SMED30010610

Overview
NameSMED30010610
Smed IDSMED30010610
Length (bp)721
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30010610

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30010610 SmedASXL_043571SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30010610 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000021:108930..109648 +3490
Homology
BLAST of SMED30010610 vs. Ensembl Human
Match: HSP90AA1 (heat shock protein 90 alpha family class A member 1 [Source:HGNC Symbol;Acc:HGNC:5253])

HSP 1 Score: 38.5058 bits (88), Expect = 2.145e-6
Identity = 27/60 (45.00%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:  186 LTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 245          

HSP 2 Score: 31.5722 bits (70), Expect = 2.145e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  251 SMIGQFGVGFYSAYLVAEKVTVITK 275          
BLAST of SMED30010610 vs. Ensembl Human
Match: HSP90AA1 (heat shock protein 90 alpha family class A member 1 [Source:HGNC Symbol;Acc:HGNC:5253])

HSP 1 Score: 38.5058 bits (88), Expect = 2.359e-6
Identity = 27/60 (45.00%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   64 LTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 123          

HSP 2 Score: 31.5722 bits (70), Expect = 2.359e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  129 SMIGQFGVGFYSAYLVAEKVTVITK 153          
BLAST of SMED30010610 vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 37.7354 bits (86), Expect = 5.813e-6
Identity = 25/60 (41.67%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   59 LTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 118          

HSP 2 Score: 31.187 bits (69), Expect = 5.813e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  124 SMIGQFGVGFYSAYLVA 140          
BLAST of SMED30010610 vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 37.7354 bits (86), Expect = 5.813e-6
Identity = 25/60 (41.67%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   59 LTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 118          

HSP 2 Score: 31.187 bits (69), Expect = 5.813e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  124 SMIGQFGVGFYSAYLVA 140          
BLAST of SMED30010610 vs. Ensembl Human
Match: HSP90AB1 (heat shock protein 90 alpha family class B member 1 [Source:HGNC Symbol;Acc:HGNC:5258])

HSP 1 Score: 37.7354 bits (86), Expect = 5.813e-6
Identity = 25/60 (41.67%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   59 LTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 118          

HSP 2 Score: 31.187 bits (69), Expect = 5.813e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  124 SMIGQFGVGFYSAYLVA 140          
BLAST of SMED30010610 vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0332873)

HSP 1 Score: 43.8986 bits (102), Expect = 8.749e-8
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.4166 bits (67), Expect = 8.749e-8
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. Ensembl Fly
Match: Hsp83 (gene:FBgn0001233 transcript:FBtr0073040)

HSP 1 Score: 43.8986 bits (102), Expect = 8.749e-8
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.4166 bits (67), Expect = 8.749e-8
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. Ensembl Zebrafish
Match: hsp90aa1.1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 [Source:NCBI gene;Acc:30591])

HSP 1 Score: 40.0466 bits (92), Expect = 6.708e-7
Identity = 30/60 (50.00%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKIA-------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  D KI         TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   61 LTDPSKLDSCKDLKIELIPDQKERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 6.708e-7
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAEKVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Zebrafish
Match: hsp90aa1.1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 1 [Source:NCBI gene;Acc:30591])

HSP 1 Score: 40.0466 bits (92), Expect = 6.708e-7
Identity = 30/60 (50.00%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKIA-------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  D KI         TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   61 LTDPSKLDSCKDLKIELIPDQKERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 6.708e-7
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAEKVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Zebrafish
Match: hsp90aa1.2 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 39.6614 bits (91), Expect = 6.925e-7
Identity = 30/60 (50.00%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKIA-------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  D KI         TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   62 LTDPSKLDSGKDLKIEIIPNKEERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 121          

HSP 2 Score: 31.5722 bits (70), Expect = 6.925e-7
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  127 SMIGQFGVGFYSAYLVAEKVTVITK 151          
BLAST of SMED30010610 vs. Ensembl Zebrafish
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 37.7354 bits (86), Expect = 2.747e-6
Identity = 28/60 (46.67%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKI-------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD + LD+  D KI         TL +I+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   58 LTDPTKLDSGKDLKIDIIPNVQERTLTLIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 117          

HSP 2 Score: 31.5722 bits (70), Expect = 2.747e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  123 SMIGQFGVGFYSAYLVAEKVTVITK 147          
BLAST of SMED30010610 vs. Ensembl Zebrafish
Match: hsp90ab1 (heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-031001-3])

HSP 1 Score: 37.7354 bits (86), Expect = 2.747e-6
Identity = 28/60 (46.67%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKI-------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD + LD+  D KI         TL +I+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   58 LTDPTKLDSGKDLKIDIIPNVQERTLTLIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 117          

HSP 2 Score: 31.5722 bits (70), Expect = 2.747e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  123 SMIGQFGVGFYSAYLVAEKVTVITK 147          
BLAST of SMED30010610 vs. Ensembl Xenopus
Match: hsp90aa1.1 (heat shock protein 90kDa alpha family class A member 1 [Source:NCBI gene;Acc:549036])

HSP 1 Score: 39.2762 bits (90), Expect = 1.314e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   73 LTDPSKLDSGKELKIYLIPNKQDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 132          

HSP 2 Score: 31.5722 bits (70), Expect = 1.314e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  138 SMIGQFGVGFYSAYLVAEKVTVITK 162          
BLAST of SMED30010610 vs. Ensembl Xenopus
Match: hsp90aa1.1 (heat shock protein 90kDa alpha family class A member 1 [Source:NCBI gene;Acc:549036])

HSP 1 Score: 39.2762 bits (90), Expect = 1.315e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   61 LTDPSKLDSGKELKIYLIPNKQDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 1.315e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAEKVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Xenopus
Match: hsp90aa1.1 (heat shock protein 90kDa alpha family class A member 1 [Source:NCBI gene;Acc:549036])

HSP 1 Score: 39.2762 bits (90), Expect = 1.325e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   57 LTDPSKLDSGKELKIYLIPNKQDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 116          

HSP 2 Score: 31.5722 bits (70), Expect = 1.325e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  122 SMIGQFGVGFYSAYLVAEKVTVITK 146          
BLAST of SMED30010610 vs. Ensembl Xenopus
Match: hsp90aa1.1 (heat shock protein 90kDa alpha family class A member 1 [Source:NCBI gene;Acc:549036])

HSP 1 Score: 39.2762 bits (90), Expect = 1.347e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   59 LTDPSKLDSGKELKIYLIPNKQDRTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 118          

HSP 2 Score: 31.5722 bits (70), Expect = 1.347e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  124 SMIGQFGVGFYSAYLVAEKVTVITK 148          
BLAST of SMED30010610 vs. Ensembl Xenopus
Match: uck1 (uridine-cytidine kinase 1 [Source:Xenbase;Acc:XB-GENE-961187])

HSP 1 Score: 39.2762 bits (90), Expect = 2.252e-6
Identity = 29/60 (48.33%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKI-------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  D KI         TL +I+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   88 LTDPSKLDSGKDLKIDIIPNRQERTLTVIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 147          

HSP 2 Score: 31.187 bits (69), Expect = 2.252e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  153 SMIGQFGVGFYSAYLVAEKVLVITK 177          
BLAST of SMED30010610 vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 38.5058 bits (88), Expect = 1.521e-6
Identity = 27/60 (45.00%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   64 LTDPSKLDSGKELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 123          

HSP 2 Score: 31.5722 bits (70), Expect = 1.521e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  129 SMIGQFGVGFYSAYLVAEKVTVITK 153          
BLAST of SMED30010610 vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 38.5058 bits (88), Expect = 1.521e-6
Identity = 27/60 (45.00%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   64 LTDPSKLDSGKELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 123          

HSP 2 Score: 31.5722 bits (70), Expect = 1.521e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  129 SMIGQFGVGFYSAYLVAEKVTVITK 153          
BLAST of SMED30010610 vs. Ensembl Mouse
Match: Hsp90aa1 (heat shock protein 90, alpha (cytosolic), class A member 1 [Source:MGI Symbol;Acc:MGI:96250])

HSP 1 Score: 38.891 bits (89), Expect = 3.137e-6
Identity = 27/64 (42.19%), Postives = 33/64 (51.56%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   60 RYESLTDPSKLDSGKELHINLIPSKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 123          

HSP 2 Score: 30.8018 bits (68), Expect = 3.137e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  129 SMIGQFGVGFYSAYLVAEKVTVITK 153          
BLAST of SMED30010610 vs. Ensembl Mouse
Match: Hsp90ab1 (heat shock protein 90 alpha (cytosolic), class B member 1 [Source:MGI Symbol;Acc:MGI:96247])

HSP 1 Score: 37.7354 bits (86), Expect = 4.231e-6
Identity = 25/60 (41.67%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKIA---------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++           TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   59 LTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 118          

HSP 2 Score: 31.187 bits (69), Expect = 4.231e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  124 SMIGQFGVGFYSAYLVA 140          
BLAST of SMED30010610 vs. UniProt/SwissProt
Match: sp|P02828|HSP83_DROME (Heat shock protein 83 OS=Drosophila melanogaster OX=7227 GN=Hsp83 PE=1 SV=1)

HSP 1 Score: 43.8986 bits (102), Expect = 6.382e-7
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.4166 bits (67), Expect = 6.382e-7
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. UniProt/SwissProt
Match: sp|P04810|HSP83_DROSI (Heat shock protein 83 (Fragment) OS=Drosophila simulans OX=7240 GN=Hsp83 PE=3 SV=1)

HSP 1 Score: 44.2838 bits (103), Expect = 6.445e-7
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.0314 bits (66), Expect = 6.445e-7
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. UniProt/SwissProt
Match: sp|O02192|HSP83_DROAV (Heat shock protein 83 OS=Drosophila auraria OX=47315 GN=Hsp83 PE=3 SV=1)

HSP 1 Score: 43.8986 bits (102), Expect = 6.863e-7
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.4166 bits (67), Expect = 6.863e-7
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. UniProt/SwissProt
Match: sp|P04811|HSP83_DROVI (Heat shock protein 83 (Fragment) OS=Drosophila virilis OX=7244 GN=Hsp83 PE=3 SV=1)

HSP 1 Score: 44.2838 bits (103), Expect = 7.102e-7
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 30.0314 bits (66), Expect = 7.102e-7
Identity = 12/18 (66.67%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y VA+
Sbjct:  117 SMIGQFGVGFYSAYLVAD 134          
BLAST of SMED30010610 vs. UniProt/SwissProt
Match: sp|O16076|HSP83_DROPE (Heat shock protein 83 (Fragment) OS=Drosophila persimilis OX=7234 GN=Hsp83 PE=3 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 7.274e-7
Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + + LTD S LD+           K AGTL II+ G GMT    + N   IA+SGTK FME LQ
Sbjct:   48 RYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQ 111          

HSP 2 Score: 29.6462 bits (65), Expect = 7.274e-7
Identity = 11/18 (61.11%), Postives = 16/18 (88.89%), Query Frame = -1
Query:  266 AMIGQFGLYFYSSYFVAN 319
            +MIGQFG+ FYS+Y +A+
Sbjct:  117 SMIGQFGVGFYSAYLIAD 134          
BLAST of SMED30010610 vs. TrEMBL
Match: C0KTP7 (90 kDa heat shock protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 8.197e-7
Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + K LTD SVLD+           K AGTL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   49 RYKSLTDPSVLDSAKELMIKIIPDKDAGTLTIIDTGVGMTKADLINNLGTIARSGTKAFMEALQ 112          

HSP 2 Score: 34.2686 bits (77), Expect = 8.197e-7
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYSSY V++ +QV+ K
Sbjct:  118 SMIGQFGVGFYSSYLVSDKVQVISK 142          
BLAST of SMED30010610 vs. TrEMBL
Match: G4V9B8 (Putative heat shock protein OS=Schistosoma mansoni OX=6183 GN=Smp_072330.1 PE=3 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.216e-6
Identity = 30/61 (49.18%), Postives = 33/61 (54.10%), Query Frame = -2
Query:  319 KCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELL 462
            K LTD SVLDT           K AGTL +++ G GMT    I N   IA SGTK FME L
Sbjct:   56 KSLTDPSVLDTGEEMYIKLIPNKEAGTLTVLDTGIGMTKADLIKNLGTIASSGTKAFMEAL 116          

HSP 2 Score: 33.113 bits (74), Expect = 5.216e-6
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y +A+ +QV+ K
Sbjct:  123 SMIGQFGVGFYSAYLIADRVQVVTK 147          
BLAST of SMED30010610 vs. TrEMBL
Match: A0A183RMF8 (HATPase_c domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.297e-6
Identity = 30/61 (49.18%), Postives = 33/61 (54.10%), Query Frame = -2
Query:  319 KCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELL 462
            K LTD SVLDT           K AGTL +++ G GMT    I N   IA SGTK FME L
Sbjct:   56 KSLTDPSVLDTGEEMYIKLIPNKEAGTLTVLDTGIGMTKADLIKNLGTIASSGTKAFMEAL 116          

HSP 2 Score: 33.113 bits (74), Expect = 5.297e-6
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y +A+ +QV+ K
Sbjct:  123 SMIGQFGVGFYSAYLIADRVQVVTK 147          
BLAST of SMED30010610 vs. TrEMBL
Match: A0A448X2J2 (HATPase_c domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS19722 PE=4 SV=1)

HSP 1 Score: 46.595 bits (109), Expect = 5.441e-6
Identity = 34/78 (43.59%), Postives = 37/78 (47.44%), Query Frame = -2
Query:  316 RTCLSQC---------KCLTDHSVLDTDG---------KIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 483
            R  +S C         K LTD SVLD D          K A T  II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   41 RELISNCSDALDKIRYKSLTDPSVLDNDSNLEIKVIPDKDAKTFTIIDTGIGMTKSDLINNLGTIARSGTKAFMEALQ 118          

HSP 2 Score: 32.3426 bits (72), Expect = 5.441e-6
Identity = 13/25 (52.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y +A+ ++V+ K
Sbjct:  124 SMIGQFGVGFYSAYLIADKVEVISK 148          
BLAST of SMED30010610 vs. TrEMBL
Match: A0A3Q0KHG3 (Putative heat shock protein OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 45.8246 bits (107), Expect = 5.472e-6
Identity = 30/61 (49.18%), Postives = 33/61 (54.10%), Query Frame = -2
Query:  319 KCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELL 462
            K LTD SVLDT           K AGTL +++ G GMT    I N   IA SGTK FME L
Sbjct:   56 KSLTDPSVLDTGEEMYIKLIPNKEAGTLTVLDTGIGMTKADLIKNLGTIASSGTKAFMEAL 116          

HSP 2 Score: 33.113 bits (74), Expect = 5.472e-6
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y +A+ +QV+ K
Sbjct:  123 SMIGQFGVGFYSAYLIADRVQVVTK 147          
BLAST of SMED30010610 vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 39.6614 bits (91), Expect = 6.984e-7
Identity = 26/57 (45.61%), Postives = 30/57 (52.63%), Query Frame = -2
Query:  316 LSQCKCLTDHSVLDTDGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 474
            L  CK L    + D   +   TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   67 LESCKDLKIELIPDLKNR---TLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 6.984e-7
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAERVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 39.6614 bits (91), Expect = 6.984e-7
Identity = 26/57 (45.61%), Postives = 30/57 (52.63%), Query Frame = -2
Query:  316 LSQCKCLTDHSVLDTDGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 474
            L  CK L    + D   +   TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   67 LESCKDLKIELIPDLKNR---TLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 6.984e-7
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAERVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Cavefish
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:103047517])

HSP 1 Score: 39.6614 bits (91), Expect = 9.640e-7
Identity = 26/60 (43.33%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K+  TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   58 LTDPSKLDSGKDLKIDIIPNKLERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 117          

HSP 2 Score: 31.187 bits (69), Expect = 9.640e-7
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  123 SMIGQFGVGFYSAYLVA 139          
BLAST of SMED30010610 vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 38.1206 bits (87), Expect = 1.680e-6
Identity = 21/36 (58.33%), Postives = 23/36 (63.89%), Query Frame = -2
Query:  316 TLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 411
            TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   85 TLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 120          

HSP 2 Score: 31.5722 bits (70), Expect = 1.680e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  126 SMIGQFGVGFYSAYLVAEKVTVITK 150          
BLAST of SMED30010610 vs. Ensembl Cavefish
Match: hsp90aa1.2 (Astyanax mexicanus heat shock protein HSP 90-alpha 1-like (LOC103024454), mRNA. [Source:RefSeq mRNA;Acc:NM_001291257])

HSP 1 Score: 38.1206 bits (87), Expect = 1.680e-6
Identity = 21/36 (58.33%), Postives = 23/36 (63.89%), Query Frame = -2
Query:  316 TLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 411
            TL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   84 TLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 119          

HSP 2 Score: 31.5722 bits (70), Expect = 1.680e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  125 SMIGQFGVGFYSAYLVAEKVTVITK 149          
BLAST of SMED30010610 vs. Ensembl Nematostella
Match: HSP90 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ66])

HSP 1 Score: 37.7354 bits (86), Expect = 1.216e-6
Identity = 28/60 (46.67%), Postives = 33/60 (55.00%), Query Frame = -2
Query:  316 LTDHSVLDT--DGKIA-------GTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD SVLD+  D KI         +L I + G GMT    + N   IA+SGTK FME LQ
Sbjct:   63 LTDPSVLDSCKDLKITLIPNKEENSLTIQDSGVGMTKADLVNNLGTIAKSGTKTFMEALQ 122          

HSP 2 Score: 31.187 bits (69), Expect = 1.216e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  128 SMIGQFGVGFYSAYLVA 144          
BLAST of SMED30010610 vs. Ensembl Medaka
Match: hsp90ab1 (heat shock protein 90 alpha family class B member 1 [Source:NCBI gene;Acc:100125466])

HSP 1 Score: 39.2762 bits (90), Expect = 1.377e-6
Identity = 27/60 (45.00%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLDTD---------GKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+           K   TL I++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   58 LTDPSKLDSGKDLKIDIIPNKADRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 117          

HSP 2 Score: 31.187 bits (69), Expect = 1.377e-6
Identity = 12/17 (70.59%), Postives = 15/17 (88.24%), Query Frame = -1
Query:  269 AMIGQFGLYFYSSYFVA 319
            +MIGQFG+ FYS+Y VA
Sbjct:  123 SMIGQFGVGFYSAYLVA 139          
BLAST of SMED30010610 vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 37.3502 bits (85), Expect = 3.080e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKI---------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++         A TL I + G GMT    I N   IA+SGTK FME LQ
Sbjct:   60 LTDPSKLDSCKELKIEVRPDLHARTLTINDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 119          

HSP 2 Score: 31.5722 bits (70), Expect = 3.080e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  125 SMIGQFGVGFYSAYLVAEKVTVITK 149          
BLAST of SMED30010610 vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 37.3502 bits (85), Expect = 3.130e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKI---------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++         A TL I + G GMT    I N   IA+SGTK FME LQ
Sbjct:   60 LTDPSKLDSCKELKIEVRPDLHARTLTINDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 119          

HSP 2 Score: 31.5722 bits (70), Expect = 3.130e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  125 SMIGQFGVGFYSAYLVAEKVTVITK 149          
BLAST of SMED30010610 vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 37.3502 bits (85), Expect = 3.231e-6
Identity = 26/60 (43.33%), Postives = 31/60 (51.67%), Query Frame = -2
Query:  316 LTDHSVLD---------TDGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD + LD         T  K   TL +++ G GMT    I N   IA+SGTK FME LQ
Sbjct:   60 LTDPAKLDSGKELKIEITPNKQERTLTLMDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 119          

HSP 2 Score: 31.5722 bits (70), Expect = 3.231e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  125 SMIGQFGVGFYSAYLVAEKVTVITK 149          
BLAST of SMED30010610 vs. Ensembl Medaka
Match: hsp90aa1.2 (heat shock protein HSP 90-alpha [Source:NCBI gene;Acc:101169506])

HSP 1 Score: 37.3502 bits (85), Expect = 3.232e-6
Identity = 27/60 (45.00%), Postives = 32/60 (53.33%), Query Frame = -2
Query:  316 LTDHSVLDTDGKI---------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 456
            LTD S LD+  ++         A TL I + G GMT    I N   IA+SGTK FME LQ
Sbjct:   60 LTDPSKLDSCKELKIEVRPDLHARTLTINDTGIGMTKADLINNLGTIAKSGTKAFMEALQ 119          

HSP 2 Score: 31.5722 bits (70), Expect = 3.232e-6
Identity = 14/25 (56.00%), Postives = 19/25 (76.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA  + V+ K
Sbjct:  125 SMIGQFGVGFYSAYLVAEKVTVITK 149          
BLAST of SMED30010610 vs. Planmine SMEST
Match: SMESG000024822.1 (SMESG000024822.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.087e-10
Identity = 33/64 (51.56%), Postives = 36/64 (56.25%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + K LTD SVLDT           K AGTL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   50 RYKSLTDPSVLDTAKELIIKIIPDKDAGTLTIIDTGIGMTKSDLINNLGTIARSGTKAFMEALQ 113          

HSP 2 Score: 35.039 bits (79), Expect = 1.087e-10
Identity = 16/25 (64.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYSSY VA+ +QV+ K
Sbjct:  119 SMIGQFGVGFYSSYLVADKVQVISK 143          
BLAST of SMED30010610 vs. Planmine SMEST
Match: SMESG000071533.1 (SMESG000071533.1)

HSP 1 Score: 47.7506 bits (112), Expect = 2.031e-10
Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + K LTD SVLD+           K AGTL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   49 RYKSLTDPSVLDSAKDLMIKIIPDKDAGTLTIIDTGIGMTKADLINNLGTIARSGTKAFMEALQ 112          

HSP 2 Score: 35.4242 bits (80), Expect = 2.031e-10
Identity = 16/25 (64.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYSSY VA+ +QV+ K
Sbjct:  118 SMIGQFGVGFYSSYLVADKVQVISK 142          
BLAST of SMED30010610 vs. Planmine SMEST
Match: SMESG000071531.1 (SMESG000071531.1)

HSP 1 Score: 47.7506 bits (112), Expect = 2.187e-10
Identity = 32/64 (50.00%), Postives = 36/64 (56.25%), Query Frame = -2
Query:  316 QCKCLTDHSVLDT---------DGKIAGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELLQ 468
            + K LTD SVLD+           K AGTL II+ G GMT    I N   IA+SGTK FME LQ
Sbjct:   49 RYKSLTDPSVLDSAKDLMIKIIPDKDAGTLTIIDTGIGMTKADLINNLGTIARSGTKAFMEALQ 112          

HSP 2 Score: 35.4242 bits (80), Expect = 2.187e-10
Identity = 16/25 (64.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYSSY VA+ +QV+ K
Sbjct:  118 SMIGQFGVGFYSSYLVADKVQVISK 142          
BLAST of SMED30010610 vs. Planmine SMEST
Match: SMESG000025598.1 (SMESG000025598.1)

HSP 1 Score: 38.891 bits (89), Expect = 2.527e-7
Identity = 26/63 (41.27%), Postives = 34/63 (53.97%), Query Frame = -2
Query:  319 QCKCLTDHSVLDTDGKI---------AGTLAIINIGFGMT----IYNSNAIAQSGTKVFMELL 468
            + K LTD SVLD+  ++         + TL + + G GMT    I N   IA+SGTK FME L
Sbjct:   50 RYKSLTDPSVLDSQKELMIKVIPDKDSNTLTLYDTGVGMTKAELINNLGTIARSGTKAFMEAL 112          

HSP 2 Score: 33.8834 bits (76), Expect = 2.527e-7
Identity = 15/25 (60.00%), Postives = 21/25 (84.00%), Query Frame = -1
Query:  245 AMIGQFGLYFYSSYFVAN*MQVL*K 319
            +MIGQFG+ FYS+Y VA+ +QV+ K
Sbjct:  119 SMIGQFGVGFYSAYLVADRVQVITK 143          
The following BLAST results are available for this feature:
BLAST of SMED30010610 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSP90AA12.145e-645.00heat shock protein 90 alpha family class A member ... [more]
HSP90AA12.359e-645.00heat shock protein 90 alpha family class A member ... [more]
HSP90AB15.813e-641.67heat shock protein 90 alpha family class B member ... [more]
HSP90AB15.813e-641.67heat shock protein 90 alpha family class B member ... [more]
HSP90AB15.813e-641.67heat shock protein 90 alpha family class B member ... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010610 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hsp838.749e-845.31gene:FBgn0001233 transcript:FBtr0332873[more]
Hsp838.749e-845.31gene:FBgn0001233 transcript:FBtr0073040[more]
back to top
BLAST of SMED30010610 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90aa1.16.708e-750.00heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90aa1.16.708e-750.00heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90aa1.26.925e-750.00heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90ab12.747e-646.67heat shock protein 90, alpha (cytosolic), class A ... [more]
hsp90ab12.747e-646.67heat shock protein 90, alpha (cytosolic), class A ... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90aa1.11.314e-645.00heat shock protein 90kDa alpha family class A memb... [more]
hsp90aa1.11.315e-645.00heat shock protein 90kDa alpha family class A memb... [more]
hsp90aa1.11.325e-645.00heat shock protein 90kDa alpha family class A memb... [more]
hsp90aa1.11.347e-645.00heat shock protein 90kDa alpha family class A memb... [more]
uck12.252e-648.33uridine-cytidine kinase 1 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hsp90aa11.521e-645.00heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90aa11.521e-645.00heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90aa13.137e-642.19heat shock protein 90, alpha (cytosolic), class A ... [more]
Hsp90ab14.231e-641.67heat shock protein 90 alpha (cytosolic), class B m... [more]
back to top
BLAST of SMED30010610 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02828|HSP83_DROME6.382e-745.31Heat shock protein 83 OS=Drosophila melanogaster O... [more]
sp|P04810|HSP83_DROSI6.445e-745.31Heat shock protein 83 (Fragment) OS=Drosophila sim... [more]
sp|O02192|HSP83_DROAV6.863e-745.31Heat shock protein 83 OS=Drosophila auraria OX=473... [more]
sp|P04811|HSP83_DROVI7.102e-745.31Heat shock protein 83 (Fragment) OS=Drosophila vir... [more]
sp|O16076|HSP83_DROPE7.274e-745.31Heat shock protein 83 (Fragment) OS=Drosophila per... [more]
back to top
BLAST of SMED30010610 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C0KTP78.197e-750.0090 kDa heat shock protein OS=Dugesia japonica OX=6... [more]
G4V9B85.216e-649.18Putative heat shock protein OS=Schistosoma mansoni... [more]
A0A183RMF85.297e-649.18HATPase_c domain-containing protein OS=Schistosoma... [more]
A0A448X2J25.441e-643.59HATPase_c domain-containing protein (Fragment) OS=... [more]
A0A3Q0KHG35.472e-649.18Putative heat shock protein OS=Schistosoma mansoni... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90aa1.26.984e-745.61Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.26.984e-745.61Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90ab19.640e-743.33heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.21.680e-658.33Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
hsp90aa1.21.680e-658.33Astyanax mexicanus heat shock protein HSP 90-alpha... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010610 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30010610 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
HSP901.216e-646.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30010610 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp90ab11.377e-645.00heat shock protein 90 alpha family class B member ... [more]
hsp90aa1.23.080e-645.00heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
hsp90aa1.23.130e-645.00heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
hsp90aa1.23.231e-643.33heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
hsp90aa1.23.232e-645.00heat shock protein HSP 90-alpha [Source:NCBI gene;... [more]
back to top
BLAST of SMED30010610 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000024822.11.087e-1051.56SMESG000024822.1[more]
SMESG000071533.12.031e-1050.00SMESG000071533.1[more]
SMESG000071531.12.187e-1050.00SMESG000071531.1[more]
SMESG000025598.12.527e-741.27SMESG000025598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30010610 ID=SMED30010610|Name=SMED30010610|organism=Schmidtea mediterranea sexual|type=transcript|length=721bp
GAGAGCTTTCAGTTGTTCCAGGTTAGCATTTGATTCTCTTTATCAATATT
ACTCCATAGGATGTTATCGATTGGAATTGTATATTGATTGATTAGGGTTC
CTCCTTCAGTTCCCCCATGGGATCTCTTTTTCAATAAATTATCATTTATT
ATTATTGAAATTTCACATTCGATAATGACAGAAATTATAAAGAATTGATG
ATAAAAGCATTGCACAACTTTTTTAATTTGATTCGAGTTTCGGGTTTCTA
TAATACTTGCATTTAATTGGCCACAAAATAAGACGAATAGAAATATAAGC
CAAATTGACCAATCATTGCAGGAGCTCCATGAAAACCTTAGTTCCAGATT
GTGCAATTGCATTGGAATTATAAATTGTCATTCCGAATCCAATATTAATT
ATTGCCAACGTTCCTGCAATTTTACCATCAGTGTCCAATACCGAATGATC
TGTTAAACATTTACATTGGGATAAACAAGTACGTCATTGGGATAGAGCGT
GTTGCGGTTGAGACTCAATAACTCAAATTGACCACAGTCGATTTAAAACC
CAAATTAAATCCCTAAATAATAACCACATACAAATAAAAATAAAAACCAT
AACATGAACTACAACGCCGCCACAATACCGTATCAATAATATGATGATAT
TGCTTTGAATTGAATCCTTATGGAATTGATTAGGTAAATATTCGAGAAAA
AAAATGAAATCGGATATAGTA
back to top

protein sequence of SMED30010610-orf-1

>SMED30010610-orf-1 ID=SMED30010610-orf-1|Name=SMED30010610-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=118bp
MQLHNLELRFSWSSCNDWSIWLIFLFVLFCGQLNASIIETRNSNQIKKVV
QCFYHQFFIISVIIECEISIIINDNLLKKRSHGGTEGGTLINQYTIPIDN
ILWSNIDKENQMLTWNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR003594HATPase_C