA-----------------------GTISYNST----SSSLEQ-----PNAGSSSPACKASSGLEANPGE--------KRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAA-RLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPSGKEKS 719          

HSP 2 Score: 110.538 bits (275), Expect = 1.886e-23
Identity = 47/107 (43.93%), Postives = 78/107 (72.90%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+K++YY  +++F++D+ R+F NC+ YN  +S  YK + +LE+FF S ++E+ L+
Sbjct:  724 DPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLI 830          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|A0A0R4IXF6|KAT2A_DANRE (Histone acetyltransferase KAT2A OS=Danio rerio OX=7955 GN=kat2a PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 4.879e-117
Identity = 204/435 (46.90%), Postives = 270/435 (62.07%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+HG+ +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE        QIP               + IP I+ T                          KP+ K  +K                         + D D L + L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER+K++YY  +++FI+D+ R+  NCR YN  DS   K++  LE+FF   ++E+ L+
Sbjct:  437 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQNQIRKVYPG--LTCFKEG-----VRQIP--------------VESIPGIRETG------------------------WKPSAKEKSKE------------------------LKDPDLLYNMLKNLLAQIKTHPDAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKSANTLEKFFYFKLKEAGLI 793          

HSP 2 Score: 160.614 bits (405), Expect = 2.942e-39
Identity = 106/302 (35.10%), Postives = 158/302 (52.32%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDA---------------NCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-------ILSP 878
            F  ++ +EK+  + SCK  D CKC GW   N                   C+ C HS  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI   G KPV++      PFEKP +   + NF+   +SH + K  + M ++++  L C+N ++L + S      Q ++  +YK+ Y RWL +C+VP+   SLPRY+   +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G       +LSP
Sbjct:   57 FPRAKKLEKLGVFSSCKANDACKCNGWKNPNPPTAARMELQQQAASLTETCRSCGHSLAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMG-KPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDAAAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASEGTQLGHQTVLSP 357          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q1LUC3|KAT2B_DANRE (Histone acetyltransferase KAT2B OS=Danio rerio OX=7955 GN=kat2b PE=2 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 1.176e-86
Identity = 154/251 (61.35%), Postives = 190/251 (75.70%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S H++RD AAR+EE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FKE    ++   IPG++E GW P
Sbjct:  440 LLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIKDYEGATLMGCELNPCIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIAIESIPGIRETGWKP 679          

HSP 2 Score: 164.081 bits (414), Expect = 2.300e-40
Identity = 111/314 (35.35%), Postives = 170/314 (54.14%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDAN--------------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD--DCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQ-PDNPIS-YKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSP 941
            +EK+  Y SCK E  CKC GW + N                        C+ C H+  +HV  +  +S E++  L  +V DVE LY+    E + D +Q+YF + K ++KCI   G +PV++  +  PFEKP +   + NF+   +SH  S + + +V++A+  L  IN ++L + S    + PD+ ++ YK+ Y RWL +C VP+FC SLPRY+A+ IFGR FL S+F   +++LLE+ + E   L       + T FPKFL  LEEE+ +  SPIW   F +   +G   PT+ +      S+  S S P+P
Sbjct:   57 LEKLGVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPTAVSLMEPCRSCSHALGDHVTHLENVSEEEMNRLLGIVLDVEYLYTCVHKEEDPDTKQVYFSLFKLLRKCILQMG-RPVVEALESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQKRQRAPDDDVAGYKVNYTRWLCYCNVPQFCDSLPRYEATQIFGRIFLRSVFTIMRKQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSHNSPIWSENF-MIGLSGGQIPTVVSAPPVNRSLYYSSS-PAP 367          

HSP 3 Score: 113.235 bits (282), Expect = 3.011e-24
Identity = 49/109 (44.95%), Postives = 79/109 (72.48%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+KS+YY  R++F++D+ R+F NCR YN  +S  YK + +LE+FF + ++E+ L+
Sbjct:  686 LKDPDQLYSTLKNILTQVKSHPNAWPFMEPVKKNEAPGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYTKIKEAGLI 794          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9JHD2|KAT2A_MOUSE (Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2)

HSP 1 Score: 292.352 bits (747), Expect = 1.684e-84
Identity = 151/251 (60.16%), Postives = 187/251 (74.50%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S +A+RD  AR+EE  G IEFH+I NSLT K   +V +WLV LQ VFS QLP MPKEYI RLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I++QK+I+ ++I++++  +   YPG+S   FKE    +    +PG++E GW P
Sbjct:  472 LLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPVESVPGIRETGWKP 711          

HSP 2 Score: 152.91 bits (385), Expect = 9.507e-37
Identity = 96/285 (33.68%), Postives = 153/285 (53.68%), Query Frame = 3
Query:   78 IEKILPYQSCK-KEDCKCRGWI---------------ADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDC---SPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNCA--VQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            +EK+  + +CK  E CKC GW                A N    C+ C+H   +HV  +  +S +++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    ++PV++      PFEKP +   + NF+   +SH + +  + M ++++  L C+N ++L + +      Q ++  +YK+ Y RWL +C+VP+ C SLPRY+ + +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F +    G
Sbjct:   98 LEKLGVFSACKANETCKCNGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQM-TRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGANSPIWESGFTMPPSEG 381          

HSP 3 Score: 105.145 bits (261), Expect = 1.003e-21
Identity = 46/109 (42.20%), Postives = 75/109 (68.81%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ ++A +K H  + PF++PV  SEAP YY++I FPIDL+T++ER++S+YY  R++F++D+ R+  NCR YN  DS   + ++ LE+FF   ++E  L+
Sbjct:  720 LKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLI 828          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A5J4N978 (Histone acetyltransferase OS=Paragonimus westermani OX=34504 GN=DEA37_0004263 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 375/940 (39.89%), Postives = 535/940 (56.91%), Query Frame = 3
Query:   78 IEKILPYQSCKKEDCKCRGWIADNS------DANCKICDHSSEEHVKFISELSPEKLLDLK---QMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNF-VRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNF----SSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXXXXXXATFPSNGVSRRKSSRLQQXXXXXXKAS------DSNNHCEIS-ELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVRQLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEA-----GWLPA---QDTHSDFI--------------------------------PKI--------KITSPRKRGRPRK---TPLIGQIEPTGTAAPEKPTTKRAAKS----TDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            I K +PY  C+++ CKC  W AD++      + +CK C H    H  F +    E+LL L    QMV+DVE LY +  +E + + R +YF ILK+I+K + +  +KP+ DD  PFEKP + T + + ++  YS +  + +  +D+ +  L  +N +++   S    + +N   YKLIY+RW+ HCY P+FC SLP    S  FG+NFL+++ P  K +L++K+  EN  L      + +     K L  +E+E+ N       P   ++S    ++P+LT+         S ++ + S  S + +   G S    L   S H     P   +     +    ++              RR S RL+       K        D + H E +   V++D       +  P K+ R+  V  +    +++Q++ E+   S  G D  S       SL+A+RD AAR EESTGGIEFHI+NNSL   Q  + Y+WL+EL  VF+LQLP MPKEYI RLVFDPKHKNLVL+K SE    T E+H IGGI FRMFP+QGFTEIVFCAVIFNEQVKGYGTQ+MNHLKDYH+QH + HFLTYADS+ATGYFRKQGFSREIRL ++AYQGYIKEYEGATLMGCEL+P IVYT+FS++I RQK+I+NR+I++R+ +L   +PG+   +F  S G L P Q+PGL EA     GW P+   + TH D +                                P+I        ++T+ R++ R R    +P   +  P         T +R++ S    T+  +    T S   N NEI          LA+QLRPI+  +++H L+ PF +PV ++EAP Y+ II FPIDL T+ +R+KS+YY  + +FI+D++RMFHNCR YN+ +S + +++  LERFF+S M+E+ L
Sbjct:   23 IRKCIPYLKCQEDGCKCSIWKADSASESLELELSCKNCHHM---HQCFTTA---EELLWLNSAVQMVEDVEHLYVLCANEQDGETRHLYFCILKRIRKALLNQ-TKPIFDDPPPFEKPSIETAVLSVLLHRYSQNCKELQYTLDLCKLFLSFVNVWKMGYPSLRTNKHENKTGYKLIYMRWMCHCYAPQFCFSLPYCKPSAAFGKNFLLAVLPDLKRKLIDKITHENSGLWSLDKKYQIIQSIVKLLSYVEDEIQN-------PTNHMSSL--CIAPSLTDSDGGVPVGRSPIITNPSVQSHYLATDSG-SKEAQLDSTSNHIANHTPDSQQSHSTRKQIGTQER-------------RRSSIRLRNQSLLECKTGSYPPRVDGSKHEEQNGAAVTMDNGTSARLIGPPCKRTRLS-VPGDINPVELQQVIQEIGDRSRAGTDILSF--NTFHSLNATRDAAARQEESTGGIEFHIVNNSLNHNQSPKTYIWLLELLNVFALQLPRMPKEYIARLVFDPKHKNLVLLKVSE----TGEKHAIGGISFRMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHVQHEIFHFLTYADSFATGYFRKQGFSREIRLARQAYQGYIKEYEGATLMGCELFPNIVYTDFSEMIGRQKEIINRLIERRQGSLGKSFPGLPAKLF--SNGPLQPHQVPGLIEAGCAPVGWSPSTVTEQTHGDGLLHNSSEESIFTNTQLKKEAPEPSSELVVNNSTPRISDSVVESTELTTGRRKLRKRSVQASPTTIKFGPIAKFERPSRTLRRSSLSGKSMTNVAQSPTVTSSDKVNTNEI--------TQLANQLRPILTAMRNHLLAAPFQRPVTATEAPDYHDIIVFPIDLSTVWDRLKSRYYTTKALFIADMMRMFHNCRTYNQPESYLVRSANTLERFFISRMKEAGL 915          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: G7YQ65 (Histone acetyltransferase OS=Clonorchis sinensis OX=79923 GN=CLF_106765 PE=4 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 1.018e-159
Identity = 249/465 (53.55%), Postives = 322/465 (69.25%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA---QDTHSDFIPKIKITSPRKRGRPRKT-----PLIGQIE---PTGT----------AAPEKPTTKRAAKSTDF----------TELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            L S HA+RD AAR EESTG IEFHI+NNSL   Q  Q Y+WL+EL  VF+LQLP MPKEYI RLVFDPKHKNL+L+K SE      E+H IGGI FRMFP+QGFTEIVFCAVIFNEQVKGYGTQ+MNHLKDYH+QHG+ HFLTYADS+ATGYFRKQGFSREIRL ++AY GYIKEYEGATLMGCELYP IVYT FS++I  QKQI+NR+I++R+ +L   +PGI   +F+   G L   Q+PGL E+G  PA   +    DF+ +    S    G    T       +G IE   PT +          A+P  P     AK T F          T   ++T S+++++N++ +   +D + LA QLRP++  L++H L+ PF +PV S+EAP Y+ II FP+DL T+ +R+KS+YY  + +F++D++R+FHNCRVYN+ +S + K +  LERFF++ M+E  L
Sbjct:   62 LHSYHATRDAAARREESTGNIEFHIVNNSLNHNQTPQTYIWLLELLNVFALQLPRMPKEYIARLVFDPKHKNLILLKVSEAG----EKHAIGGISFRMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHVQHGIFHFLTYADSFATGYFRKQGFSREIRLTRQAYHGYIKEYEGATLMGCELYPNIVYTNFSEMIGHQKQIINRLIERRKDSLGKSFPGIPARVFRN--GPLQLHQVPGLLESGCAPAHWSKKDEPDFVSQTSCLSTDVGGSTDVTDSVEQTALGTIEVSDPTSSQRKLRRRCVQASPAVPRLSALAKPTKFPVRSTRRGSITSKPLDTLSANDSVNKLGS---NDVNELATQLRPVLTALRNHILAAPFQRPVTSAEAPDYHDIIIFPMDLGTMWDRLKSRYYTTKALFVADMMRIFHNCRVYNQPESYLVKCANTLERFFINRMKEVNL 517          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A419Q995 (Histone acetyltransferase KAT2B OS=Clonorchis sinensis OX=79923 GN=Kat2b PE=4 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 5.015e-157
Identity = 248/466 (53.22%), Postives = 323/466 (69.31%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA---QDTHSDFIPKIKITSPRKRGRPRKT-----PLIGQIE---PTGT----------AAPEKPTTKRAAKSTDF-----------TELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            L S HA+RD AAR EESTG IEFHI+NNSL   Q  Q Y+WL+EL  VF+LQLP MPKEYI RLVFDPKHKNL+L+K SE      E+H IGGI FRMFP+QGFTEIVFCAVIFNEQVKGYGTQ+MNHLKDYH+QHG+ HFLTYADS+ATGYFRKQGFSREIRL ++AY GYIKEYEGATLMGCELYP IVYT FS++I  QKQI+NR+I++R+ +L   +PGI   +F+   G L   Q+PGL E+G  PA   +    DF+ +    S    G    T       +G IE   PT +          A+P  P     AK T F           ++  ++T S+++++N++ +   +D + LA QLRP++  L++H L+ PF +PV S+EAP Y+ II FP+DL T+ +R+KS+YY  + +F++D++R+FHNCRVYN+ +S + K +  LERFF++ M+E  L
Sbjct:  259 LHSYHATRDAAARREESTGNIEFHIVNNSLNHNQTPQTYIWLLELLNVFALQLPRMPKEYIARLVFDPKHKNLILLKVSEAG----EKHAIGGISFRMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHVQHGIFHFLTYADSFATGYFRKQGFSREIRLTRQAYHGYIKEYEGATLMGCELYPNIVYTNFSEMIGHQKQIINRLIERRKDSLGKSFPGIPARVFR--NGPLQLHQVPGLLESGCAPAHWSKKDEPDFVSQTSCLSTDVGGSTDVTDSVEQTALGTIEVSDPTSSQRKLRRRCVQASPAVPRLSALAKPTKFPVRSTRRGSITSKPRLDTLSANDSVNKLGS---NDVNELATQLRPVLTALRNHILAAPFQRPVTSAEAPDYHDIIIFPMDLGTMWDRLKSRYYTTKALFVADMMRIFHNCRVYNQPESYLVKCANTLERFFINRMKEVNL 715          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A4V3S9U7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011083 PE=4 SV=1)

HSP 1 Score: 482.641 bits (1241), Expect = 4.348e-153
Identity = 251/466 (53.86%), Postives = 320/466 (68.67%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA---QDTHSDFIPKIKITSPRKRGRPR------KTPLIGQIE---PTGT----------AAPEKPTTKRAAKSTDF----------TELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            L S HA+RD AAR EESTG IEFHI+NNSL   Q  Q Y+WL+EL  VF+LQLP MPKEYI RLVFDPKHKNL+L+K SE      E+H IGGI FRMFP+QGFTEIVFCAVIFNEQVKGYGTQ+MNHLKDYH+QHG+ HFLTYADS+ATGYFRKQGFSREIRL ++AY GYIKEYEGATLMGCELYP IVYT FS++I  QKQI+NR+ ++R+ +L   +PGI   +F+   G L   Q+PGL EAG  PA   +    DFI +    S    GRP            G IE   PT +          A+P  P     +K T F          T    +T S+++++N++ +   +D + LA QLRP++  L++H L+ PF +PV S+EAP Y+ II FP+DL T+ +R+KS+YY  R +F++D++R+FHNCRVYN+ +S + K +  LERFF++ M+E  L
Sbjct:  429 LHSYHATRDAAARREESTGNIEFHIVNNSLNHNQTPQTYIWLLELLNVFALQLPRMPKEYIARLVFDPKHKNLILLKVSEAG----EKHAIGGISFRMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHVQHGIFHFLTYADSFATGYFRKQGFSREIRLTRQAYHGYIKEYEGATLMGCELYPNIVYTNFSEMIGHQKQIINRLSERRKDSLGKSFPGIPARVFR--NGPLQLHQVPGLLEAGCAPAHWSKKDEPDFISQTACLS-NDVGRPTDGTDSVDQTAFGTIEVLDPTSSQRKLRRRCAQASPAVPRLSALSKPTKFSLRSTRRGALTSKPSDTLSANDSVNKLGS---NDVNELATQLRPVLTALRNHILAAPFQRPVTSAEAPDYHDIIIFPMDLGTMWDRLKSRYYTTRALFVADMMRIFHNCRVYNQPESYLVKCANTLERFFINRMKEVNL 884          

HSP 2 Score: 154.451 bits (389), Expect = 1.233e-34
Identity = 97/290 (33.45%), Postives = 152/290 (52.41%), Query Frame = 3
Query:   57 YFNMSELIEKILPYQSCKKEDCKCRGW--IADNSDANCKICDHSSEEHVKFISELSPEKLLDLK-QMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSEN-----IDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWD------PVFQLTSFTGILSPTL 884
            + +  + I++ LPY  C+++ CKC  W    D   A    C +    H  F +E      LDL  QMV+DVE LY +  +E++ + R +YF ILK+++K + +   KP  DD  PFE+P + T +R+ ++ HY   + + E +  + +  L   N +++      A + +N   Y+LIY+RW+ HCYVP+FC SLP    +  FG+NFLV++ P+ K +L+EK+  EN     +D  +     V     KF+  LE+E  N   P WD      P    T   G  SP+L
Sbjct:   16 HLSTEQKIKRCLPYLKCQEQGCKCLTWKLSTDKVQAESGTCKYCGHVHSTFTAE-GDLAWLDLAVQMVEDVEHLYILCANESDCETRHLYFCILKRVRKALVNR-VKPTFDDPPPFERPSIETAVRSVLLRHYVRDNRELESIAKLGKLFLAFANAWKMGYPILRANRHENRTGYRLIYMRWMCHCYVPQFCFSLPYCSPTSAFGKNFLVAVLPELKRKLIEKVMHENTTAYGLDKKQQ----VILPLVKFISHLEDEAHNPSCPWWDTYSHSIPFLSNTYLPGAQSPSL 299          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A430QCR9 (Histone acetyltransferase OS=Schistosoma bovis OX=6184 GN=DC041_0006178 PE=4 SV=1)

HSP 1 Score: 481.485 bits (1238), Expect = 1.579e-152
Identity = 241/457 (52.74%), Postives = 310/457 (67.83%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDF---IPKIKITSPRKRG-------RPRKTPLIGQIEPTGTAAPEK-------------PTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKL 2669
            L SL+A+RD AAR EES G IEFHI+NNSL   Q  Q Y+WL+EL  VF+LQLP MPKEYI RL+FDPKHKNL+L+K S+    + E+H IGGICFRMFP+QGFTEIVFCAVIFNEQVKGYGTQ+MNHLKDYH+QH + HFLTYADS+ATGYFRKQGFSREIRL ++AY GYIKEYEGATLMGCELYP I+YT FS+LI +QKQ++ R+I+KRR ++   YPGI   +F+   G L P QIPGL E       +  SD    IPK +++   +         + + +   G+        P K             P T +       +       SS +  + +  V I +A  LA+++RPI+  L+ H L+GPF +PV   EAP YY II FPIDL T+ ER+KS YY  + +FI+D++RMFHNCR YN+ DS +Y+++  LER+F++ M+E+ L
Sbjct:  449 LHSLNATRDAAARQEESAGNIEFHIVNNSLNPNQPPQTYIWLLELLNVFALQLPRMPKEYIARLIFDPKHKNLILLKVSD----SCEKHAIGGICFRMFPSQGFTEIVFCAVIFNEQVKGYGTQMMNHLKDYHLQHKIFHFLTYADSFATGYFRKQGFSREIRLARQAYLGYIKEYEGATLMGCELYPNIIYTRFSELIAKQKQVITRLIEKRRESVNQTYPGIPAKLFR--NGPLRPDQIPGLTEIDL--TSNKFSDLFHKIPKTELSETNQTSINNHISVKRKSSETFGKCVEKLQEPPRKLRKRLLDPLPSPSPLTTKPQMKARISSRSTRYNSSLKTSDSLEPVWIQEAKQLAEKIRPILNALRSHILAGPFQKPVTVDEAPDYYDIIVFPIDLSTMWERLKSNYYVTKSLFIADMMRMFHNCRTYNQQDSYLYRSANTLERYFINKMKEADL 897          

HSP 2 Score: 149.443 bits (376), Expect = 4.372e-33
Identity = 86/266 (32.33%), Postives = 147/266 (55.26%), Query Frame = 3
Query:   78 IEKILPYQSCKKEDCKCRGW-IADNS------DANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENI--DLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQ 848
            + + LPY  C+ E CKC  W ++DN+      +A C+ C H    H           L    QMVDDVE +Y +   E + + R IYF ILK+++K + +   +PV DD  PFE+P +NT +RN ++          E+ +++ +  L  +N++++   S    + +N   YKLIY+RW+ HCYVPKFC +LP  +A+  FG+NFL+++ P+ K  L+E  K +++   + +  ++ ++    +    LE+ + +  + +WDP FQ
Sbjct:   10 LSRYLPYSKCRNEGCKCSTWKLSDNAIDEKLVEAICENCCHV---HYSLSDPNESTWLNSAMQMVDDVERMYILCTKEEDYETRNIYFCILKRLRKALMNK-VQPVFDDKPPFERPDINTAVRNALLFCAVTDPQNPEITIELCKLFLAYVNSYKITYPSQRIQKYENKTGYKLIYMRWICHCYVPKFCNALPYTEATCAFGKNFLLAVLPEIKRRLIEFFKQDSVIPSMLDAKIHLIQP-LTRLCNLLEDNVEDKTTSVWDPYFQ 270          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat2a (lysine acetyltransferase 2A [Source:NCBI gene;Acc:103044670])

HSP 1 Score: 315.849 bits (808), Expect = 6.099e-94
Identity = 153/252 (60.71%), Postives = 189/252 (75.00%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA 2123
            L+S +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+HG+ +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE    +    IPG++E GW P+
Sbjct:  497 LLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHGILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPG--LTCFKEGVRQIPVESIPGIRETGWKPS 737          

HSP 2 Score: 159.458 bits (402), Expect = 9.188e-40
Identity = 107/304 (35.20%), Postives = 162/304 (53.29%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGW----------------IADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-------ILSPT 881
            F  ++ +EK+  + +CK  D CKC GW                 A+ S+A C+ C H+  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI   G KPV++      PFEKP +   + NF+   +SH + K  + M ++++  L C+N ++L + S      Q ++  +YK+ Y RWL +C+VP+   SLPRY+   +FGR+ L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIWD  F + +  G       +LSP 
Sbjct:  122 FPRAKKLEKLGVFSACKANDSCKCNGWKNPHPPTATRMELQQQTANLSEA-CRSCGHALAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMG-KPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLAPKERQTMYELSKMFLLCLNYWKLETPSQFRQRAQKEDASAYKVDYTRWLCYCHVPQSNDSLPRYETCQVFGRSLLKSIFTVTRRQLLEKFRVEKDKLPPEKRTLILTHFPKFLSMLEEEIYGENSPIWDADFTMPASEGAQLVPQTVLSPV 423          

HSP 3 Score: 105.145 bits (261), Expect = 1.291e-22
Identity = 49/109 (44.95%), Postives = 76/109 (69.72%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L + L+ ++A +K H  + PF++PV  SEAP YY+II FPIDL+T++ER+K++YY  +++FI+D+ R+  NCR YN  DS   K +  LE+FF   ++ES L+
Sbjct:  745 LKDPDLLYNILKNLLAQIKTHPDAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRVITNCREYNPPDSEYCKCANTLEKFFYFKLKESGLI 853          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat2b (histone acetyltransferase KAT2B [Source:NCBI gene;Acc:103026885])

HSP 1 Score: 297.745 bits (761), Expect = 2.975e-88
Identity = 154/251 (61.35%), Postives = 189/251 (75.30%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S H++RD AARIEE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FKE    +    IPG++E GW P
Sbjct:  440 LLSAHSARDEAARIEERRGVIEFHVIGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPIESIPGIRETGWKP 679          

HSP 2 Score: 164.851 bits (416), Expect = 1.059e-41
Identity = 109/309 (35.28%), Postives = 163/309 (52.75%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGW--------------------IADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD--DCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSN--CAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-----ILSPTLTNCLHNFSS 911
            +EK+  Y SCK E  CKC GW                    IA N    C+ C H   +HV  +  +S +++  L  +V DVE LY+    E + D +Q+YF + K ++KCI   G +P ++  +  PFEKP +   + NF+   +SH  S + + +V++A+  L  IN ++L + S     V  D+   YK+ Y RWL +C VP+FC SLPRY+A+ IFGR  L S+F   +++LLE+ + E   L       + T FPKFL  LEEE+ +  SPIW   F + S  G     I +P +T  L+  +S
Sbjct:   57 LEKLAVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPIAVNLLEPCRSCSHPLGDHVTHLENVSEDEMNRLLGIVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKCILQMG-RPAVEALESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQRRQRVPTDDVAGYKINYTRWLCYCNVPQFCDSLPRYEATQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSPNSPIWSEDFMVGSSGGQIPRVISAPQVTRPLYYTNS 364          

HSP 3 Score: 50.447 bits (119), Expect = 8.119e-6
Identity = 20/49 (40.82%), Postives = 32/49 (65.31%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDL 2492
            + D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+ +
Sbjct:  686 VKDPDQLYSTLKTILQQVKSHQNAWPFMEPVKKNEAPGYYQVIRFPMGM 734          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat2b (histone acetyltransferase KAT2B [Source:NCBI gene;Acc:103026885])

HSP 1 Score: 298.13 bits (762), Expect = 7.472e-88
Identity = 154/251 (61.35%), Postives = 189/251 (75.30%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLP 2120
            L+S H++RD AARIEE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FKE    +    IPG++E GW P
Sbjct:  440 LLSAHSARDEAARIEERRGVIEFHVIGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKEGVRQIPIESIPGIRETGWKP 679          

HSP 2 Score: 164.081 bits (414), Expect = 2.319e-41
Identity = 109/309 (35.28%), Postives = 163/309 (52.75%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGW--------------------IADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD--DCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSN--CAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG-----ILSPTLTNCLHNFSS 911
            +EK+  Y SCK E  CKC GW                    IA N    C+ C H   +HV  +  +S +++  L  +V DVE LY+    E + D +Q+YF + K ++KCI   G +P ++  +  PFEKP +   + NF+   +SH  S + + +V++A+  L  IN ++L + S     V  D+   YK+ Y RWL +C VP+FC SLPRY+A+ IFGR  L S+F   +++LLE+ + E   L       + T FPKFL  LEEE+ +  SPIW   F + S  G     I +P +T  L+  +S
Sbjct:   57 LEKLAVYSSCKAEGACKCNGWKSQNPPPTPPPPTPPRAEQPIAVNLLEPCRSCSHPLGDHVTHLENVSEDEMNRLLGIVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKCILQMG-RPAVEALESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNQINYWQLETPSQRRQRVPTDDVAGYKINYTRWLCYCNVPQFCDSLPRYEATQIFGRTLLRSVFTVMRKQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSPNSPIWSEDFMVGSSGGQIPRVISAPQVTRPLYYTNS 364          

HSP 3 Score: 114.005 bits (284), Expect = 1.706e-25
Identity = 49/109 (44.95%), Postives = 79/109 (72.48%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D D L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+KS+YY  R++F++D+ R+F NCR YN  +S  YK + +LE+FF + ++E+ L+
Sbjct:  686 VKDPDQLYSTLKTILQQVKSHQNAWPFMEPVKKNEAPGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYTKIKEAGLI 794          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: bptf (nucleosome-remodeling factor subunit BPTF-like [Source:NCBI gene;Acc:103026062])

HSP 1 Score: 92.4337 bits (228), Expect = 1.837e-18
Identity = 42/112 (37.50%), Postives = 72/112 (64.29%), Query Frame = 3
Query: 2316 ENLNEIFTV--PIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
            ++  E  TV  P+ D D+  + L+ I+  L+ H ++ PFL+PV+ ++AP YY +I  P+DL TI ++I+ ++Y     F++D+ ++F NCR YN +DS  Y+ +  LE FF+
Sbjct: 2963 QSTEEAMTVLTPLTDKDY--EGLKRILRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLSTIEQKIQKRFYSKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEFLETFFV 3072          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: bptf (nucleosome-remodeling factor subunit BPTF-like [Source:NCBI gene;Acc:103026062])

HSP 1 Score: 92.4337 bits (228), Expect = 1.843e-18
Identity = 42/116 (36.21%), Postives = 74/116 (63.79%), Query Frame = 3
Query: 2316 ENLNEIFTV--PIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQ 2657
            ++  E  TV  P+ D D+  + L+ I+  L+ H ++ PFL+PV+ ++AP YY +I  P+DL TI ++I+ ++Y     F++D+ ++F NCR YN +DS  Y+ +  LE FF+  ++
Sbjct: 2848 QSTEEAMTVLTPLTDKDY--EGLKRILRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLSTIEQKIQKRFYSKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEFLETFFVQKLK 2961          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat2b (K(lysine) acetyltransferase 2B [Source:NCBI gene;Acc:563942])

HSP 1 Score: 297.36 bits (760), Expect = 6.868e-88
Identity = 153/249 (61.45%), Postives = 188/249 (75.50%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGW 2114
            L+S HA+RD AAR+EE  G IEFH++ NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L LVK     DG     VIGGICFRMF TQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+ G+ HFLT+AD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P+I YTEFS +I++QK+I+ ++I++++  +   YPG  L  FKE    +    IPG++E GW
Sbjct:  483 LLSAHAARDEAARMEERRGVIEFHVVGNSLSQKPNRKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALVK-----DG----RVIGGICFRMFSTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKQGVLHFLTFADEYAIGYFKKQGFSKDIKIPKSKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPG--LTCFKEGVRQIPIESIPGIRETGW 720          

HSP 2 Score: 172.94 bits (437), Expect = 8.304e-45
Identity = 112/317 (35.33%), Postives = 162/317 (51.10%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDAN-----------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDD---CSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSN--CAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPS 938
            +  S+ +EK+  Y +CK +D CKC GW   N   N                 C+ C+H   +HV  +  +S E++  L  +V DVE L+     E + D +Q++FY+ K ++KCI    SKPV++      PFEKP +   + NF+   +SH   K  + M D+A+  L C+N +RL + S+     Q D   +YK+ Y RWL +C VP+FC SLP YD + +FGR  L SIFP  + +L EK + E   L       + T FPKFL  LEEE+ +  SPIWD  F  +   G  +          S V C   +PS
Sbjct:  103 YAHSKKLEKLGVYSACKADDSCKCNGWKNPNQAPNPPTVDVQQHNVASLSDPCRSCNHVLADHVSHLENVSEEEMNRLLGIVVDVENLFICVTKEEDADTKQVFFYLFKLLRKCILQM-SKPVVEGPLGSPPFEKPSIEKGVANFVQYKFSHLPPKERQPMYDLAKMFLRCLNYWRLETPSHRRARAQTDELSAYKVNYTRWLCYCNVPQFCDSLPCYDTTQVFGRTLLRSIFPVMRLQLQEKFRKEKDKLPAEQRTLILTHFPKFLSMLEEEVYSSSSPIWDADFSGSDVAGAQAALQ-------SGVSCVTGEPS 411          

HSP 3 Score: 104.375 bits (259), Expect = 3.922e-23
Identity = 45/107 (42.06%), Postives = 76/107 (71.03%), Query Frame = 3
Query: 2352 DADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            D++ L + L+ I+  +K    + PF++PV  SEAP YY +I FP+DL+T+SER+K++YY  +++F++D+ R+F NCR YN  ++  Y+ +  LERFF + M+E+ L+
Sbjct:  733 DSEQLYNTLKSIMQQVKGQPSAWPFMEPVKKSEAPDYYDVIRFPMDLKTMSERLKNRYYVTKKLFMADMQRIFTNCREYNPPETEYYRCANTLERFFYNKMKEAGLI 839          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010200.1 (pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 gene:ENSPMAG00000009229.1 transcript:ENSPMAT00000010200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 3.414e-19
Identity = 43/108 (39.81%), Postives = 69/108 (63.89%), Query Frame = 3
Query: 2343 PIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESK 2666
            P+ + D+  D L+ I+  ++ H ++ PFL+PV+  EAPGYY++I  P+DL TI +R+ S++Y     F+ D+ +MF NCR YN  +S   K + VLE FF+  ++  K
Sbjct: 2751 PLTERDY--DGLKRILRSMQVHKMAWPFLEPVDEEEAPGYYEVIKEPMDLSTIEKRLSSRFYSKLAEFVGDMTKMFDNCRYYNPGESTFAKCAEVLETFFVQKLKSFK 2856          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008098.1 (pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 gene:ENSPMAG00000007319.1 transcript:ENSPMAT00000008098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 1.766e-12
Identity = 40/105 (38.10%), Postives = 59/105 (56.19%), Query Frame = 3
Query: 2364 LADQL----RPIVADLKHHSLSGPFLQPVNSS--EAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            L +QL    R ++  L  H  + PFLQPV+++    P Y+KII  P+D+ TI +R++S YY      ISD   MF+NC VYN+    I   +  LE+ F+  + E
Sbjct:   35 LTNQLQFMQRSVLKVLWRHHFAWPFLQPVDAAALNLPDYHKIIKQPMDMGTIKQRLESSYYWSASECISDFKTMFNNCYVYNKPGDDIAIMAQALEKAFLQKITE 139          

HSP 2 Score: 49.6766 bits (117), Expect = 2.998e-6
Identity = 29/83 (34.94%), Postives = 44/83 (53.01%), Query Frame = 3
Query: 2403 HHSLSGPFLQPVNSSEAPG---YYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            H + + PF  PV++  A G   Y+ II  P+DL TI  +++++ Y   Q F SDV  MF NC  YN  +  +   +  L+  F
Sbjct:  337 HAAYAWPFYNPVDA-RALGLHDYHDIIKHPMDLGTIRRKLEAREYASGQEFASDVRLMFSNCYKYNPPEHDVVAMARKLQDVF 418          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004772.1 (pep scaffold:Pmarinus_7.0:GL477964:1616:15578:1 gene:ENSPMAG00000004315.1 transcript:ENSPMAT00000004772.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 4.452e-10
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 2403 HHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            +H  +  FLQPV +  APGY+ I+  P+DL TI + I++   +    F  DV+ MF N  +YN +D  ++  +  ++R  M  +Q+
Sbjct:  790 NHKYANVFLQPVTNDIAPGYHSIVHRPMDLSTIKKNIENGAIRTTAEFQRDVMLMFQNAIMYNSSDHDVFHMAVEMQRDVMEHVQQ 875          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008812.1 (pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 gene:ENSPMAG00000007951.1 transcript:ENSPMAT00000008812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 4.568e-10
Identity = 32/94 (34.04%), Postives = 51/94 (54.26%), Query Frame = 3
Query: 2385 IVADLKHHSLSGPFLQPVNSSEA--PGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            ++  L  H  + PF  PV++++   P YY II  P+D+ TI +R++S +Y      I D   MF NC +YN  +  I   +  LE+FF+  + E
Sbjct:   41 VMKALWKHQFAWPFHHPVDAAKLNLPDYYNIIKNPMDMGTIKKRLESNFYFTAVECIQDFSTMFTNCYIYNRPNDDIVLMAQTLEKFFLQKVAE 134          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 199.134 bits (505), Expect = 2.354e-56
Identity = 106/245 (43.27%), Postives = 145/245 (59.18%), Query Frame = 3
Query: 1407 IEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDY-HIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGC--LSPAQIPGLKEAGWLPAQDT 2132
            +EE+ G IEF ++NN  T + +    + L  L+ +F  QLP MPKEYI RLV+D  H ++ +++            V+GGI +R F  + F EIVFCA+   EQV+GYG  LMNHLKDY      + +FLTYAD+YA GYF+KQGF++EI L+K  + GYIK+YEG TLM C + P+I Y +   ++  Q+  + R I   R   +S      L  FK+      + P  IPGLKEAGW P  D 
Sbjct:   93 VEENEGKIEFRVVNNDNTKENM----MVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLT--------VVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLMQCSMLPRIRYLDAGKILLLQEAALRRKI---RTISKSHIVRPGLEQFKDLNNIKPIDPMTIPGLKEAGWTPEMDA 322          

HSP 2 Score: 82.8037 bits (203), Expect = 5.081e-17
Identity = 37/95 (38.95%), Postives = 63/95 (66.32%), Query Frame = 3
Query: 2376 LRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            ++ I+ +L++H+ + PFLQPVN  E P YY  I  P+DL T+  +++S  Y+  + FI D   +F+NCR+YN  +++ YK +  LE+FF + ++E
Sbjct:  336 IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKE 430          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SPT7 (Subunit of the SAGA transcriptional regulatory complex; involved in proper assembly of the complex; also present as a C-terminally truncated form in the SLIK/SALSA transcriptional regulatory complex [Source:SGD;Acc:S000000285])

HSP 1 Score: 60.077 bits (144), Expect = 1.586e-9
Identity = 28/82 (34.15%), Postives = 50/82 (60.98%), Query Frame = 3
Query: 2385 IVADLKHHSL-SGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAV 2627
            +V +L++++  S PFL  V+  EAP Y++II   +DL T+ +++KS  Y  +Q F+ D++ ++ NC  YN   S   +  A+
Sbjct:  452 VVLELRNYTEHSTPFLNKVSKREAPNYHQIIKKSMDLNTVLKKLKSFQYDSKQEFVDDIMLIWKNCLTYNSDPSHFLRGHAI 533          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: RSC4 (Component of the RSC chromatin remodeling complex; found in close proximity to nucleosomal DNA; displaced from the surface of nucleosomal DNA after chromatin remodeling; acetylated (K25) by Gcn5p, altering replication stress tolerance; contains tandem bromodomains that recognize histone H3 acetylated on K14 (H3K14ac) by Gcn5p [Source:SGD;Acc:S000001716])

HSP 1 Score: 56.225 bits (134), Expect = 1.636e-8
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 2412 LSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQ 2657
            LS PF++ V+  E P YY+I+  P+ L  + + ++   Y     FI D++ +F N  ++N+  + IYK++  L  +F  ++Q
Sbjct:  209 LSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQ 290          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: RSC2 (Component of the RSC chromatin remodeling complex; required for expression of mid-late sporulation-specific genes; involved in telomere maintenance; RSC2 has a paralog, RSC1, that arose from the whole genome duplication [Source:SGD;Acc:S000004349])

HSP 1 Score: 52.373 bits (124), Expect = 2.803e-7
Identity = 24/63 (38.10%), Postives = 38/63 (60.32%), Query Frame = 3
Query: 2454 PGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            P YY +I  P+   T+ +RI   +Y   Q F++DV+++  N + YN  DS IYK + VLE++ 
Sbjct:   53 PDYYAVIKNPVSFNTLKKRIP--HYTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYL 113          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: BDF2 (Protein involved in transcription initiation; acts at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf1p; protein abundance increases in response to DNA replication stress; BDF2 has a paralog, BDF1, that arose from the whole genome duplication [Source:SGD;Acc:S000002228])

HSP 1 Score: 51.9878 bits (123), Expect = 3.257e-7
Identity = 32/127 (25.20%), Postives = 63/127 (49.61%), Query Frame = 3
Query: 2268 KSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVN--SSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            KS D  +++  +K  S+ L + F   +        ++  ++   K+  ++ PFLQPV+  +   P Y+ ++  P+DL TIS  + +  YK    F+ D+  +F+NC  +N   + ++     L+  F
Sbjct:  301 KSKDLFDIYENSKPKSKTLQKKFRTCL--------KILKVLMSKKNSDINFPFLQPVDPIALNLPNYFDVVKNPMDLGTISNNLMNWKYKTIDQFVDDLNLVFYNCFQFNPEGNEVHSMGKKLKELF 419          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO43844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXH0])

HSP 1 Score: 302.753 bits (774), Expect = 1.812e-90
Identity = 183/431 (42.46%), Postives = 237/431 (54.99%), Query Frame = 3
Query: 1380 HASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQD--THSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAP-EKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIP-FPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            H++RD  AR EE  G IEFH++ NSL          WLV LQ VFS QLP MPKEYITRLVFDPKHK L LVK         +   IGGICFRMFPTQ FTEIVFCA+  NEQVKGYGT LMNHLKDYHI+HG+ + LTYAD YA GYF+KQGFS+EI++ K +Y GYIKEYEGATLM C++   I YTEFS +IR+QK+IV +++ +++  +   YPG  L  FKE    +    IPG+ E GW  + +     +  P +  T  +         ++ Q++   +A P +KP  +  A++ D+ E HI+              P+D        L+ +   LK                  GYY     F  D+R I                      F NCR YN  D+  YK +  +ERFF+S ++E
Sbjct:  404 HSARDEHARCEERRGVIEFHVVGNSLRRMPSRLTQQWLVGLQNVFSYQLPRMPKEYITRLVFDPKHKTLALVK---------DNRPIGGICFRMFPTQNFTEIVFCAITSNEQVKGYGTHLMNHLKDYHIKHGVLNLLTYADEYAIGYFKKQGFSKEIKIPKASYTGYIKEYEGATLMHCQVNSCIQYTEFSTIIRKQKEIVKKLMSRKQEQIRRVYPG--LTCFKEGVRQIPVESIPGISETGWRSSMNKSVTKEADPSVLQTQLKN--------ILTQVKNHASAWPFQKPVER--AEAPDYYE-HIK-------------YPMD--------LKTMTERLK-----------------SGYYSSKKLFVADMRRI----------------------FQNCRTYNSPDTEYYKCANTVERFFLSKIKE 752          

HSP 2 Score: 164.081 bits (414), Expect = 7.190e-42
Identity = 99/281 (35.23%), Postives = 153/281 (54.45%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGW-----------------IADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCS--PFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRL--VSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQL 851
            +EK+  Y SCK ED CKC GW                 +A  +D  C+ C HS   H+  +  +S ++L  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    +  V       PFEKP +   + NF++  + H   + W++M D+A+  L+C+N+++L  V++     + ++  +YKL Y RWL +C+VP FC SLP+ D + +FGR  L S+F   + +LLEK ++E   +       V T FP+FL  LE+E+    SPIWD  F +
Sbjct:   31 LEKLGVYSSCKVEDTCKCNGWKNPNPPPTPPRLDLSQPLASLNDP-CRSCGHSLGLHISQLQSISEDELDRLLCMVVDVENLFMCVHKEEDADTKQVYFYLFKLLRKCILQMSTPTVEGQLGTPPFEKPSIAKAVINFVLHKFGHLPQREWQIMHDLAKMFLHCLNHWKLETVAMRKQHAEAEHIAAYKLNYTRWLCYCHVPVFCDSLPKCDTTAVFGRTLLRSVFSVMRSQLLEKFRAEKDKMPADKRTIVLTHFPRFLSMLEKEVYGESSPIWDDDFTV 310          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 91.2781 bits (225), Expect = 1.656e-21
Identity = 43/117 (36.75%), Postives = 72/117 (61.54%), Query Frame = 3
Query: 2316 ENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESK 2666
            EN +++   P+ + D   D L+ ++  L+ H ++ PFL+PV+  + PGYY +I  P+DL T+ ++I SK Y   + F+SDV R+F NCR +N  D+  Y+ + VLE  F+  ++  K
Sbjct:   38 ENQSKLALQPLTNRD--HDSLKRMLRSLQSHKMAWPFLEPVSGLDVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDTPYYRCAEVLEAVFVQKLRAWK 152          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO38859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV1])

HSP 1 Score: 76.6406 bits (187), Expect = 3.650e-14
Identity = 37/111 (33.33%), Postives = 61/111 (54.95%), Query Frame = 3
Query: 2352 DADWLAD-------QLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQES 2663
            +ADW  +       ++   V  L   SL+GPF+ PV+    P Y+ ++P+PIDL TI E++ +++Y+     I D+ ++  N R+YNE DS I  NS  L       +++S
Sbjct: 1131 EADWFGEGRDEMTSRIMGCVDRLCELSLAGPFVYPVDVQAYPDYWSVVPYPIDLHTIIEKLGNRFYRRANALIWDIKQIERNARLYNEEDSQIVNNSTRLVNILSEFIRDS 1241          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO44814 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU7])

HSP 1 Score: 68.5514 bits (166), Expect = 2.557e-12
Identity = 34/91 (37.36%), Postives = 51/91 (56.04%), Query Frame = 3
Query: 2376 LRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMS 2648
             R I+A+++ H  + PFL PVN+ + P YYKII  P+D  T+  +++   Y   Q F  D   +F NC  +NE DS + +    L +FF S
Sbjct:  218 CRTILAEMEKHDDAWPFLIPVNAKQFPEYYKIIRKPMDFHTMKIKLRDYQYSSPQEFAQDSRLVFANCEEFNEDDSEVGQAGKRLSKFFES 308          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO47681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLF4])

HSP 1 Score: 65.0846 bits (157), Expect = 4.592e-12
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 3
Query: 2385 IVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQM---FISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQE 2660
            I+ +L  HS S PF Q V+ S  P YYK+I  P+DL TI  +I+ ++++H      F+SD   +F NC  +N+  S + +    LE ++MS++Q+
Sbjct:   83 ILLELFCHSDSIPFQQKVSKS-VPNYYKVITHPMDLSTIRAKIQPQHFQHYSSITEFLSDCQLIFSNCATFNDESSEVGRMGNNLELYYMSLLQK 176          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat2a (lysine acetyltransferase 2A [Source:NCBI gene;Acc:101170930])

HSP 1 Score: 370.548 bits (950), Expect = 9.589e-115
Identity = 201/435 (46.21%), Postives = 268/435 (61.61%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L++ +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE        QIP               + IP I+ T                          KP++K  +K                         + D D L + L+ ++A +K H  + PF++PV  SEAP YY+II FPIDL+T+++R+K++YY  +++FI+D+ R+  NCR YN  DS   K +  LE+FF   +++  L+
Sbjct:  452 LLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVAKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPG--LTCFKE-----GVRQIP--------------VESIPGIRETG------------------------WKPSSKDKSKE------------------------VKDPDVLYNTLKNLLAQIKTHPDAWPFMEPVKKSEAPDYYEIIRFPIDLKTMTDRLKNRYYVTKKLFIADLQRIISNCREYNPPDSEYCKCANTLEKFFYFKLKDGGLI 808          

HSP 2 Score: 155.992 bits (393), Expect = 1.161e-38
Identity = 99/291 (34.02%), Postives = 155/291 (53.26%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDAN---------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG 866
            F  ++ +EK+  + +CK  D CKC GW   N  +                C+ C H+  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    S+PV++      PFE+P +   + NF+   +SH + K  + M ++++  L C+N ++L + +      Q ++   YK+ Y RWL +C+VP+   SLPRY+ + +FGRN L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G
Sbjct:   74 FPRAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRLDLQQQAASLSEPCRSCGHALAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQ-MSQPVVEGSLGTPPFERPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYRQRTQKEDGAPYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKFRVEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDG 363          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat2a (lysine acetyltransferase 2A [Source:NCBI gene;Acc:101170930])

HSP 1 Score: 327.791 bits (839), Expect = 6.333e-99
Identity = 189/435 (43.45%), Postives = 246/435 (56.55%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            L++ +A+RD  AR+EE  G IEFH+I NSL+ K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFPTQGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLM CEL P+I YTE S +I+RQK+I+ ++I++++  +   YPG  L  FKE    +    IPG++E GW P+                 K  RP ++P   Q  P   A P     K               KS + +  EI   PID        L+ +   LK+                                      +YY  +++FI+D+ R+  NCR YN  DS   K +  LE+FF   +++  L+
Sbjct:  448 LLTPNAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIK-----DG----RVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVAKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKRQKEIIKKLIERKQSQIRKVYPG--LTCFKEGVRQIPVESIPGIRETGWKPSS----------------KDKRPIRSPFPQQTHP--DAWPFMEPVK---------------KSEAPDYYEIIRFPID--------LKTMTDRLKN--------------------------------------RYYVTKKLFIADLQRIISNCREYNPPDSEYCKCANTLEKFFYFKLKDGGLI 792          

HSP 2 Score: 156.377 bits (394), Expect = 8.043e-39
Identity = 101/299 (33.78%), Postives = 159/299 (53.18%), Query Frame = 3
Query:   60 FNMSELIEKILPYQSCKKED-CKCRGWIADNSDAN---------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD---DCSPFEKPCLNTILRNFMVTHYSHSSDK-WEMMVDIARSVLYCINNFRLVSLSNC--AVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTG---ILSPT 881
            F  ++ +EK+  + +CK  D CKC GW   N  +                C+ C H+  EHV  +  +S E++  L  MV DVE L+     E + D +Q+YFY+ K ++KCI    S+PV++      PFE+P +   + NF+   +SH + K  + M ++++  L C+N ++L + +      Q ++   YK+ Y RWL +C+VP+   SLPRY+ + +FGRN L SIF   + +LLEK + E   L       + T FPKFL  LEEE+    SPIW+  F + +  G   ++SP 
Sbjct:   74 FPRAKKLEKLGVFSACKANDTCKCNGWKNPNPPSATRLDLQQQAASLSEPCRSCGHALAEHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQ-MSQPVVEGSLGTPPFERPNIEQGVLNFVQYKFSHLAPKERQTMFELSKMFLLCLNYWKLETPTQYRQRTQKEDGAPYKVDYTRWLCYCHVPQSNDSLPRYETTQVFGRNLLKSIFTVTRRQLLEKFRVEKDKLLPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTMPASDGTQLVISPA 371          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat2b (histone acetyltransferase KAT2B [Source:NCBI gene;Acc:101159205])

HSP 1 Score: 295.819 bits (756), Expect = 8.604e-89
Identity = 153/252 (60.71%), Postives = 190/252 (75.40%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA 2123
            L+S H++RD AAR+EE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW PA
Sbjct:  266 LLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIKDYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPA 506          

HSP 2 Score: 104.375 bits (259), Expect = 1.326e-22
Identity = 45/98 (45.92%), Postives = 71/98 (72.45%), Query Frame = 3
Query: 2379 RPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            R  V   + H  + PF++PV  +EAPGYY++I FP+DL+T+SER+KS+YY  R++F++D+ R+F NCR YN  +S  YK + +LE+FF   ++E+ L+
Sbjct:  512 RATVHHSESHQNAWPFMEPVKKTEAPGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYGKIKEAGLI 609          

HSP 3 Score: 58.5362 bits (140), Expect = 2.288e-8
Identity = 32/101 (31.68%), Postives = 48/101 (47.52%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDAN----------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYIL 329
            +EK+  Y SCK E  CKC GW + N                    C+ C H+  +HV  +  +S E++  L  +V DVE LY+    E + D +Q+YF + 
Sbjct:   57 LEKLGIYSSCKAEGPCKCNGWKSQNPPPTPPQTDQQTNTVNLQEPCRSCSHTLGDHVSHLENISEEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLF 157          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat2b (histone acetyltransferase KAT2B [Source:NCBI gene;Acc:101159205])

HSP 1 Score: 296.59 bits (758), Expect = 2.786e-87
Identity = 153/252 (60.71%), Postives = 190/252 (75.40%), Query Frame = 3
Query: 1368 LMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPA 2123
            L+S H++RD AAR+EE  G IEFH+I NSL  K   ++ +WLV LQ VFS QLP MPKEYITRLVFDPKHK L L+K     DG     VIGGICFRMFP+QGFTEIVFCAV  NEQVKGYGT LMNHLK+YHI+H + +FLTYAD YA GYF+KQGFS++I++ K  Y GYIK+YEGATLMGCEL P I YTEFS +I++QK+I+ ++I++++  +   YPG+S   FK+    +    IPG++E GW PA
Sbjct:  438 LLSAHSARDEAARLEERRGVIEFHVIGNSLNQKPNKRILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLSLIK-----DG----RVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHEILNFLTYADEYAIGYFKKQGFSKDIKVPKSKYVGYIKDYEGATLMGCELNPSIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSC--FKDGVRQIPIESIPGIRETGWKPA 678          

HSP 2 Score: 157.918 bits (398), Expect = 2.488e-39
Identity = 106/307 (34.53%), Postives = 161/307 (52.44%), Query Frame = 3
Query:   78 IEKILPYQSCKKED-CKCRGWIADNSDAN----------------CKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLD--DCSPFEKPCLNTILRNFMVTHYSH-SSDKWEMMVDIARSVLYCINNFRLVSLSN--CAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVF-------QLTSFTGILSPTLTNCLHNFSS 911
            +EK+  Y SCK E  CKC GW + N                    C+ C H+  +HV  +  +S E++  L  +V DVE LY+    E + D +Q+YF + K ++K I   G KP+L+  +  PFEKP +   + NF+   +SH  S + + ++++A+  L  IN ++L + S     V  +    YK+ Y RWL +C VP+FC SLPRY+ + IFGR  L S+F   +++LLE+ + E   L       + T FPKFL  LEEE+ +  SPIW   F       Q+   T I +P +T  L+  +S
Sbjct:   57 LEKLGIYSSCKAEGPCKCNGWKSQNPPPTPPQTDQQTNTVNLQEPCRSCSHTLGDHVSHLENISEEEMNRLLGVVLDVEYLYTCVHKEEDADTKQVYFSLFKLLRKSILQMG-KPMLEAQESPPFEKPSIEQGVNNFVQYKFSHLPSKERQTIMELAKMFLNQINYWQLETPSQRRQRVPNEETAGYKVNYTRWLCYCNVPQFCDSLPRYETTQIFGRTLLRSVFTIMRKQLLEQARQEKDKLPPEKRTLILTHFPKFLSMLEEEVYSHSSPIWSLEFLAGTTGGQIPVQTVISAPPVTRSLYYSAS 362          

HSP 3 Score: 111.309 bits (277), Expect = 1.154e-24
Identity = 48/109 (44.04%), Postives = 78/109 (71.56%), Query Frame = 3
Query: 2346 IDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            + D + L   L+ I+  +K H  + PF++PV  +EAPGYY++I FP+DL+T+SER+KS+YY  R++F++D+ R+F NCR YN  +S  YK + +LE+FF   ++E+ L+
Sbjct:  684 LKDPEQLYTTLKSILQHVKSHQNAWPFMEPVKKTEAPGYYQVIRFPMDLKTMSERLKSRYYTTRKLFMADMQRIFTNCREYNPPESEYYKCANLLEKFFYGKIKEAGLI 792          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: BPTF (bromodomain PHD finger transcription factor [Source:NCBI gene;Acc:101168342])

HSP 1 Score: 95.9005 bits (237), Expect = 1.326e-19
Identity = 44/112 (39.29%), Postives = 75/112 (66.96%), Query Frame = 3
Query: 2310 SSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFM 2645
            S+E+   +FT P+ + D+  + LR I+  L+ H ++ PFL+PV++++AP YY++I  P+DL T+ ER+  + Y     F++D+ ++F NCR YN +DS  Y+ + VLE FF+
Sbjct: 2799 STEDAMTVFT-PLTEKDF--EGLRRILRSLQAHKMAWPFLEPVDTNDAPDYYRVIKEPMDLSTMEERLLKRAYVKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFV 2907          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000017094.1 (SMESG000017094.1)

HSP 1 Score: 1672.91 bits (4331), Expect = 0.000e+0
Identity = 865/875 (98.86%), Postives = 866/875 (98.97%), Query Frame = 3
Query:   66 MSELIEKILPYQSCKKEDCKCRGWIADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFXXXXXXXXXSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPXXXXXXXXXXXXXXXXX--XXXXATFPSNGVSRRKSSRLQQXXXXXX----KASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVRQLLTELXXXXXXXXXXXXXXXKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 2672
            MSELIEKILPYQSCKKEDCKCRGWIADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFKEELLEKLKSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPLEFKKEEEEEAE + K   EEKLATFPSNGVSRRKSSRLQQHHHHHH    KASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVRQLLTELEGDSSDGEDTESETSKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL
Sbjct:    1 MSELIEKILPYQSCKKEDCKCRGWIADNSDANCKICDHSSEEHVKFISELSPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGSKPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINNFRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGRNFLVSIFPKFKEELLEKLKSENIDLNETHLNFVRTEFPKFLMKLEEELTNLRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGLSVVVNLPEESKHFPCSLPLEFKKEEEEEAEAEVKEKLEEKLATFPSNGVSRRKSSRLQQHHHHHHHHHHKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEHVDEEQFDEDVRQLLTELEGDSSDGEDTESETSKLLMSLHASRDVAARIEESTGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVFDPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNEQVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNKEAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRALESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKITSPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSIMQESKLL 875          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000002851.1 (SMESG000002851.1)

HSP 1 Score: 68.1662 bits (165), Expect = 2.944e-11
Identity = 49/153 (32.03%), Postives = 73/153 (47.71%), Query Frame = 3
Query: 2208 GQIEPTGTAAPEKPTTKRAAKSTDF-TELHIETKSSSENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYY----KHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFFMSI 2651
            G +  TG    E+ T   +  S D   +  I+ KS     N I    I+ A +       ++ ++  H  S PF+ PV+  E P YY+II  PI++  + E+ K   Y       ++F+SDV +MF N  VYN  DS I   +  LE+FF  I
Sbjct: 1373 GSVTGTGNVKQERQTCNGSGDSDDVVNKAPIQKKS----FNGISAEKIEKACY------HMLKNMMSHKASWPFIDPVDPEEVPDYYQIITDPINIAQMMEKYKQGIYASGIDSLKIFLSDVGQMFFNAEVYNMPDSDIMNLAITLEQFFKGI 1515          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.984e-9
Identity = 30/91 (32.97%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 2370 DQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            +  R  + ++   +L  PFL+PV+  + P Y K+I  P+D  T++ ++    YK    F++D+  +F+NC  +NE DS I K    L  FF
Sbjct: 1786 ENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFF 1876          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000068165.1 (SMESG000068165.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.984e-9
Identity = 30/91 (32.97%), Postives = 50/91 (54.95%), Query Frame = 3
Query: 2370 DQLRPIVADLKHHSLSGPFLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSAVLERFF 2642
            +  R  + ++   +L  PFL+PV+  + P Y K+I  P+D  T++ ++    YK    F++D+  +F+NC  +NE DS I K    L  FF
Sbjct: 1787 ENCRKFLLEILDLNLVYPFLRPVDVKKVPIYKKVIKTPMDFSTLARKLSDFVYKSTNEFLNDLRLIFNNCEQFNEDDSDIGKAGHALRAFF 1877          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000046902.1 (SMESG000046902.1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.803e-9
Identity = 33/89 (37.08%), Postives = 49/89 (55.06%), Query Frame = 3
Query: 2424 FLQPVNSSEAPGYYKIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYKNSA------VLERFFMSIMQESKLL 2672
            FL PV   E P YY +I  P+DL T+  RI   YY+ R+ F+ D+  ++ NC  +N  D++ Y N A      V+E+F     +E KL+
Sbjct: 1602 FLHPVRKRECPNYYTVIDNPMDLSTVKMRINDNYYETRESFLQDIKLIYDNCITFN-GDTSEYSNIAKQLMSFVMEQF---CAKERKLM 1686          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KAT2B2.351e-13038.97lysine acetyltransferase 2B [Source:HGNC Symbol;Ac... [more]
KAT2A4.506e-8560.16lysine acetyltransferase 2A [Source:HGNC Symbol;Ac... [more]
KAT2A2.096e-3232.68lysine acetyltransferase 2A [Source:HGNC Symbol;Ac... [more]
KAT2A5.178e-2669.84lysine acetyltransferase 2A [Source:HGNC Symbol;Ac... [more]
BPTF3.836e-2036.21bromodomain PHD finger transcription factor [Sourc... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcaf-11.028e-6734.57P300/CBP Associated Factor homolog [Source:UniPro... [more]
athp-22.931e-1131.16AT Hook plus PHD finger transcription factor [Sou... [more]
nurf-14.294e-1135.06Nucleosome-remodeling factor subunit NURF301-like ... [more]
nurf-14.294e-1135.06Nucleosome-remodeling factor subunit NURF301-like ... [more]
nurf-18.624e-1135.44Nucleosome-remodeling factor subunit NURF301-like ... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gcn55.311e-9841.06gene:FBgn0020388 transcript:FBtr0075969[more]
E(bx)4.666e-1535.48gene:FBgn0000541 transcript:FBtr0072522[more]
E(bx)4.734e-1535.48gene:FBgn0000541 transcript:FBtr0332102[more]
E(bx)4.915e-1535.48gene:FBgn0000541 transcript:FBtr0332103[more]
E(bx)4.915e-1535.48gene:FBgn0000541 transcript:FBtr0072521[more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat2a6.463e-11846.90K(lysine) acetyltransferase 2A [Source:NCBI gene;A... [more]
kat2a9.752e-9559.92K(lysine) acetyltransferase 2A [Source:NCBI gene;A... [more]
kat2b1.558e-8761.35K(lysine) acetyltransferase 2B [Source:NCBI gene;A... [more]
kat2a1.676e-5268.12K(lysine) acetyltransferase 2A [Source:NCBI gene;A... [more]
bptf2.425e-1939.29bromodomain PHD finger transcription factor [Sourc... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
diras28.605e-9044.14DIRAS family GTP binding RAS like 2 [Source:Xenbas... [more]
diras21.010e-8944.14DIRAS family GTP binding RAS like 2 [Source:Xenbas... [more]
diras21.039e-8944.14DIRAS family GTP binding RAS like 2 [Source:Xenbas... [more]
diras22.025e-8944.14DIRAS family GTP binding RAS like 2 [Source:Xenbas... [more]
KAT2B5.840e-8560.32K(lysine) acetyltransferase 2B [Source:NCBI gene;A... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kat2b9.155e-13138.41K(lysine) acetyltransferase 2B [Source:MGI Symbol;... [more]
Kat2a2.408e-8560.16K(lysine) acetyltransferase 2A [Source:MGI Symbol;... [more]
Kat2a2.461e-8560.16K(lysine) acetyltransferase 2A [Source:MGI Symbol;... [more]
Kat2b4.763e-2733.98K(lysine) acetyltransferase 2B [Source:MGI Symbol;... [more]
Kat2b8.813e-2152.53K(lysine) acetyltransferase 2B [Source:MGI Symbol;... [more]
back to top
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JHD1|KAT2B_MOUSE6.404e-13038.41Histone acetyltransferase KAT2B OS=Mus musculus OX... [more]
sp|Q92831|KAT2B_HUMAN1.129e-12938.97Histone acetyltransferase KAT2B OS=Homo sapiens OX... [more]
sp|A0A0R4IXF6|KAT2A_DANRE4.879e-11746.90Histone acetyltransferase KAT2A OS=Danio rerio OX=... [more]
sp|Q1LUC3|KAT2B_DANRE1.176e-8661.35Histone acetyltransferase KAT2B OS=Danio rerio OX=... [more]
sp|Q9JHD2|KAT2A_MOUSE1.684e-8460.16Histone acetyltransferase KAT2A OS=Mus musculus OX... [more]
back to top
BLAST of Histone acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4N9780.000e+039.89Histone acetyltransferase OS=Paragonimus westerman... [more]
G7YQ651.018e-15953.55Histone acetyltransferase OS=Clonorchis sinensis O... [more]
A0A419Q9955.015e-15753.22Histone acetyltransferase KAT2B OS=Clonorchis sine... [more]
A0A4V3S9U74.348e-15353.86Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A430QCR91.579e-15252.74Histone acetyltransferase OS=Schistosoma bovis OX=... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat2a6.099e-9460.71lysine acetyltransferase 2A [Source:NCBI gene;Acc:... [more]
kat2b2.975e-8861.35histone acetyltransferase KAT2B [Source:NCBI gene;... [more]
kat2b7.472e-8861.35histone acetyltransferase KAT2B [Source:NCBI gene;... [more]
bptf1.837e-1837.50nucleosome-remodeling factor subunit BPTF-like [So... [more]
bptf1.843e-1836.21nucleosome-remodeling factor subunit BPTF-like [So... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat2b6.868e-8861.45K(lysine) acetyltransferase 2B [Source:NCBI gene;A... [more]
ENSPMAT00000010200.13.414e-1939.81pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 g... [more]
ENSPMAT00000008098.11.766e-1238.10pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 g... [more]
ENSPMAT00000004772.14.452e-1033.72pep scaffold:Pmarinus_7.0:GL477964:1616:15578:1 ge... [more]
ENSPMAT00000008812.14.568e-1034.04pep scaffold:Pmarinus_7.0:GL478772:7873:35829:1 ge... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GCN52.354e-5643.27Catalytic subunit of ADA and SAGA histone acetyltr... [more]
SPT71.586e-934.15Subunit of the SAGA transcriptional regulatory com... [more]
RSC41.636e-830.49Component of the RSC chromatin remodeling complex;... [more]
RSC22.803e-738.10Component of the RSC chromatin remodeling complex;... [more]
BDF23.257e-725.20Protein involved in transcription initiation; acts... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438441.812e-9042.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449021.656e-2136.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388593.650e-1433.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448142.557e-1237.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476814.592e-1236.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat2a9.589e-11546.21lysine acetyltransferase 2A [Source:NCBI gene;Acc:... [more]
kat2a6.333e-9943.45lysine acetyltransferase 2A [Source:NCBI gene;Acc:... [more]
kat2b8.604e-8960.71histone acetyltransferase KAT2B [Source:NCBI gene;... [more]
kat2b2.786e-8760.71histone acetyltransferase KAT2B [Source:NCBI gene;... [more]
BPTF1.326e-1939.29bromodomain PHD finger transcription factor [Sourc... [more]
back to top
BLAST of Histone acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017094.10.000e+098.86SMESG000017094.1[more]
SMESG000002851.12.944e-1132.03SMESG000002851.1[more]
SMESG000068165.11.984e-932.97SMESG000068165.1[more]
SMESG000068165.11.984e-932.97SMESG000068165.1[more]
SMESG000046902.13.803e-937.08SMESG000046902.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010620 ID=SMED30010620|Name=Histone acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2693bp
TGTGTTTTAATATTCATATAAAGCTAAATATTATACAAATTATTTAAATA
TATTAATATTTTAATATGTCTGAATTAATTGAAAAGATATTACCGTATCA
GTCATGCAAAAAAGAAGATTGTAAATGTAGAGGTTGGATTGCAGACAATA
GTGACGCAAATTGTAAAATATGTGATCATTCAAGTGAAGAGCATGTCAAA
TTTATATCAGAACTTTCACCCGAAAAACTTTTGGATTTAAAACAAATGGT
TGACGATGTTGAATTGTTATATTCAATAGCAAAGGATGAAACTGAAATTG
ATGATAGACAAATTTACTTTTACATTCTTAAAAAAATTAAAAAATGTATT
CACCACGGTGGTTCAAAACCAGTTCTTGATGATTGTTCACCTTTTGAAAA
ACCATGTTTAAATACAATCTTGCGCAATTTCATGGTAACCCATTACTCAC
ACAGCTCAGATAAATGGGAAATGATGGTCGATATCGCTCGATCGGTGCTC
TATTGCATCAATAATTTCCGATTGGTATCACTGTCAAATTGCGCTGTGCA
GCCGGATAATCCAATTTCTTACAAGTTGATCTACATCCGATGGTTAAGCC
ACTGTTACGTGCCCAAATTCTGCAAAAGCCTCCCTAGATATGACGCGTCA
GTGATATTCGGTAGGAATTTCCTCGTTAGCATTTTCCCTAAATTCAAAGA
GGAATTACTGGAAAAATTGAAATCGGAAAACATTGATCTCAATGAAACTC
ATCTGAATTTCGTCAGAACTGAATTTCCAAAATTTCTCATGAAGCTCGAA
GAAGAACTGACAAATCTCCGCTCTCCCATCTGGGATCCTGTGTTTCAATT
GACCAGCTTCACTGGGATATTGTCTCCGACTCTTACTAACTGTCTCCACA
ATTTCAGCTCTGTACTCTGTTCCGACTCGAAACCGTCTCCGTTTAATAGT
CCCAAGAAAGGATTGTCTGTGGTTGTCAATTTGCCAGAAGAATCCAAACA
CTTTCCCTGCTCGTTACCGCTGGAATTTAAGAAAGAAGAAGAAGAAGAAG
CGGAAGTGAAAGAGAAGCTGGAAGAGAAATTGGCCACATTTCCATCGAAT
GGAGTTAGTCGAAGGAAAAGCTCTCGGTTACAGCAACATCATCATCATCA
TCATAAAGCATCCGATTCAAACAATCATTGTGAAATCTCAGAACTCGTTA
GCATTGATCCGGAGGAAATTAATTTGTGTTTGTCGTCTCCAAAGAAACAG
AAACGAATAGAACATGTGGATGAGGAACAATTTGATGAGGATGTTAGGCA
ACTATTGACGGAATTGGAGGGTGATTCTAGCGACGGGGAAGATACTGAGA
GCGAGACATCGAAATTGTTGATGTCGTTACATGCCAGTAGAGATGTTGCT
GCTCGAATAGAAGAGTCAACCGGCGGAATCGAATTTCACATTATCAACAA
CAGTTTGACTGTGAAGCAGCTGAATCAAGTTTACGTGTGGCTTGTCGAAT
TACAAACTGTATTCTCGCTCCAATTGCCAATGATGCCGAAAGAATATATT
ACGAGATTAGTATTTGATCCCAAACATAAAAACCTCGTGCTTGTTAAGAC
CAGTGAAAATGCCGATGGGACAGTTGAAAGGCATGTTATTGGAGGAATTT
GTTTTCGAATGTTTCCTACTCAAGGATTCACAGAAATAGTATTCTGTGCT
GTTATATTCAATGAGCAAGTTAAAGGCTATGGCACTCAATTGATGAACCA
TCTCAAAGACTACCACATTCAGCATGGGTTGACACATTTTCTGACTTATG
CTGATTCATATGCCACTGGTTATTTCCGCAAACAAGGATTTTCTCGTGAG
ATTCGGTTGAACAAGGAAGCATATCAAGGTTACATAAAGGAATATGAAGG
TGCGACTCTCATGGGCTGTGAGCTTTATCCACAGATTGTTTATACGGAAT
TCTCGGATCTCATTCGGAGGCAGAAACAGATAGTGAATCGCATTATCAAA
AAGCGCCGAAGAGCTCTAGAAAGCGAATATCCCGGCATCAGTTTAGCCAT
GTTCAAGGAATCAGGCGGCTGTTTGTCTCCCGCACAAATCCCCGGCCTAA
AAGAAGCCGGATGGCTTCCTGCCCAAGATACCCATTCAGATTTTATTCCA
AAGATTAAAATAACATCTCCCCGTAAACGCGGTCGACCACGGAAAACTCC
CCTCATTGGCCAGATCGAACCGACCGGAACAGCAGCCCCAGAGAAACCCA
CAACAAAACGTGCCGCAAAATCCACAGATTTCACCGAACTCCATATCGAA
ACTAAAAGTTCATCGGAAAATCTCAACGAGATATTCACAGTTCCGATCGA
TGATGCCGATTGGCTAGCGGACCAGCTGAGACCGATTGTAGCGGACCTGA
AGCATCACTCGCTGTCTGGTCCGTTCCTTCAACCGGTAAACTCGTCAGAA
GCTCCCGGCTATTATAAAATCATTCCGTTTCCCATCGATCTGCGCACGAT
TTCCGAGCGGATCAAGAGTAAATATTACAAACATCGGCAAATGTTTATCA
GCGACGTCATCCGAATGTTTCACAACTGCCGAGTTTATAATGAAACGGAT
TCGGCCATTTACAAGAACTCGGCCGTTTTAGAAAGGTTTTTCATGTCGAT
AATGCAAGAATCGAAATTGTTGTAAATAAATCAATTTTTATTA
back to top

protein sequence of SMED30010620-orf-1

>SMED30010620-orf-1 ID=SMED30010620-orf-1|Name=SMED30010620-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=870bp
MSELIEKILPYQSCKKEDCKCRGWIADNSDANCKICDHSSEEHVKFISEL
SPEKLLDLKQMVDDVELLYSIAKDETEIDDRQIYFYILKKIKKCIHHGGS
KPVLDDCSPFEKPCLNTILRNFMVTHYSHSSDKWEMMVDIARSVLYCINN
FRLVSLSNCAVQPDNPISYKLIYIRWLSHCYVPKFCKSLPRYDASVIFGR
NFLVSIFPKFKEELLEKLKSENIDLNETHLNFVRTEFPKFLMKLEEELTN
LRSPIWDPVFQLTSFTGILSPTLTNCLHNFSSVLCSDSKPSPFNSPKKGL
SVVVNLPEESKHFPCSLPLEFKKEEEEEAEVKEKLEEKLATFPSNGVSRR
KSSRLQQHHHHHHKASDSNNHCEISELVSIDPEEINLCLSSPKKQKRIEH
VDEEQFDEDVRQLLTELEGDSSDGEDTESETSKLLMSLHASRDVAARIEE
STGGIEFHIINNSLTVKQLNQVYVWLVELQTVFSLQLPMMPKEYITRLVF
DPKHKNLVLVKTSENADGTVERHVIGGICFRMFPTQGFTEIVFCAVIFNE
QVKGYGTQLMNHLKDYHIQHGLTHFLTYADSYATGYFRKQGFSREIRLNK
EAYQGYIKEYEGATLMGCELYPQIVYTEFSDLIRRQKQIVNRIIKKRRRA
LESEYPGISLAMFKESGGCLSPAQIPGLKEAGWLPAQDTHSDFIPKIKIT
SPRKRGRPRKTPLIGQIEPTGTAAPEKPTTKRAAKSTDFTELHIETKSSS
ENLNEIFTVPIDDADWLADQLRPIVADLKHHSLSGPFLQPVNSSEAPGYY
KIIPFPIDLRTISERIKSKYYKHRQMFISDVIRMFHNCRVYNETDSAIYK
NSAVLERFFMSIMQESKLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016573histone acetylation
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036427Bromodomain-like_sf
IPR037800GCN5
IPR001487Bromodomain
IPR016181Acyl_CoA_acyltransferase
IPR009464PCAF_N
IPR000182GNAT_dom
IPR018359Bromodomain_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004402histone acetyltransferase activity
GO:0008080N-acetyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 319..343
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 457..633
e-value: 7.7E-68
score: 229.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 338..376
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 354..371
NoneNo IPR availablePANTHERPTHR45750:SF2HISTONE ACETYLTRANSFERASE KAT2Bcoord: 436..696
coord: 5..264
NoneNo IPR availablePANTHERPTHR45750:SF2HISTONE ACETYLTRANSFERASE KAT2Bcoord: 768..874
NoneNo IPR availableCDDcd04301NAT_SFcoord: 530..581
e-value: 0.00359688
score: 34.5589
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 802..818
score: 49.1
coord: 788..801
score: 38.35
coord: 836..855
score: 38.91
coord: 818..836
score: 26.2
IPR001487BromodomainSMARTSM00297bromo_6coord: 766..874
e-value: 4.3E-29
score: 112.6
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 778..857
e-value: 3.0E-20
score: 72.1
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 785..855
score: 19.744
IPR000182GNAT domainPFAMPF00583Acetyltransf_1coord: 521..598
e-value: 2.8E-6
score: 27.6
IPR000182GNAT domainPROSITEPS51186GNATcoord: 470..627
score: 14.391
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 767..875
e-value: 3.1E-31
score: 109.2
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 770..871
IPR009464PCAF, N-terminalPFAMPF06466PCAF_Ncoord: 5..217
e-value: 1.9E-54
score: 184.9
IPR037800Histone acetyltransferase GCN5PANTHERPTHR45750FAMILY NOT NAMEDcoord: 436..696
coord: 5..264
IPR037800Histone acetyltransferase GCN5PANTHERPTHR45750FAMILY NOT NAMEDcoord: 768..874
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 790..847
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 462..628